2ERWA

Crystal structure of infestin 4, a factor xiia inhibitor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
53
structure length
53
Chain Sequence
NPCACFRNYVPVCGSDGKTYGNPCMLNCAAQTKVPGLKLVHEGRCQRSNVEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords serine protease inhibitor infestin
publication title The Kazal-type inhibitors infestins 1 and 4 differ in specificity but are similar in three-dimensional structure.
pubmed doi rcsb
source organism Triatoma infestans
molecule tags Blood clotting, hydrolase inhibitor
total genus 14
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2005-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2erwA00
1Y1CA 2JYYA 1DS3I 3OVOA 1CT2I 3QTLD 1SGYI 2M5XA 1SGRI 1TUSA 1KMAA 2N71A 1OYVI 1SGNI 2QQCA 1FYBA 1SGQI 1CSOI 1TBRR 2NU4I 2NU0I 1Y1BA 4OVOA 1UVFA 2SGEI 1BUSA 2KMOA 2ERWA 2N52A 1CE3A 1H0ZA 1CHOI 2GKRI 1DS2I 2BUSA 2F3CI 1PPFI 1R0RI 3TJQA 1Z7KB 1MT1A 3SGQI 1TGSI 1SGDI 1M8CA 2GKTI 4GI3C 1LR9A 1LR7A 1UUCA 3SEKC 2KMPA 2B0UC 2N17A 2SGPI 2NU2I 1IW4A 1HPTA 4HGUA 1YU6C 1HJAI 1OVOA 2KMRA 2V53A 5JHWC 1IY5A 1PJUA 1CGJI 1PCEA 2NU1I 1CT4I 4SGBI 2JXDA 1N13A 1NUBA 1LR8A 2ARPF 2SGFI 3B4VC 1YTPA 2LEOA 3SGBI 2NU3I 1TBQR 1SGPI 1CT0I 1TIHA 1M8BA 2KCXA 1OMUA 1HDLA 2P6AC 1SGEI 5DAEA 2SGQI 1TURA 2GKVA 1AN1I 2SGDI 2WCYA 1CGII 2OVOA 3HH2C 2JZMA 1IY6A 2XRCA 1BMOA 1UVGA 1OMTA 2QQDA 2KMQA
chains in the Genus database with same CATH superfamily
3OL0A 1Y1CA 5HI7A 2YQPA 2JYYA 1DS3I 3OVOA 1CT2I 3QTLD 4MPIA 5FUXA 1SGYI 2M5XA 3RU0A 1S20A 1KBEA 1FAQA 5J8CA 1SGRI 1TUSA 1PTRA 1R79A 1MJ9A 2WVJA 2QPOA 4E1RA 2YUUA 2DIPA 4E1PA 3E2IA 3QWPA 2N71A 1OYVI 1SGNI 5FUVA 1KMAA 2QQCA 1FYBA 2L7XA 9WGAA 3PDNA 3R5AA 5EX0A 2J87A 5E3PA 1SGQI 4A24A 1CSOI 5FUWA 3FSYA 2DKVA 4UXJA 1TBRR 2NU4I 3UGIA 1PTQA 5J8FA 1K7UA 2NU0I 3UOEA 2A20A 1Y1BA 4OVOA 2QQ0A 3OXLA 4AMLA 1UVFA 2SGEI 1BUSA 1ULNA 2KMOA 2ERWA 2X3TA 2UZ3A 1V1IA 2N52A 1CE3A 4L9MA 2ENNA 1NXUA 2CWHA 2GIVA 2B8TA 2RC4A 2ODDA 4B6DA 1H0ZA 1CHOI 2ROWA 2V1CC 4UXHA 2GKRI 1DS2I 3OXGA 7WGAA 1X74A 1TOTA 3CXLA 2BUSA 1MJAA 2F3CI 2V1CA 1PPFI 1R0RI 3UFFA 2LUYA 3TJQA 1Z7KB 1MT1A 3SGQI 1TGSI 2E5RA 2RIJA 1SGDI 1M8CA 2GKTI 2DB6A 3TOAA 1TBOA 3GOXA 1MJBA 2JW6A 3R5BA 5CCMA 3R5CA 1RFHA 4GI3C 3TO9A 1LR9A 1LR7A 1V1HA 1FARA 1UUCA 3SEKC 2KMPA 5E3QA 2B0UC 1U5KA 5FUYA 3FSXA 2N17A 2SGPI 3TO6A 2NU2I 4WP4A 3TOBA 2ELIA 3FC3A 3UGLA 3R5DA 3E59A 1Z2IA 2W0TA 3VE5A 1IW4A 2CJSC 1HPTA 5EX3A 3TO7A 3KY9A 4HGUA 1YU6C 1HJAI 1OVOA 1W4RA 2CWGA 2KMRA 2V53A 2UVOA 2Y0MA 1FY7A 5JHWC 1IY5A 1PJUA 1XBTA 1CGJI 1PCEA 2NU1I 2CWFA 1CT4I 1K7VA 4SGBI 2FNFX 2J9RA 2JXDA 2L8EA 1N13A 2QQEA 2WGCA 1W3SA 1WGCA 1X4SA 2LB7A 1ULKA 1NUBA 1LR8A 2ARPF 2SGFI 3B4VC 1YTPA 2OU2A 2GVIA 1WTJA 1ULMA 1Y8FA 2LEOA 3SGBI 2NU3I 1TBQR 3VDPA 1SGPI 1WGTA 1CT0I 1TIHA 1XA6A 4DNCA 1M8BA 1P9GA 2OZUA 2K9HA 2KCXA 1KBFA 1OMUA 2X52A 3UEJA 1TBNA 4FKDA 1K7TA 3D00A 1HDLA 2PQ8A 3VDUA 2P6AC 3UGDA 2VRWB 4JCVE 2N1AB 3MEKA 1SGEI 2JA1A 5DAEA 2SGQI 1HEVA 3UEYA 2ORWA 1TURA 2GKVA 1AN1I 1VDDA 2ORVA 2SGDI 3QAHA 5HQ8A 2WCYA 4UXIA 2OD1A 1CGII 2E73A 2OVOA 3HH2C 2JZMA 3BJIA 1IY6A 1XX6A 2ENZA 2XRCA 1UHAA 5CCLA 1P9ZA 1BMOA 1UVGA 1Q9BA 1OMTA 3OXFA 1WKXA 5E3RA 2QQDA 2KMQA
chains in the Genus database with same CATH topology
3OL0A 1Y1CA 5HI7A 2YQPA 2JYYA 1DS3I 3OVOA 1CT2I 3QTLD 5FUXA 1SGYI 2M5XA 3RU0A 1KBEA 1FAQA 1SGRI 1TUSA 1PTRA 1R79A 2WVJA 2QPOA 4E1RA 2YUUA 2DIPA 4E1PA 3E2IA 3QWPA 2N71A 1OYVI 1SGNI 5FUVA 1KMAA 2QQCA 1FYBA 2L7XA 3PDNA 5EX0A 2J87A 1SGQI 4A24A 1CSOI 5FUWA 4UXJA 3UGIA 1TBRR 2NU4I 1PTQA 2NU0I 2A20A 1Y1BA 4OVOA 2QQ0A 3OXLA 1UVFA 2SGEI 1BUSA 2KMOA 2ERWA 2UZ3A 1V1IA 2N52A 1CE3A 4L9MA 2ENNA 2B8TA 2ODDA 4B6DA 1H0ZA 1CHOI 2ROWA 2V1CC 4UXHA 2GKRI 1DS2I 3OXGA 1X74A 1TOTA 3CXLA 2BUSA 2F3CI 2V1CA 1PPFI 1R0RI 3UFFA 2LUYA 3TJQA 1Z7KB 1MT1A 3SGQI 1TGSI 2E5RA 1SGDI 1M8CA 2GKTI 2DB6A 1TBOA 3GOXA 2JW6A 5CCMA 1RFHA 4GI3C 1LR9A 1LR7A 1V1HA 1FARA 1UUCA 3SEKC 2KMPA 2B0UC 1U5KA 5FUYA 2N17A 2SGPI 2NU2I 3FC3A 2ELIA 3UGLA 3E59A 3VE5A 2W0TA 1IW4A 2CJSC 1HPTA 5EX3A 3KY9A 4HGUA 1YU6C 1HJAI 1OVOA 1W4RA 2KMRA 2V53A 5JHWC 1IY5A 1PJUA 1XBTA 1CGJI 1PCEA 2NU1I 1CT4I 4SGBI 2FNFX 2J9RA 2JXDA 2L8EA 1N13A 2QQEA 1W3SA 1X4SA 1NUBA 1LR8A 2ARPF 2SGFI 3B4VC 1YTPA 2GVIA 1Y8FA 2LEOA 3SGBI 2NU3I 1TBQR 3VDPA 1SGPI 1CT0I 1TIHA 1XA6A 1M8BA 1KBFA 2K9HA 2KCXA 1OMUA 3UEJA 1TBNA 4FKDA 3D00A 1HDLA 3VDUA 2P6AC 3UGDA 2VRWB 4JCVE 2N1AB 3MEKA 1SGEI 2JA1A 5DAEA 2SGQI 3UEYA 2ORWA 1TURA 2GKVA 1AN1I 1VDDA 2ORVA 2SGDI 5HQ8A 2WCYA 4UXIA 2OD1A 1CGII 2E73A 2OVOA 3HH2C 2JZMA 3BJIA 1IY6A 1XX6A 2ENZA 2XRCA 5CCLA 1BMOA 1UVGA 3OXFA 1OMTA 2QQDA 2KMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1C A;  2JYY A;  1DS3 I;  3OVO A;  1CT2 I;  3QTL D;  1SGY I;  2M5X A;  1SGR I;  1TUS A;  1KMA A;  2N71 A;  1OYV I;  1SGN I;  2QQC A;  1FYB A;  1SGQ I;  1CSO I;  1TBR R;  2NU4 I;  2NU0 I;  1Y1B A;  4OVO A;  1UVF A;  2SGE I;  1BUS A;  2KMO A;  2ERW A;  2N52 A;  1CE3 A;  1H0Z A;  1CHO I;  2GKR I;  1DS2 I;  2BUS A;  2F3C I;  1PPF I;  1R0R I;  3TJQ A;  1Z7K B;  1MT1 A;  3SGQ I;  1TGS I;  1SGD I;  1M8C A;  2GKT I;  4GI3 C;  1LR9 A;  1LR7 A;  1UUC A;  3SEK C;  2KMP A;  2B0U C;  2N17 A;  2SGP I;  2NU2 I;  1IW4 A;  1HPT A;  4HGU A;  1YU6 C;  1HJA I;  1OVO A;  2KMR A;  2V53 A;  5JHW C;  1IY5 A;  1PJU A;  1CGJ I;  1PCE A;  2NU1 I;  1CT4 I;  4SGB I;  2JXD A;  1N13 A;  1NUB A;  1LR8 A;  2ARP F;  2SGF I;  3B4V C;  1YTP A;  2LEO A;  3SGB I;  2NU3 I;  1TBQ R;  1SGP I;  1CT0 I;  1TIH A;  1M8B A;  2KCX A;  1OMU A;  1HDL A;  2P6A C;  1SGE I;  5DAE A;  2SGQ I;  1TUR A;  2GKV A;  1AN1 I;  2SGD I;  2WCY A;  1CGI I;  2OVO A;  3HH2 C;  2JZM A;  1IY6 A;  2XRC A;  1BMO A;  1UVG A;  1OMT A;  2QQD A;  2KMQ A; 
#chains in the Genus database with same CATH topology
 3OL0 A;  1Y1C A;  5HI7 A;  2YQP A;  2JYY A;  1DS3 I;  3OVO A;  1CT2 I;  3QTL D;  4MPI A;  5FUX A;  1SGY I;  2M5X A;  3RU0 A;  1S20 A;  1KBE A;  1FAQ A;  5J8C A;  1SGR I;  1TUS A;  1PTR A;  1R79 A;  1MJ9 A;  2WVJ A;  2QPO A;  4E1R A;  2YUU A;  2DIP A;  4E1P A;  3E2I A;  3QWP A;  2N71 A;  1OYV I;  1SGN I;  5FUV A;  1KMA A;  2QQC A;  1FYB A;  2L7X A;  9WGA A;  3PDN A;  3R5A A;  5EX0 A;  2J87 A;  5E3P A;  1SGQ I;  4A24 A;  1CSO I;  5FUW A;  3FSY A;  2DKV A;  4UXJ A;  1TBR R;  2NU4 I;  3UGI A;  1PTQ A;  5J8F A;  1K7U A;  2NU0 I;  3UOE A;  2A20 A;  1Y1B A;  4OVO A;  2QQ0 A;  3OXL A;  4AML A;  1UVF A;  2SGE I;  1BUS A;  1ULN A;  2KMO A;  2ERW A;  2X3T A;  2UZ3 A;  1V1I A;  2N52 A;  1CE3 A;  4L9M A;  2ENN A;  1NXU A;  2CWH A;  2GIV A;  2B8T A;  2RC4 A;  2ODD A;  4B6D A;  1H0Z A;  1CHO I;  2ROW A;  2V1C C;  4UXH A;  2GKR I;  1DS2 I;  3OXG A;  7WGA A;  1X74 A;  1TOT A;  3CXL A;  2BUS A;  1MJA A;  2F3C I;  2V1C A;  1PPF I;  1R0R I;  3UFF A;  2LUY A;  3TJQ A;  1Z7K B;  1MT1 A;  3SGQ I;  1TGS I;  2E5R A;  2RIJ A;  1SGD I;  1M8C A;  2GKT I;  2DB6 A;  3TOA A;  1TBO A;  3GOX A;  1MJB A;  2JW6 A;  3R5B A;  5CCM A;  3R5C A;  1RFH A;  4GI3 C;  3TO9 A;  1LR9 A;  1LR7 A;  1V1H A;  1FAR A;  1UUC A;  3SEK C;  2KMP A;  5E3Q A;  2B0U C;  1U5K A;  5FUY A;  3FSX A;  2N17 A;  2SGP I;  3TO6 A;  2NU2 I;  4WP4 A;  3TOB A;  2ELI A;  3FC3 A;  3UGL A;  3R5D A;  3E59 A;  1Z2I A;  2W0T A;  3VE5 A;  1IW4 A;  2CJS C;  1HPT A;  5EX3 A;  3TO7 A;  3KY9 A;  4HGU A;  1YU6 C;  1HJA I;  1OVO A;  1W4R A;  2CWG A;  2KMR A;  2V53 A;  2UVO A;  2Y0M A;  1FY7 A;  5JHW C;  1IY5 A;  1PJU A;  1XBT A;  1CGJ I;  1PCE A;  2NU1 I;  2CWF A;  1CT4 I;  1K7V A;  4SGB I;  2FNF X;  2J9R A;  2JXD A;  2L8E A;  1N13 A;  2QQE A;  2WGC A;  1W3S A;  1WGC A;  1X4S A;  2LB7 A;  1ULK A;  1NUB A;  1LR8 A;  2ARP F;  2SGF I;  3B4V C;  1YTP A;  2OU2 A;  2GVI A;  1WTJ A;  1ULM A;  1Y8F A;  2LEO A;  3SGB I;  2NU3 I;  1TBQ R;  3VDP A;  1SGP I;  1WGT A;  1CT0 I;  1TIH A;  1XA6 A;  4DNC A;  1M8B A;  1P9G A;  2OZU A;  2K9H A;  2KCX A;  1KBF A;  1OMU A;  2X52 A;  3UEJ A;  1TBN A;  4FKD A;  1K7T A;  3D00 A;  1HDL A;  2PQ8 A;  3VDU A;  2P6A C;  3UGD A;  2VRW B;  4JCV E;  2N1A B;  3MEK A;  1SGE I;  2JA1 A;  5DAE A;  2SGQ I;  1HEV A;  3UEY A;  2ORW A;  1TUR A;  2GKV A;  1AN1 I;  1VDD A;  2ORV A;  2SGD I;  3QAH A;  5HQ8 A;  2WCY A;  4UXI A;  2OD1 A;  1CGI I;  2E73 A;  2OVO A;  3HH2 C;  2JZM A;  3BJI A;  1IY6 A;  1XX6 A;  2ENZ A;  2XRC A;  1UHA A;  5CCL A;  1P9Z A;  1BMO A;  1UVG A;  1Q9B A;  1OMT A;  3OXF A;  1WKX A;  5E3R A;  2QQD A;  2KMQ A; 
#chains in the Genus database with same CATH homology
 3OL0 A;  1Y1C A;  5HI7 A;  2YQP A;  2JYY A;  1DS3 I;  3OVO A;  1CT2 I;  3QTL D;  5FUX A;  1SGY I;  2M5X A;  3RU0 A;  1KBE A;  1FAQ A;  1SGR I;  1TUS A;  1PTR A;  1R79 A;  2WVJ A;  2QPO A;  4E1R A;  2YUU A;  2DIP A;  4E1P A;  3E2I A;  3QWP A;  2N71 A;  1OYV I;  1SGN I;  5FUV A;  1KMA A;  2QQC A;  1FYB A;  2L7X A;  3PDN A;  5EX0 A;  2J87 A;  1SGQ I;  4A24 A;  1CSO I;  5FUW A;  4UXJ A;  3UGI A;  1TBR R;  2NU4 I;  1PTQ A;  2NU0 I;  2A20 A;  1Y1B A;  4OVO A;  2QQ0 A;  3OXL A;  1UVF A;  2SGE I;  1BUS A;  2KMO A;  2ERW A;  2UZ3 A;  1V1I A;  2N52 A;  1CE3 A;  4L9M A;  2ENN A;  2B8T A;  2ODD A;  4B6D A;  1H0Z A;  1CHO I;  2ROW A;  2V1C C;  4UXH A;  2GKR I;  1DS2 I;  3OXG A;  1X74 A;  1TOT A;  3CXL A;  2BUS A;  2F3C I;  2V1C A;  1PPF I;  1R0R I;  3UFF A;  2LUY A;  3TJQ A;  1Z7K B;  1MT1 A;  3SGQ I;  1TGS I;  2E5R A;  1SGD I;  1M8C A;  2GKT I;  2DB6 A;  1TBO A;  3GOX A;  2JW6 A;  5CCM A;  1RFH A;  4GI3 C;  1LR9 A;  1LR7 A;  1V1H A;  1FAR A;  1UUC A;  3SEK C;  2KMP A;  2B0U C;  1U5K A;  5FUY A;  2N17 A;  2SGP I;  2NU2 I;  3FC3 A;  2ELI A;  3UGL A;  3E59 A;  3VE5 A;  2W0T A;  1IW4 A;  2CJS C;  1HPT A;  5EX3 A;  3KY9 A;  4HGU A;  1YU6 C;  1HJA I;  1OVO A;  1W4R A;  2KMR A;  2V53 A;  5JHW C;  1IY5 A;  1PJU A;  1XBT A;  1CGJ I;  1PCE A;  2NU1 I;  1CT4 I;  4SGB I;  2FNF X;  2J9R A;  2JXD A;  2L8E A;  1N13 A;  2QQE A;  1W3S A;  1X4S A;  1NUB A;  1LR8 A;  2ARP F;  2SGF I;  3B4V C;  1YTP A;  2GVI A;  1Y8F A;  2LEO A;  3SGB I;  2NU3 I;  1TBQ R;  3VDP A;  1SGP I;  1CT0 I;  1TIH A;  1XA6 A;  1M8B A;  1KBF A;  2K9H A;  2KCX A;  1OMU A;  3UEJ A;  1TBN A;  4FKD A;  3D00 A;  1HDL A;  3VDU A;  2P6A C;  3UGD A;  2VRW B;  4JCV E;  2N1A B;  3MEK A;  1SGE I;  2JA1 A;  5DAE A;  2SGQ I;  3UEY A;  2ORW A;  1TUR A;  2GKV A;  1AN1 I;  1VDD A;  2ORV A;  2SGD I;  5HQ8 A;  2WCY A;  4UXI A;  2OD1 A;  1CGI I;  2E73 A;  2OVO A;  3HH2 C;  2JZM A;  3BJI A;  1IY6 A;  1XX6 A;  2ENZ A;  2XRC A;  5CCL A;  1BMO A;  1UVG A;  3OXF A;  1OMT A;  2QQD A;  2KMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...