2YQPA

Solution structure of the zf-hit domain in dead (asp-glu-ala-asp) box polypeptide 59
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
GSSGSSGFSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation, hydrolase
molecule keywords Probable ATP-dependent RNA helicase DDX59
publication title Solution structure of the zf-HIT domain in DEAD (Asp-Glu-Ala-Asp) box polypeptide 59
rcsb
source organism Homo sapiens
total genus 6
structure length 60
sequence length 60
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04438 zf-HIT HIT zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.220 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2yqpA00
2YQPA
chains in the Genus database with same CATH superfamily
1XX6A 3FSXA 1Z7KB 3OXGA 3MEKA 4AMLA 1TURA 4B6DA 2NU3I 1DS3I 1Q9BA 3UEYA 1LR8A 1PTQA 2JA1A 1NXUA 2QPOA 3HH2C 2GIVA 1OVOA 3TO6A 1UVGA 1YTPA 2OVOA 3BJIA 2KMRA 5E3RA 4DNCA 2DIPA 9WGAA 2CWFA 2BUSA 1CE3A 1ULKA 4UXIA 5FUWA 1P9ZA 2ARPF 5EX3A 4E1PA 1HPTA 1TIHA 1MJ9A 3CXLA 2OD1A 3OL0A 5J8CA 1K7VA 1XBTA 2WCYA 1CGJI 1OMUA 1TGSI 1HJAI 2KMQA 1CT4I 3VDPA 1FY7A 2KMOA 1FYBA 1CGII 4GI3C 2QQDA 3KY9A 2OU2A 2YUUA 1TBNA 2GVIA 3UGDA 3TO7A 1FARA 3VE5A 2A20A 1CT2I 3SEKC 1Y8FA 3FC3A 5CCMA 1KBFA 2M5XA 2ORWA 3SGBI 1TBRR 2E5RA 5J8FA 2JW6A 2N17A 1ULNA 3TJQA 1YU6C 2ERWA 2DKVA 1U5KA 3OVOA 3R5DA 1MT1A 2SGPI 3E59A 4E1RA 1KMAA 1CHOI 1SGRI 2GKTI 2J87A 2E73A 2B0UC 1RFHA 2PQ8A 1R0RI 2VRWB 3UFFA 5HQ8A 1M8BA 2KCXA 2N1AB 1VDDA 3RU0A 2ODDA 1SGYI 3R5BA 1SGEI 1SGDI 3UGLA 1CT0I 1ULMA 2JZMA 1W4RA 1UUCA 2OZUA 2YQPA 2ELIA 4L9MA 1XA6A 2GKVA 1MJAA 1NUBA 1V1IA 3UOEA 2J9RA 2QQEA 2SGEI 2UZ3A 1SGNI 3OXLA 2B8TA 1CSOI 1S20A 2XRCA 2L7XA 2X52A 4WP4A 2SGDI 1M8CA 1V1HA 2LUYA 2RIJA 1X74A 4SGBI 1K7TA 2GKRI 3GOXA 3QWPA 2QQCA 1LR7A 1WKXA 1SGPI 5FUVA 1WTJA 2SGQI 2WVJA 4UXJA 1IY5A 3PDNA 1HDLA 1Y1CA 1OYVI 2JXDA 2SGFI 4JCVE 2UVOA 7WGAA 1BMOA 1BUSA 2P6AC 3B4VC 1PCEA 2WGCA 1TOTA 1HEVA 1PJUA 1TBOA 4UXHA 3SGQI 1UHAA 4A24A 1N13A 3TOAA 2Y0MA 2ENZA 2F3CI 3OXFA 1PPFI 1OMTA 1KBEA 1UVFA 1X4SA 2RC4A 2ROWA 1DS2I 3VDUA 1R79A 5DAEA 5JHWC 1FAQA 1AN1I 2FNFX 2LB7A 1W3SA 2X3TA 3FSYA 2W0TA 3UGIA 2CWGA 2L8EA 3TO9A 1LR9A 1MJBA 1PTRA 2V1CC 2K9HA 2V53A 3UEJA 1K7UA 2CJSC 1WGTA 1H0ZA 5FUXA 2N71A 1P9GA 4FKDA 3E2IA 1IW4A 1WGCA 2DB6A 2NU4I 5CCLA 1SGQI 1TBQR 2NU2I 4MPIA 2QQ0A 2CWHA 5EX0A 2ENNA 2LEOA 1TUSA 4HGUA 2JYYA 3TOBA 3R5AA 3D00A 2NU0I 3R5CA 4OVOA 3QAHA 5E3PA 5FUYA 1Y1BA 1IY6A 2NU1I 2N52A 5E3QA 2KMPA 3QTLD 2ORVA 1Z2IA 2V1CA 5HI7A
chains in the Genus database with same CATH topology
1XX6A 1Z7KB 3OXGA 3MEKA 4B6DA 1TURA 2NU3I 1DS3I 3UEYA 1LR8A 1PTQA 2JA1A 2QPOA 3HH2C 1OVOA 1UVGA 1YTPA 2OVOA 3BJIA 2KMRA 2DIPA 2BUSA 1CE3A 4UXIA 5FUWA 5EX3A 4E1PA 1HPTA 1TIHA 3CXLA 3OL0A 2OD1A 1XBTA 2WCYA 1CGJI 1OMUA 1TGSI 1HJAI 2KMQA 1CT4I 3VDPA 2KMOA 1FYBA 1CGII 4GI3C 2QQDA 3KY9A 2YUUA 1TBNA 2GVIA 3UGDA 3VE5A 1FARA 2A20A 1CT2I 3SEKC 1Y8FA 3FC3A 5CCMA 1KBFA 2M5XA 2ORWA 3SGBI 1TBRR 2E5RA 2JW6A 2N17A 3TJQA 1YU6C 2ERWA 1U5KA 3OVOA 4E1RA 1MT1A 2SGPI 3E59A 1KMAA 1CHOI 1SGRI 2GKTI 2J87A 2E73A 2B0UC 1RFHA 2VRWB 1R0RI 3UFFA 5HQ8A 1M8BA 2KCXA 2N1AB 1VDDA 3RU0A 2ODDA 1SGYI 1SGEI 1SGDI 3UGLA 1CT0I 2JZMA 1W4RA 1UUCA 2YQPA 4L9MA 2ELIA 1XA6A 2GKVA 1NUBA 1V1IA 2J9RA 2QQEA 2SGEI 2UZ3A 1SGNI 3OXLA 2B8TA 1CSOI 2XRCA 2L7XA 2SGDI 1M8CA 1V1HA 2LUYA 1X74A 4SGBI 2GKRI 3GOXA 3QWPA 2QQCA 1LR7A 1SGPI 5FUVA 2WVJA 2SGQI 4UXJA 1HDLA 3PDNA 1Y1CA 1OYVI 2JXDA 2SGFI 4JCVE 1BUSA 1BMOA 2P6AC 3B4VC 1PCEA 1TOTA 1PJUA 1TBOA 4UXHA 3SGQI 4A24A 1N13A 2ENZA 2F3CI 3OXFA 1PPFI 1X4SA 1KBEA 1OMTA 1UVFA 2ROWA 1DS2I 3VDUA 1R79A 5DAEA 5JHWC 1FAQA 1AN1I 2FNFX 3UGIA 1W3SA 2W0TA 2L8EA 1IY5A 1LR9A 1PTRA 2V1CC 2V53A 2K9HA 3UEJA 1H0ZA 2CJSC 5FUXA 2N71A 4FKDA 3E2IA 1IW4A 2DB6A 2NU4I 5CCLA 1SGQI 1TBQR 2NU2I 2QQ0A 5EX0A 2ENNA 2LEOA 1TUSA 4HGUA 2JYYA 4OVOA 3D00A 2NU0I 5FUYA 1Y1BA 1IY6A 2NU1I 2N52A 2KMPA 3QTLD 2ORVA 2ARPF 2V1CA 5HI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQP A; 
#chains in the Genus database with same CATH topology
 1XX6 A;  3FSX A;  1Z7K B;  3OXG A;  3MEK A;  4AML A;  1TUR A;  4B6D A;  2NU3 I;  1DS3 I;  1Q9B A;  3UEY A;  1LR8 A;  1PTQ A;  2JA1 A;  1NXU A;  2QPO A;  3HH2 C;  2GIV A;  1OVO A;  3TO6 A;  1UVG A;  1YTP A;  2OVO A;  3BJI A;  2KMR A;  5E3R A;  4DNC A;  2DIP A;  9WGA A;  2CWF A;  2BUS A;  1CE3 A;  1ULK A;  4UXI A;  5FUW A;  1P9Z A;  2ARP F;  5EX3 A;  4E1P A;  1HPT A;  1TIH A;  1MJ9 A;  3CXL A;  2OD1 A;  3OL0 A;  5J8C A;  1K7V A;  1XBT A;  2WCY A;  1CGJ I;  1OMU A;  1TGS I;  1HJA I;  2KMQ A;  1CT4 I;  3VDP A;  1FY7 A;  2KMO A;  1FYB A;  1CGI I;  4GI3 C;  2QQD A;  3KY9 A;  2OU2 A;  2YUU A;  1TBN A;  2GVI A;  3UGD A;  3TO7 A;  1FAR A;  3VE5 A;  2A20 A;  1CT2 I;  3SEK C;  1Y8F A;  3FC3 A;  5CCM A;  1KBF A;  2M5X A;  2ORW A;  3SGB I;  1TBR R;  2E5R A;  5J8F A;  2JW6 A;  2N17 A;  1ULN A;  3TJQ A;  1YU6 C;  2ERW A;  2DKV A;  1U5K A;  3OVO A;  3R5D A;  1MT1 A;  2SGP I;  3E59 A;  4E1R A;  1KMA A;  1CHO I;  1SGR I;  2GKT I;  2J87 A;  2E73 A;  2B0U C;  1RFH A;  2PQ8 A;  1R0R I;  2VRW B;  3UFF A;  5HQ8 A;  1M8B A;  2KCX A;  2N1A B;  1VDD A;  3RU0 A;  2ODD A;  1SGY I;  3R5B A;  1SGE I;  1SGD I;  3UGL A;  1CT0 I;  1ULM A;  2JZM A;  1W4R A;  1UUC A;  2OZU A;  2YQP A;  2ELI A;  4L9M A;  1XA6 A;  2GKV A;  1MJA A;  1NUB A;  1V1I A;  3UOE A;  2J9R A;  2QQE A;  2SGE I;  2UZ3 A;  1SGN I;  3OXL A;  2B8T A;  1CSO I;  1S20 A;  2XRC A;  2L7X A;  2X52 A;  4WP4 A;  2SGD I;  1M8C A;  1V1H A;  2LUY A;  2RIJ A;  1X74 A;  4SGB I;  1K7T A;  2GKR I;  3GOX A;  3QWP A;  2QQC A;  1LR7 A;  1WKX A;  1SGP I;  5FUV A;  1WTJ A;  2SGQ I;  2WVJ A;  4UXJ A;  1IY5 A;  3PDN A;  1HDL A;  1Y1C A;  1OYV I;  2JXD A;  2SGF I;  4JCV E;  2UVO A;  7WGA A;  1BMO A;  1BUS A;  2P6A C;  3B4V C;  1PCE A;  2WGC A;  1TOT A;  1HEV A;  1PJU A;  1TBO A;  4UXH A;  3SGQ I;  1UHA A;  4A24 A;  1N13 A;  3TOA A;  2Y0M A;  2ENZ A;  2F3C I;  3OXF A;  1PPF I;  1OMT A;  1KBE A;  1UVF A;  1X4S A;  2RC4 A;  2ROW A;  1DS2 I;  3VDU A;  1R79 A;  5DAE A;  5JHW C;  1FAQ A;  1AN1 I;  2FNF X;  2LB7 A;  1W3S A;  2X3T A;  3FSY A;  2W0T A;  3UGI A;  2CWG A;  2L8E A;  3TO9 A;  1LR9 A;  1MJB A;  1PTR A;  2V1C C;  2K9H A;  2V53 A;  3UEJ A;  1K7U A;  2CJS C;  1WGT A;  1H0Z A;  5FUX A;  2N71 A;  1P9G A;  4FKD A;  3E2I A;  1IW4 A;  1WGC A;  2DB6 A;  2NU4 I;  5CCL A;  1SGQ I;  1TBQ R;  2NU2 I;  4MPI A;  2QQ0 A;  2CWH A;  5EX0 A;  2ENN A;  2LEO A;  1TUS A;  4HGU A;  2JYY A;  3TOB A;  3R5A A;  3D00 A;  2NU0 I;  3R5C A;  4OVO A;  3QAH A;  5E3P A;  5FUY A;  1Y1B A;  1IY6 A;  2NU1 I;  2N52 A;  5E3Q A;  2KMP A;  3QTL D;  2ORV A;  1Z2I A;  2V1C A;  5HI7 A; 
#chains in the Genus database with same CATH homology
 1XX6 A;  1Z7K B;  3OXG A;  3MEK A;  4B6D A;  1TUR A;  2NU3 I;  1DS3 I;  3UEY A;  1LR8 A;  1PTQ A;  2JA1 A;  2QPO A;  3HH2 C;  1OVO A;  1UVG A;  1YTP A;  2OVO A;  3BJI A;  2KMR A;  2DIP A;  2BUS A;  1CE3 A;  4UXI A;  5FUW A;  5EX3 A;  4E1P A;  1HPT A;  1TIH A;  3CXL A;  3OL0 A;  2OD1 A;  1XBT A;  2WCY A;  1CGJ I;  1OMU A;  1TGS I;  1HJA I;  2KMQ A;  1CT4 I;  3VDP A;  2KMO A;  1FYB A;  1CGI I;  4GI3 C;  2QQD A;  3KY9 A;  2YUU A;  1TBN A;  2GVI A;  3UGD A;  3VE5 A;  1FAR A;  2A20 A;  1CT2 I;  3SEK C;  1Y8F A;  3FC3 A;  5CCM A;  1KBF A;  2M5X A;  2ORW A;  3SGB I;  1TBR R;  2E5R A;  2JW6 A;  2N17 A;  3TJQ A;  1YU6 C;  2ERW A;  1U5K A;  3OVO A;  4E1R A;  1MT1 A;  2SGP I;  3E59 A;  1KMA A;  1CHO I;  1SGR I;  2GKT I;  2J87 A;  2E73 A;  2B0U C;  1RFH A;  2VRW B;  1R0R I;  3UFF A;  5HQ8 A;  1M8B A;  2KCX A;  2N1A B;  1VDD A;  3RU0 A;  2ODD A;  1SGY I;  1SGE I;  1SGD I;  3UGL A;  1CT0 I;  2JZM A;  1W4R A;  1UUC A;  2YQP A;  4L9M A;  2ELI A;  1XA6 A;  2GKV A;  1NUB A;  1V1I A;  2J9R A;  2QQE A;  2SGE I;  2UZ3 A;  1SGN I;  3OXL A;  2B8T A;  1CSO I;  2XRC A;  2L7X A;  2SGD I;  1M8C A;  1V1H A;  2LUY A;  1X74 A;  4SGB I;  2GKR I;  3GOX A;  3QWP A;  2QQC A;  1LR7 A;  1SGP I;  5FUV A;  2WVJ A;  2SGQ I;  4UXJ A;  1HDL A;  3PDN A;  1Y1C A;  1OYV I;  2JXD A;  2SGF I;  4JCV E;  1BUS A;  1BMO A;  2P6A C;  3B4V C;  1PCE A;  1TOT A;  1PJU A;  1TBO A;  4UXH A;  3SGQ I;  4A24 A;  1N13 A;  2ENZ A;  2F3C I;  3OXF A;  1PPF I;  1X4S A;  1KBE A;  1OMT A;  1UVF A;  2ROW A;  1DS2 I;  3VDU A;  1R79 A;  5DAE A;  5JHW C;  1FAQ A;  1AN1 I;  2FNF X;  3UGI A;  1W3S A;  2W0T A;  2L8E A;  1IY5 A;  1LR9 A;  1PTR A;  2V1C C;  2V53 A;  2K9H A;  3UEJ A;  1H0Z A;  2CJS C;  5FUX A;  2N71 A;  4FKD A;  3E2I A;  1IW4 A;  2DB6 A;  2NU4 I;  5CCL A;  1SGQ I;  1TBQ R;  2NU2 I;  2QQ0 A;  5EX0 A;  2ENN A;  2LEO A;  1TUS A;  4HGU A;  2JYY A;  4OVO A;  3D00 A;  2NU0 I;  5FUY A;  1Y1B A;  1IY6 A;  2NU1 I;  2N52 A;  2KMP A;  3QTL D;  2ORV A;  2ARP F;  2V1C A;  5HI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...