2YQPA

Solution structure of the zf-hit domain in dead (asp-glu-ala-asp) box polypeptide 59
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
GSSGSSGFSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase DDX59
publication title Solution structure of the zf-HIT domain in DEAD (Asp-Glu-Ala-Asp) box polypeptide 59
rcsb
source organism Homo sapiens
molecule tags Gene regulation, hydrolase
total genus 6
structure length 60
sequence length 60
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04438 zf-HIT HIT zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.220 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2yqpA00
2YQPA
chains in the Genus database with same CATH superfamily
1UHAA 2ELIA 2SGPI 4UXJA 3B4VC 4SGBI 2GIVA 1Q9BA 1HPTA 1BUSA 2KMRA 2LEOA 1YU6C 2LUYA 2ODDA 2ARPF 7WGAA 2LB7A 1OMTA 2GKRI 3SGQI 1AN1I 2ROWA 1TBOA 1Y1BA 2JW6A 5E3RA 2RC4A 2A20A 3E59A 1PJUA 2KMOA 1KBFA 1P9ZA 2UZ3A 4UXHA 2CWGA 1IY6A 4UXIA 4E1RA 3QTLD 2NU0I 3OXGA 1SGYI 2X52A 3QWPA 2ERWA 1XBTA 2NU3I 3HH2C 1NUBA 4DNCA 5FUYA 1V1HA 1KBEA 2QQEA 1H0ZA 2ORVA 2CWFA 1W4RA 2M5XA 2ENZA 1SGQI 1CT4I 2PQ8A 4WP4A 2J9RA 2W0TA 1CGII 5E3PA 2N1AB 1HDLA 1MJ9A 3TOAA 2JYYA 1TUSA 2DB6A 2SGQI 1FAQA 4L9MA 3R5BA 1SGNI 2NU4I 1LR8A 1Y8FA 1TBNA 2SGDI 2UVOA 1CE3A 1SGDI 5CCMA 1CT0I 5FUVA 3FC3A 1UVGA 1R79A 1WGCA 2WVJA 4OVOA 2E73A 1S20A 2P6AC 5DAEA 5HI7A 1OYVI 1TOTA 1NXUA 1K7UA 1BMOA 2OU2A 2ORWA 1CSOI 2XRCA 1FARA 1SGRI 2YQPA 3SGBI 3UEYA 1CGJI 1TBRR 2L8EA 1M8BA 2JXDA 2V53A 1V1IA 3OXFA 3TOBA 4MPIA 5EX3A 3TO7A 1FYBA 2GKVA 4JCVE 1P9GA 9WGAA 3TJQA 2DIPA 2FNFX 2L7XA 1ULMA 1TGSI 1MT1A 2J87A 2B0UC 2NU1I 3OL0A 5CCLA 1SGEI 1VDDA 2VRWB 5JHWC 1IW4A 1TURA 1IY5A 5EX0A 1TIHA 1WGTA 2DKVA 2QQCA 1PPFI 3R5CA 4HGUA 3R5AA 2Y0MA 1CHOI 3FSYA 4A24A 2V1CC 1PTRA 1FY7A 2CWHA 2V1CA 1HEVA 1XX6A 3RU0A 1R0RI 2F3CI 3UFFA 2N52A 2SGEI 2OD1A 3QAHA 3VE5A 3GOXA 1CT2I 1WTJA 2N17A 1K7TA 2WGCA 1YTPA 2K9HA 3UGLA 1OVOA 1K7VA 1Z2IA 5FUXA 3VDUA 4E1PA 5FUWA 2KCXA 2KMQA 1N13A 2E5RA 2NU2I 2QPOA 2B8TA 3PDNA 2JA1A 2X3TA 3E2IA 3UEJA 1MJAA 4AMLA 1OMUA 5E3QA 2GKTI 2JZMA 1PTQA 3D00A 4B6DA 2SGFI 1RFHA 2OVOA 3R5DA 1WKXA 1DS2I 1PCEA 3UGDA 1ULNA 1MJBA 3VDPA 1Z7KB 1X74A 2ENNA 1TBQR 3UOEA 1ULKA 1LR9A 1UUCA 1SGPI 1LR7A 3KY9A 1U5KA 2N71A 4GI3C 1HJAI 3OXLA 4FKDA 1UVFA 1KMAA 1XA6A 2WCYA 2KMPA 5HQ8A 3UGIA 1M8CA 3OVOA 5J8FA 2RIJA 3TO6A 2OZUA 2QQDA 3FSXA 2QQ0A 2CJSC 1DS3I 1Y1CA 3SEKC 1W3SA 3MEKA 3TO9A 3BJIA 1X4SA 2BUSA 2YUUA 2GVIA 3CXLA 5J8CA
chains in the Genus database with same CATH topology
2ELIA 2SGPI 4UXJA 3B4VC 4SGBI 1HPTA 1BUSA 2KMRA 2LEOA 1YU6C 2LUYA 2ODDA 2ARPF 1OMTA 2GKRI 3SGQI 1AN1I 2ROWA 1TBOA 1Y1BA 2JW6A 2A20A 3E59A 1PJUA 2KMOA 1KBFA 2UZ3A 4UXHA 1IY6A 4UXIA 4E1RA 3QTLD 2NU0I 3OXGA 1SGYI 3QWPA 2ERWA 1XBTA 2NU3I 3HH2C 1NUBA 5FUYA 1V1HA 1KBEA 2QQEA 1H0ZA 2ORVA 1W4RA 2M5XA 2ENZA 1SGQI 1CT4I 2J9RA 2W0TA 1CGII 2N1AB 1HDLA 2JYYA 1TUSA 2DB6A 2SGQI 4L9MA 1SGNI 2NU4I 1LR8A 1Y8FA 1TBNA 2SGDI 1CE3A 1SGDI 5CCMA 1CT0I 5FUVA 3FC3A 1UVGA 1R79A 2WVJA 4OVOA 2E73A 2P6AC 5DAEA 5HI7A 1OYVI 1TOTA 1BMOA 2ORWA 1CSOI 2XRCA 1FARA 1SGRI 2YQPA 3SGBI 3UEYA 1CGJI 1TBRR 2L8EA 1M8BA 2JXDA 2V53A 1V1IA 3OXFA 1FAQA 1FYBA 5EX3A 2GKVA 4JCVE 3TJQA 2DIPA 2FNFX 2L7XA 1TGSI 1MT1A 2J87A 2B0UC 2NU1I 3OL0A 5CCLA 1SGEI 1VDDA 2VRWB 5JHWC 1IW4A 1TURA 1IY5A 5EX0A 1TIHA 4HGUA 2QQCA 1PPFI 1CHOI 4A24A 2V1CC 1PTRA 2V1CA 1XX6A 3RU0A 1R0RI 2F3CI 3UFFA 2N52A 2SGEI 2OD1A 3VE5A 3GOXA 1CT2I 2N17A 1YTPA 2K9HA 3UGLA 1OVOA 5FUXA 3VDUA 4E1PA 5FUWA 2KCXA 2KMQA 1N13A 2E5RA 2NU2I 2QPOA 2B8TA 3PDNA 2JA1A 3E2IA 3UEJA 1OMUA 4B6DA 2GKTI 2JZMA 1PTQA 3D00A 2SGFI 1RFHA 2OVOA 1DS2I 1PCEA 3UGDA 3VDPA 1Z7KB 1X74A 2ENNA 1TBQR 1LR9A 1UUCA 1SGPI 1LR7A 3KY9A 1U5KA 2N71A 4GI3C 1HJAI 3OXLA 4FKDA 1UVFA 1KMAA 1XA6A 2WCYA 2KMPA 5HQ8A 3UGIA 1M8CA 3OVOA 2QQDA 2QQ0A 2CJSC 1DS3I 1Y1CA 3SEKC 1W3SA 3MEKA 3BJIA 1X4SA 2BUSA 2YUUA 2GVIA 3CXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQP A; 
#chains in the Genus database with same CATH topology
 1UHA A;  2ELI A;  2SGP I;  4UXJ A;  3B4V C;  4SGB I;  2GIV A;  1Q9B A;  1HPT A;  1BUS A;  2KMR A;  2LEO A;  1YU6 C;  2LUY A;  2ODD A;  2ARP F;  7WGA A;  2LB7 A;  1OMT A;  2GKR I;  3SGQ I;  1AN1 I;  2ROW A;  1TBO A;  1Y1B A;  2JW6 A;  5E3R A;  2RC4 A;  2A20 A;  3E59 A;  1PJU A;  2KMO A;  1KBF A;  1P9Z A;  2UZ3 A;  4UXH A;  2CWG A;  1IY6 A;  4UXI A;  4E1R A;  3QTL D;  2NU0 I;  3OXG A;  1SGY I;  2X52 A;  3QWP A;  2ERW A;  1XBT A;  2NU3 I;  3HH2 C;  1NUB A;  4DNC A;  5FUY A;  1V1H A;  1KBE A;  2QQE A;  1H0Z A;  2ORV A;  2CWF A;  1W4R A;  2M5X A;  2ENZ A;  1SGQ I;  1CT4 I;  2PQ8 A;  4WP4 A;  2J9R A;  2W0T A;  1CGI I;  5E3P A;  2N1A B;  1HDL A;  1MJ9 A;  3TOA A;  2JYY A;  1TUS A;  2DB6 A;  2SGQ I;  1FAQ A;  4L9M A;  3R5B A;  1SGN I;  2NU4 I;  1LR8 A;  1Y8F A;  1TBN A;  2SGD I;  2UVO A;  1CE3 A;  1SGD I;  5CCM A;  1CT0 I;  5FUV A;  3FC3 A;  1UVG A;  1R79 A;  1WGC A;  2WVJ A;  4OVO A;  2E73 A;  1S20 A;  2P6A C;  5DAE A;  5HI7 A;  1OYV I;  1TOT A;  1NXU A;  1K7U A;  1BMO A;  2OU2 A;  2ORW A;  1CSO I;  2XRC A;  1FAR A;  1SGR I;  2YQP A;  3SGB I;  3UEY A;  1CGJ I;  1TBR R;  2L8E A;  1M8B A;  2JXD A;  2V53 A;  1V1I A;  3OXF A;  3TOB A;  4MPI A;  5EX3 A;  3TO7 A;  1FYB A;  2GKV A;  4JCV E;  1P9G A;  9WGA A;  3TJQ A;  2DIP A;  2FNF X;  2L7X A;  1ULM A;  1TGS I;  1MT1 A;  2J87 A;  2B0U C;  2NU1 I;  3OL0 A;  5CCL A;  1SGE I;  1VDD A;  2VRW B;  5JHW C;  1IW4 A;  1TUR A;  1IY5 A;  5EX0 A;  1TIH A;  1WGT A;  2DKV A;  2QQC A;  1PPF I;  3R5C A;  4HGU A;  3R5A A;  2Y0M A;  1CHO I;  3FSY A;  4A24 A;  2V1C C;  1PTR A;  1FY7 A;  2CWH A;  2V1C A;  1HEV A;  1XX6 A;  3RU0 A;  1R0R I;  2F3C I;  3UFF A;  2N52 A;  2SGE I;  2OD1 A;  3QAH A;  3VE5 A;  3GOX A;  1CT2 I;  1WTJ A;  2N17 A;  1K7T A;  2WGC A;  1YTP A;  2K9H A;  3UGL A;  1OVO A;  1K7V A;  1Z2I A;  5FUX A;  3VDU A;  4E1P A;  5FUW A;  2KCX A;  2KMQ A;  1N13 A;  2E5R A;  2NU2 I;  2QPO A;  2B8T A;  3PDN A;  2JA1 A;  2X3T A;  3E2I A;  3UEJ A;  1MJA A;  4AML A;  1OMU A;  5E3Q A;  2GKT I;  2JZM A;  1PTQ A;  3D00 A;  4B6D A;  2SGF I;  1RFH A;  2OVO A;  3R5D A;  1WKX A;  1DS2 I;  1PCE A;  3UGD A;  1ULN A;  1MJB A;  3VDP A;  1Z7K B;  1X74 A;  2ENN A;  1TBQ R;  3UOE A;  1ULK A;  1LR9 A;  1UUC A;  1SGP I;  1LR7 A;  3KY9 A;  1U5K A;  2N71 A;  4GI3 C;  1HJA I;  3OXL A;  4FKD A;  1UVF A;  1KMA A;  1XA6 A;  2WCY A;  2KMP A;  5HQ8 A;  3UGI A;  1M8C A;  3OVO A;  5J8F A;  2RIJ A;  3TO6 A;  2OZU A;  2QQD A;  3FSX A;  2QQ0 A;  2CJS C;  1DS3 I;  1Y1C A;  3SEK C;  1W3S A;  3MEK A;  3TO9 A;  3BJI A;  1X4S A;  2BUS A;  2YUU A;  2GVI A;  3CXL A;  5J8C A; 
#chains in the Genus database with same CATH homology
 2ELI A;  2SGP I;  4UXJ A;  3B4V C;  4SGB I;  1HPT A;  1BUS A;  2KMR A;  2LEO A;  1YU6 C;  2LUY A;  2ODD A;  2ARP F;  1OMT A;  2GKR I;  3SGQ I;  1AN1 I;  2ROW A;  1TBO A;  1Y1B A;  2JW6 A;  2A20 A;  3E59 A;  1PJU A;  2KMO A;  1KBF A;  2UZ3 A;  4UXH A;  1IY6 A;  4UXI A;  4E1R A;  3QTL D;  2NU0 I;  3OXG A;  1SGY I;  3QWP A;  2ERW A;  1XBT A;  2NU3 I;  3HH2 C;  1NUB A;  5FUY A;  1V1H A;  1KBE A;  2QQE A;  1H0Z A;  2ORV A;  1W4R A;  2M5X A;  2ENZ A;  1SGQ I;  1CT4 I;  2J9R A;  2W0T A;  1CGI I;  2N1A B;  1HDL A;  2JYY A;  1TUS A;  2DB6 A;  2SGQ I;  4L9M A;  1SGN I;  2NU4 I;  1LR8 A;  1Y8F A;  1TBN A;  2SGD I;  1CE3 A;  1SGD I;  5CCM A;  1CT0 I;  5FUV A;  3FC3 A;  1UVG A;  1R79 A;  2WVJ A;  4OVO A;  2E73 A;  2P6A C;  5DAE A;  5HI7 A;  1OYV I;  1TOT A;  1BMO A;  2ORW A;  1CSO I;  2XRC A;  1FAR A;  1SGR I;  2YQP A;  3SGB I;  3UEY A;  1CGJ I;  1TBR R;  2L8E A;  1M8B A;  2JXD A;  2V53 A;  1V1I A;  3OXF A;  1FAQ A;  1FYB A;  5EX3 A;  2GKV A;  4JCV E;  3TJQ A;  2DIP A;  2FNF X;  2L7X A;  1TGS I;  1MT1 A;  2J87 A;  2B0U C;  2NU1 I;  3OL0 A;  5CCL A;  1SGE I;  1VDD A;  2VRW B;  5JHW C;  1IW4 A;  1TUR A;  1IY5 A;  5EX0 A;  1TIH A;  4HGU A;  2QQC A;  1PPF I;  1CHO I;  4A24 A;  2V1C C;  1PTR A;  2V1C A;  1XX6 A;  3RU0 A;  1R0R I;  2F3C I;  3UFF A;  2N52 A;  2SGE I;  2OD1 A;  3VE5 A;  3GOX A;  1CT2 I;  2N17 A;  1YTP A;  2K9H A;  3UGL A;  1OVO A;  5FUX A;  3VDU A;  4E1P A;  5FUW A;  2KCX A;  2KMQ A;  1N13 A;  2E5R A;  2NU2 I;  2QPO A;  2B8T A;  3PDN A;  2JA1 A;  3E2I A;  3UEJ A;  1OMU A;  4B6D A;  2GKT I;  2JZM A;  1PTQ A;  3D00 A;  2SGF I;  1RFH A;  2OVO A;  1DS2 I;  1PCE A;  3UGD A;  3VDP A;  1Z7K B;  1X74 A;  2ENN A;  1TBQ R;  1LR9 A;  1UUC A;  1SGP I;  1LR7 A;  3KY9 A;  1U5K A;  2N71 A;  4GI3 C;  1HJA I;  3OXL A;  4FKD A;  1UVF A;  1KMA A;  1XA6 A;  2WCY A;  2KMP A;  5HQ8 A;  3UGI A;  1M8C A;  3OVO A;  2QQD A;  2QQ0 A;  2CJS C;  1DS3 I;  1Y1C A;  3SEK C;  1W3S A;  3MEK A;  3BJI A;  1X4S A;  2BUS A;  2YUU A;  2GVI A;  3CXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...