2ERWA

Crystal structure of infestin 4, a factor xiia inhibitor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
53
structure length
53
Chain Sequence
NPCACFRNYVPVCGSDGKTYGNPCMLNCAAQTKVPGLKLVHEGRCQRSNVEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting, hydrolase inhibitor
molecule keywords serine protease inhibitor infestin
publication title The Kazal-type inhibitors infestins 1 and 4 differ in specificity but are similar in three-dimensional structure.
pubmed doi rcsb
source organism Triatoma infestans
total genus 14
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2005-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2erwA00
2SGFI 2SGPI 4GI3C 2KMPA 1DS2I 2KCXA 1UUCA 2NU4I 1CT4I 3SGBI 3OVOA 1HDLA 1HJAI 2XRCA 1SGPI 4HGUA 3B4VC 5JHWC 2JZMA 1TURA 1UVFA 2N71A 2BUSA 2KMRA 2ARPF 2M5XA 2NU1I 3QTLD 2SGEI 1Z7KB 1HPTA 1NUBA 1DS3I 1TUSA 1PJUA 2SGDI 2P6AC 1CHOI 4SGBI 1IY6A 1IY5A 1N13A 1AN1I 1SGYI 2ERWA 1TIHA 2GKRI 1CGII 1YU6C 2N17A 1CGJI 2NU3I 2N52A 4OVOA 3SEKC 2B0UC 1SGNI 1KMAA 1OMUA 1CSOI 2F3CI 2NU2I 1Y1BA 1LR9A 1UVGA 1R0RI 2LEOA 1OYVI 2GKVA 1SGDI 1PCEA 1SGEI 1M8BA 1H0ZA 1LR8A 1YTPA 1M8CA 2NU0I 2JXDA 1BUSA 2OVOA 3TJQA 1TBQR 2QQDA 2WCYA 1Y1CA 1OMTA 2QQCA 1IW4A 1SGQI 1CT0I 1CT2I 1OVOA 1BMOA 1CE3A 1FYBA 2KMOA 1MT1A 1SGRI 1LR7A 3SGQI 2V53A 5DAEA 1TBRR 2JYYA 2SGQI 3HH2C 1PPFI 2GKTI 2KMQA 1TGSI
chains in the Genus database with same CATH superfamily
2SGFI 1K7VA 2SGPI 2ELIA 2KMPA 3QAHA 4GI3C 1DS2I 1VDDA 1UUCA 1WKXA 2KCXA 2NU4I 1CT4I 2W0TA 3SGBI 2JW6A 1TBOA 3TO6A 1TBNA 1ULNA 3OVOA 2ODDA 3TO7A 1HJAI 2XRCA 3OXLA 1HDLA 3VE5A 3FSXA 3TOAA 1SGPI 1MJAA 1TOTA 3B4VC 4HGUA 5JHWC 2JZMA 1HEVA 4A24A 4UXHA 1TURA 1UVFA 4JCVE 2N71A 1WTJA 1Z2IA 2BUSA 2DKVA 3R5AA 2WVJA 1U5KA 2OU2A 2KMRA 2ARPF 2M5XA 2NU1I 3QTLD 3OXGA 2SGEI 4MPIA 1K7TA 2QQ0A 5E3RA 3QWPA 1ULKA 1Z7KB 5CCLA 1HPTA 3BJIA 2J87A 5HI7A 1NUBA 1DS3I 1TUSA 2E73A 1V1HA 1PJUA 2SGDI 3KY9A 2P6AC 1CHOI 2Y0MA 1FY7A 4SGBI 2X52A 3UEYA 2L7XA 1IY6A 2UVOA 1IY5A 1Y8FA 2VRWB 1N13A 1KBFA 3FC3A 2QQEA 1AN1I 1WGCA 1SGYI 3R5DA 2ERWA 1TIHA 1P9GA 1XBTA 2GKRI 4UXIA 3E2IA 1CGII 1YU6C 3VDUA 2QPOA 3FSYA 1MJ9A 1K7UA 5FUWA 2DB6A 2N17A 1P9ZA 1CGJI 2NU3I 1RFHA 2J9RA 2N52A 3UGIA 4OVOA 4UXJA 2B0UC 1PTRA 3SEKC 5J8FA 2DIPA 1SGNI 1X4SA 5HQ8A 1OMUA 1CSOI 3E59A 2F3CI 3R5BA 2YUUA 2NU2I 3UEJA 1KMAA 2ROWA 1Y1BA 3R5CA 1LR9A 2ORVA 5EX0A 5FUXA 2OZUA 1FAQA 2GIVA 1UVGA 4AMLA 1R79A 1R0RI 2LEOA 2CWGA 2JA1A 5E3PA 1OYVI 4WP4A 5J8CA 2YQPA 2ENZA 2GKVA 5EX3A 4L9MA 4DNCA 1SGDI 3D00A 1PCEA 1SGEI 3OXFA 3UOEA 3VDPA 3MEKA 1M8BA 5FUVA 1H0ZA 2B8TA 2A20A 3CXLA 2CWFA 1LR8A 1YTPA 5CCMA 1M8CA 2LUYA 2NU0I 1S20A 2JXDA 1BUSA 2OVOA 1UHAA 2WGCA 1TBQR 3TJQA 1WGTA 2QQDA 4FKDA 3OL0A 4B6DA 2WCYA 4E1RA 1Y1CA 1OMTA 3UGLA 1KBEA 2ORWA 9WGAA 1ULMA 2QQCA 1MJBA 1V1IA 2RC4A 3TOBA 2GVIA 2RIJA 1IW4A 1PTQA 1SGQI 1CT0I 1CT2I 1OVOA 1XA6A 3PDNA 2CWHA 5FUYA 3UGDA 7WGAA 1BMOA 1CE3A 2E5RA 2N1AB 2PQ8A 1FYBA 2KMOA 1FARA 1MT1A 1SGRI 2FNFX 1LR7A 5E3QA 2OD1A 3SGQI 1W4RA 1W3SA 3GOXA 2V1CA 2L8EA 3RU0A 1Q9BA 3UFFA 2V53A 2K9HA 2V1CC 2X3TA 5DAEA 1TBRR 2CJSC 3TO9A 1XX6A 1NXUA 2JYYA 2ENNA 2SGQI 1X74A 3HH2C 4E1PA 1PPFI 2LB7A 2UZ3A 2GKTI 2KMQA 1TGSI
chains in the Genus database with same CATH topology
2SGFI 3RU0A 2SGPI 2ELIA 2KMPA 4GI3C 1DS2I 1VDDA 1UUCA 2KCXA 2W0TA 2NU4I 1CT4I 3SGBI 2JW6A 1TBOA 1TBNA 3OVOA 2ODDA 1HDLA 1HJAI 2XRCA 3OXLA 3VE5A 1SGPI 4HGUA 1TOTA 3B4VC 5JHWC 2JZMA 4A24A 4UXHA 1TURA 1UVFA 4JCVE 2N71A 2BUSA 2WVJA 1U5KA 2KMRA 2ARPF 2M5XA 2NU1I 3QTLD 3OXGA 2SGEI 2QQ0A 3QWPA 1Z7KB 5CCLA 1HPTA 3BJIA 2J87A 5HI7A 1NUBA 1DS3I 1TUSA 2E73A 1V1HA 1PJUA 2SGDI 3KY9A 2P6AC 1CHOI 4SGBI 3UEYA 1IY6A 2L7XA 1IY5A 1Y8FA 2VRWB 1N13A 1KBFA 3FC3A 2QQEA 1AN1I 1SGYI 2ERWA 1TIHA 1XBTA 2GKRI 4UXIA 3E2IA 1CGII 1YU6C 3VDUA 2QPOA 5FUWA 2DB6A 2N17A 1CGJI 2NU3I 1RFHA 2J9RA 2N52A 3UGIA 4OVOA 4UXJA 2B0UC 1PTRA 3SEKC 2DIPA 1X4SA 1SGNI 5HQ8A 1OMUA 1CSOI 3E59A 2F3CI 1KMAA 2YUUA 2NU2I 3UEJA 2ROWA 1Y1BA 1LR9A 2ORVA 5EX0A 5FUXA 1FAQA 1UVGA 1R79A 1R0RI 2LEOA 2JA1A 1OYVI 2YQPA 2ENZA 2GKVA 5EX3A 4L9MA 1SGDI 3D00A 1PCEA 1SGEI 3OXFA 3VDPA 3MEKA 1M8BA 5FUVA 1H0ZA 2B8TA 2A20A 3CXLA 5CCMA 1LR8A 1YTPA 1M8CA 2LUYA 2NU0I 2JXDA 1BUSA 2OVOA 3TJQA 1TBQR 2QQDA 4FKDA 4B6DA 3OL0A 2WCYA 4E1RA 1Y1CA 1OMTA 3UGLA 1KBEA 2ORWA 2QQCA 1V1IA 2GVIA 1IW4A 1PTQA 1SGQI 1CT0I 1CT2I 1OVOA 1XA6A 3PDNA 5FUYA 3UGDA 1BMOA 1CE3A 2E5RA 2N1AB 1FYBA 2KMOA 1FARA 1MT1A 1SGRI 2FNFX 1LR7A 2OD1A 3SGQI 1W4RA 1W3SA 3GOXA 2V1CA 2L8EA 3UFFA 2V53A 2K9HA 2V1CC 5DAEA 1TBRR 2CJSC 1XX6A 2JYYA 2ENNA 2SGQI 1X74A 3HH2C 4E1PA 1PPFI 2UZ3A 2GKTI 2KMQA 1TGSI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SGF I;  2SGP I;  4GI3 C;  2KMP A;  1DS2 I;  2KCX A;  1UUC A;  2NU4 I;  1CT4 I;  3SGB I;  3OVO A;  1HDL A;  1HJA I;  2XRC A;  1SGP I;  4HGU A;  3B4V C;  5JHW C;  2JZM A;  1TUR A;  1UVF A;  2N71 A;  2BUS A;  2KMR A;  2ARP F;  2M5X A;  2NU1 I;  3QTL D;  2SGE I;  1Z7K B;  1HPT A;  1NUB A;  1DS3 I;  1TUS A;  1PJU A;  2SGD I;  2P6A C;  1CHO I;  4SGB I;  1IY6 A;  1IY5 A;  1N13 A;  1AN1 I;  1SGY I;  2ERW A;  1TIH A;  2GKR I;  1CGI I;  1YU6 C;  2N17 A;  1CGJ I;  2NU3 I;  2N52 A;  4OVO A;  3SEK C;  2B0U C;  1SGN I;  1KMA A;  1OMU A;  1CSO I;  2F3C I;  2NU2 I;  1Y1B A;  1LR9 A;  1UVG A;  1R0R I;  2LEO A;  1OYV I;  2GKV A;  1SGD I;  1PCE A;  1SGE I;  1M8B A;  1H0Z A;  1LR8 A;  1YTP A;  1M8C A;  2NU0 I;  2JXD A;  1BUS A;  2OVO A;  3TJQ A;  1TBQ R;  2QQD A;  2WCY A;  1Y1C A;  1OMT A;  2QQC A;  1IW4 A;  1SGQ I;  1CT0 I;  1CT2 I;  1OVO A;  1BMO A;  1CE3 A;  1FYB A;  2KMO A;  1MT1 A;  1SGR I;  1LR7 A;  3SGQ I;  2V53 A;  5DAE A;  1TBR R;  2JYY A;  2SGQ I;  3HH2 C;  1PPF I;  2GKT I;  2KMQ A;  1TGS I; 
#chains in the Genus database with same CATH topology
 2SGF I;  1K7V A;  2SGP I;  2ELI A;  2KMP A;  3QAH A;  4GI3 C;  1DS2 I;  1VDD A;  1UUC A;  1WKX A;  2KCX A;  2NU4 I;  1CT4 I;  2W0T A;  3SGB I;  2JW6 A;  1TBO A;  3TO6 A;  1TBN A;  1ULN A;  3OVO A;  2ODD A;  3TO7 A;  1HJA I;  2XRC A;  3OXL A;  1HDL A;  3VE5 A;  3FSX A;  3TOA A;  1SGP I;  1MJA A;  1TOT A;  3B4V C;  4HGU A;  5JHW C;  2JZM A;  1HEV A;  4A24 A;  4UXH A;  1TUR A;  1UVF A;  4JCV E;  2N71 A;  1WTJ A;  1Z2I A;  2BUS A;  2DKV A;  3R5A A;  2WVJ A;  1U5K A;  2OU2 A;  2KMR A;  2ARP F;  2M5X A;  2NU1 I;  3QTL D;  3OXG A;  2SGE I;  4MPI A;  1K7T A;  2QQ0 A;  5E3R A;  3QWP A;  1ULK A;  1Z7K B;  5CCL A;  1HPT A;  3BJI A;  2J87 A;  5HI7 A;  1NUB A;  1DS3 I;  1TUS A;  2E73 A;  1V1H A;  1PJU A;  2SGD I;  3KY9 A;  2P6A C;  1CHO I;  2Y0M A;  1FY7 A;  4SGB I;  2X52 A;  3UEY A;  2L7X A;  1IY6 A;  2UVO A;  1IY5 A;  1Y8F A;  2VRW B;  1N13 A;  1KBF A;  3FC3 A;  2QQE A;  1AN1 I;  1WGC A;  1SGY I;  3R5D A;  2ERW A;  1TIH A;  1P9G A;  1XBT A;  2GKR I;  4UXI A;  3E2I A;  1CGI I;  1YU6 C;  3VDU A;  2QPO A;  3FSY A;  1MJ9 A;  1K7U A;  5FUW A;  2DB6 A;  2N17 A;  1P9Z A;  1CGJ I;  2NU3 I;  1RFH A;  2J9R A;  2N52 A;  3UGI A;  4OVO A;  4UXJ A;  2B0U C;  1PTR A;  3SEK C;  5J8F A;  2DIP A;  1SGN I;  1X4S A;  5HQ8 A;  1OMU A;  1CSO I;  3E59 A;  2F3C I;  3R5B A;  2YUU A;  2NU2 I;  3UEJ A;  1KMA A;  2ROW A;  1Y1B A;  3R5C A;  1LR9 A;  2ORV A;  5EX0 A;  5FUX A;  2OZU A;  1FAQ A;  2GIV A;  1UVG A;  4AML A;  1R79 A;  1R0R I;  2LEO A;  2CWG A;  2JA1 A;  5E3P A;  1OYV I;  4WP4 A;  5J8C A;  2YQP A;  2ENZ A;  2GKV A;  5EX3 A;  4L9M A;  4DNC A;  1SGD I;  3D00 A;  1PCE A;  1SGE I;  3OXF A;  3UOE A;  3VDP A;  3MEK A;  1M8B A;  5FUV A;  1H0Z A;  2B8T A;  2A20 A;  3CXL A;  2CWF A;  1LR8 A;  1YTP A;  5CCM A;  1M8C A;  2LUY A;  2NU0 I;  1S20 A;  2JXD A;  1BUS A;  2OVO A;  1UHA A;  2WGC A;  1TBQ R;  3TJQ A;  1WGT A;  2QQD A;  4FKD A;  3OL0 A;  4B6D A;  2WCY A;  4E1R A;  1Y1C A;  1OMT A;  3UGL A;  1KBE A;  2ORW A;  9WGA A;  1ULM A;  2QQC A;  1MJB A;  1V1I A;  2RC4 A;  3TOB A;  2GVI A;  2RIJ A;  1IW4 A;  1PTQ A;  1SGQ I;  1CT0 I;  1CT2 I;  1OVO A;  1XA6 A;  3PDN A;  2CWH A;  5FUY A;  3UGD A;  7WGA A;  1BMO A;  1CE3 A;  2E5R A;  2N1A B;  2PQ8 A;  1FYB A;  2KMO A;  1FAR A;  1MT1 A;  1SGR I;  2FNF X;  1LR7 A;  5E3Q A;  2OD1 A;  3SGQ I;  1W4R A;  1W3S A;  3GOX A;  2V1C A;  2L8E A;  3RU0 A;  1Q9B A;  3UFF A;  2V53 A;  2K9H A;  2V1C C;  2X3T A;  5DAE A;  1TBR R;  2CJS C;  3TO9 A;  1XX6 A;  1NXU A;  2JYY A;  2ENN A;  2SGQ I;  1X74 A;  3HH2 C;  4E1P A;  1PPF I;  2LB7 A;  2UZ3 A;  2GKT I;  2KMQ A;  1TGS I; 
#chains in the Genus database with same CATH homology
 2SGF I;  3RU0 A;  2SGP I;  2ELI A;  2KMP A;  4GI3 C;  1DS2 I;  1VDD A;  1UUC A;  2KCX A;  2W0T A;  2NU4 I;  1CT4 I;  3SGB I;  2JW6 A;  1TBO A;  1TBN A;  3OVO A;  2ODD A;  1HDL A;  1HJA I;  2XRC A;  3OXL A;  3VE5 A;  1SGP I;  4HGU A;  1TOT A;  3B4V C;  5JHW C;  2JZM A;  4A24 A;  4UXH A;  1TUR A;  1UVF A;  4JCV E;  2N71 A;  2BUS A;  2WVJ A;  1U5K A;  2KMR A;  2ARP F;  2M5X A;  2NU1 I;  3QTL D;  3OXG A;  2SGE I;  2QQ0 A;  3QWP A;  1Z7K B;  5CCL A;  1HPT A;  3BJI A;  2J87 A;  5HI7 A;  1NUB A;  1DS3 I;  1TUS A;  2E73 A;  1V1H A;  1PJU A;  2SGD I;  3KY9 A;  2P6A C;  1CHO I;  4SGB I;  3UEY A;  1IY6 A;  2L7X A;  1IY5 A;  1Y8F A;  2VRW B;  1N13 A;  1KBF A;  3FC3 A;  2QQE A;  1AN1 I;  1SGY I;  2ERW A;  1TIH A;  1XBT A;  2GKR I;  4UXI A;  3E2I A;  1CGI I;  1YU6 C;  3VDU A;  2QPO A;  5FUW A;  2DB6 A;  2N17 A;  1CGJ I;  2NU3 I;  1RFH A;  2J9R A;  2N52 A;  3UGI A;  4OVO A;  4UXJ A;  2B0U C;  1PTR A;  3SEK C;  2DIP A;  1X4S A;  1SGN I;  5HQ8 A;  1OMU A;  1CSO I;  3E59 A;  2F3C I;  1KMA A;  2YUU A;  2NU2 I;  3UEJ A;  2ROW A;  1Y1B A;  1LR9 A;  2ORV A;  5EX0 A;  5FUX A;  1FAQ A;  1UVG A;  1R79 A;  1R0R I;  2LEO A;  2JA1 A;  1OYV I;  2YQP A;  2ENZ A;  2GKV A;  5EX3 A;  4L9M A;  1SGD I;  3D00 A;  1PCE A;  1SGE I;  3OXF A;  3VDP A;  3MEK A;  1M8B A;  5FUV A;  1H0Z A;  2B8T A;  2A20 A;  3CXL A;  5CCM A;  1LR8 A;  1YTP A;  1M8C A;  2LUY A;  2NU0 I;  2JXD A;  1BUS A;  2OVO A;  3TJQ A;  1TBQ R;  2QQD A;  4FKD A;  4B6D A;  3OL0 A;  2WCY A;  4E1R A;  1Y1C A;  1OMT A;  3UGL A;  1KBE A;  2ORW A;  2QQC A;  1V1I A;  2GVI A;  1IW4 A;  1PTQ A;  1SGQ I;  1CT0 I;  1CT2 I;  1OVO A;  1XA6 A;  3PDN A;  5FUY A;  3UGD A;  1BMO A;  1CE3 A;  2E5R A;  2N1A B;  1FYB A;  2KMO A;  1FAR A;  1MT1 A;  1SGR I;  2FNF X;  1LR7 A;  2OD1 A;  3SGQ I;  1W4R A;  1W3S A;  3GOX A;  2V1C A;  2L8E A;  3UFF A;  2V53 A;  2K9H A;  2V1C C;  5DAE A;  1TBR R;  2CJS C;  1XX6 A;  2JYY A;  2ENN A;  2SGQ I;  1X74 A;  3HH2 C;  4E1P A;  1PPF I;  2UZ3 A;  2GKT I;  2KMQ A;  1TGS I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...