4GI3C

Crystal structure of greglin in complex with subtilisin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
b'CPSICPLIYAPVCVEDSNQDFYLFVNECEVRKCGCEAGFVYTFVPREMCKATTSLCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KerA
publication title Crystal structure of greglin, a novel non-classical Kazal inhibitor, in complex with subtilisin
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4gi3C00
2SGQI 1CT2I 2N52A 1BMOA 1H0ZA 3SGQI 2QQCA 3SGBI 2KMPA 1TUSA 3SEKC 1DS3I 2B0UC 1CSOI 1M8BA 2KMQA 1DS2I 2GKVA 3TJQA 2NU0I 2ARPF 2KCXA 1UVFA 2KMOA 2OVOA 2XRCA 1FYBA 1SGQI 1M8CA 1TBRR 1Z7KB 4HGUA 1OMTA 1SGDI 4SGBI 1CT0I 2N17A 2SGDI 5JHWC 1OVOA 1TURA 1IY5A 1CT4I 1Y1BA 1SGPI 2GKRI 1CHOI 1PPFI 1IW4A 2NU2I 2N71A 2JXDA 2NU4I 2SGFI 1UUCA 2QQDA 1N13A 1CGJI 1SGNI 1CE3A 2LEOA 2V53A 2BUSA 1LR7A 1AN1I 1PCEA 2KMRA 2F3CI 2ERWA 4GI3C 1YU6C 3QTLD 1CGII 1SGRI 1TIHA 4OVOA 2SGEI 3HH2C 1OMUA 1HPTA 1LR9A 1OYVI 1KMAA 1Y1CA 2M5XA 2P6AC 5DAEA 1SGYI 2WCYA 2JZMA 1R0RI 1HDLA 1MT1A 2NU3I 1BUSA 1SGEI 1TBQR 1UVGA 1NUBA 2NU1I 2JYYA 1HJAI 3B4VC 1IY6A 1PJUA 2SGPI 1LR8A 3OVOA 1TGSI 1YTPA 2GKTI
chains in the Genus database with same CATH superfamily
3OL0A 1VDDA 2SGQI 1CT2I 2N52A 2GIVA 5E3PA 1BMOA 1H0ZA 5E3QA 5EX3A 3SGQI 2QQCA 3SGBI 2KMPA 2UZ3A 1Q9BA 2YUUA 3D00A 3UGDA 1P9GA 1TUSA 3SEKC 3E2IA 1DS3I 2JA1A 1W4RA 3OXFA 5FUWA 2OU2A 4A24A 1WTJA 1PTQA 2B8TA 2B0UC 1CSOI 1M8BA 2KMQA 1DS2I 3QWPA 1MJBA 2GKVA 3FSYA 2CJSC 2QQEA 3TJQA 1V1HA 2NU0I 2ARPF 2E73A 4WP4A 3TO7A 2KCXA 5J8CA 3TO6A 1UVFA 3UEYA 2KMOA 1U5KA 1XA6A 2OVOA 2N1AB 5FUXA 5FUVA 1WGTA 2XRCA 4MPIA 3PDNA 1RFHA 4AMLA 3UFFA 1FYBA 1SGQI 1W3SA 1M8CA 3TOAA 1TBRR 1Z7KB 2RC4A 1V1IA 1S20A 2CWGA 1OMTA 1X74A 4HGUA 1SGDI 1TBOA 4SGBI 2K9HA 3OXLA 1CT0I 1KBEA 3KY9A 2N17A 5EX0A 2SGDI 5JHWC 3UOEA 1OVOA 1WGCA 1TURA 1IY5A 1CT4I 1ULNA 1K7VA 1Y1BA 2DB6A 1SGPI 2CWHA 2GKRI 3GOXA 1CHOI 1PPFI 3R5BA 1IW4A 4UXHA 2NU2I 2VRWB 2QPOA 2V1CC 2N71A 2A20A 2JXDA 3UEJA 1HEVA 2NU4I 2SGFI 2YQPA 2RIJA 1UUCA 2OZUA 3R5DA 4E1RA 2QQDA 2WVJA 3MEKA 1N13A 4UXIA 5HI7A 1CGJI 1SGNI 1FARA 2ENZA 2GVIA 3E59A 3VE5A 2WGCA 1CE3A 2LEOA 2OD1A 2V53A 4FKDA 3RU0A 2L7XA 1MJ9A 2BUSA 1LR7A 2E5RA 4E1PA 1AN1I 1P9ZA 1PCEA 1TBNA 1XX6A 2KMRA 2ORWA 2F3CI 2ERWA 2QQ0A 4GI3C 1YU6C 3UGIA 3VDUA 5J8FA 3FC3A 3QTLD 2JW6A 1Z2IA 4B6DA 1CGII 1SGRI 9WGAA 1TIHA 2LUYA 1ULKA 4OVOA 2SGEI 1FY7A 2W0TA 3HH2C 1OMUA 1HPTA 1UHAA 3R5AA 7WGAA 4DNCA 3OXGA 1LR9A 1OYVI 1R79A 1Y8FA 1KMAA 5CCMA 1ULMA 1Y1CA 2V1CA 2M5XA 5E3RA 3VDPA 2P6AC 5DAEA 1SGYI 2LB7A 2WCYA 1X4SA 2JZMA 1PTRA 1XBTA 1R0RI 1TOTA 1HDLA 1MT1A 2NU3I 2CWFA 2L8EA 5HQ8A 1BUSA 1SGEI 1TBQR 1UVGA 2DKVA 2ROWA 3BJIA 3CXLA 4UXJA 3TOBA 2UVOA 1NUBA 2NU1I 3QAHA 3FSXA 1KBFA 2JYYA 1HJAI 3TO9A 3B4VC 2J87A 2X52A 2FNFX 3R5CA 1IY6A 4L9MA 3UGLA 1PJUA 2SGPI 1LR8A 3OVOA 5CCLA 1MJAA 2X3TA 2ORVA 2ELIA 2DIPA 1FAQA 1K7TA 1TGSI 2PQ8A 5FUYA 4JCVE 2ODDA 1K7UA 1WKXA 1YTPA 2J9RA 2ENNA 2Y0MA 1NXUA 2GKTI
chains in the Genus database with same CATH topology
3OL0A 1VDDA 2SGQI 1CT2I 2N52A 1BMOA 1H0ZA 5EX3A 3SGQI 2QQCA 3SGBI 2KMPA 2UZ3A 2YUUA 3D00A 3UGDA 1TUSA 3SEKC 3E2IA 1DS3I 2JA1A 1W4RA 3OXFA 5FUWA 4A24A 1PTQA 2B8TA 2B0UC 1CSOI 1M8BA 2KMQA 1DS2I 3QWPA 2GKVA 3TJQA 2CJSC 2QQEA 1V1HA 2NU0I 2ARPF 2E73A 2KCXA 1UVFA 3UEYA 2KMOA 1XA6A 1U5KA 2OVOA 2N1AB 5FUXA 5FUVA 2XRCA 3PDNA 1RFHA 3UFFA 1FYBA 1SGQI 1W3SA 1M8CA 1TBRR 1Z7KB 1V1IA 4HGUA 1OMTA 1X74A 1SGDI 1TBOA 4SGBI 2K9HA 3OXLA 1CT0I 1KBEA 3KY9A 2N17A 5EX0A 2SGDI 5JHWC 1OVOA 1TURA 1IY5A 1CT4I 1Y1BA 2DB6A 1SGPI 2GKRI 3GOXA 1CHOI 1PPFI 1IW4A 4UXHA 2NU2I 2VRWB 2QPOA 2V1CC 2N71A 2A20A 2JXDA 3UEJA 2NU4I 2SGFI 2YQPA 1UUCA 4E1RA 2QQDA 2WVJA 3MEKA 1N13A 4UXIA 5HI7A 1CGJI 1SGNI 1FARA 2ENZA 2GVIA 3E59A 3VE5A 1CE3A 2LEOA 2OD1A 2V53A 4FKDA 3RU0A 2L7XA 2BUSA 1LR7A 2E5RA 4E1PA 1AN1I 1PCEA 1TBNA 1XX6A 2KMRA 2ORWA 2F3CI 2ERWA 2QQ0A 4GI3C 1YU6C 3VDUA 3FC3A 3QTLD 2JW6A 4B6DA 1CGII 1SGRI 1TIHA 2LUYA 4OVOA 2SGEI 2W0TA 3HH2C 1OMUA 1HPTA 3OXGA 1LR9A 1OYVI 1R79A 1Y8FA 1KMAA 5CCMA 2V1CA 1Y1CA 2M5XA 3VDPA 2P6AC 5DAEA 1SGYI 2WCYA 1X4SA 2JZMA 1PTRA 1XBTA 1R0RI 1TOTA 1HDLA 1MT1A 2NU3I 2L8EA 5HQ8A 1BUSA 1SGEI 1TBQR 1UVGA 2ROWA 3CXLA 3BJIA 4UXJA 3UGIA 1NUBA 2NU1I 1KBFA 2JYYA 1HJAI 3B4VC 2J87A 2FNFX 1IY6A 4L9MA 3UGLA 1PJUA 2SGPI 1LR8A 3OVOA 5CCLA 2ORVA 2ELIA 2DIPA 1FAQA 1TGSI 5FUYA 4JCVE 2ODDA 1YTPA 2J9RA 2ENNA 2GKTI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SGQ I;  1CT2 I;  2N52 A;  1BMO A;  1H0Z A;  3SGQ I;  2QQC A;  3SGB I;  2KMP A;  1TUS A;  3SEK C;  1DS3 I;  2B0U C;  1CSO I;  1M8B A;  2KMQ A;  1DS2 I;  2GKV A;  3TJQ A;  2NU0 I;  2ARP F;  2KCX A;  1UVF A;  2KMO A;  2OVO A;  2XRC A;  1FYB A;  1SGQ I;  1M8C A;  1TBR R;  1Z7K B;  4HGU A;  1OMT A;  1SGD I;  4SGB I;  1CT0 I;  2N17 A;  2SGD I;  5JHW C;  1OVO A;  1TUR A;  1IY5 A;  1CT4 I;  1Y1B A;  1SGP I;  2GKR I;  1CHO I;  1PPF I;  1IW4 A;  2NU2 I;  2N71 A;  2JXD A;  2NU4 I;  2SGF I;  1UUC A;  2QQD A;  1N13 A;  1CGJ I;  1SGN I;  1CE3 A;  2LEO A;  2V53 A;  2BUS A;  1LR7 A;  1AN1 I;  1PCE A;  2KMR A;  2F3C I;  2ERW A;  4GI3 C;  1YU6 C;  3QTL D;  1CGI I;  1SGR I;  1TIH A;  4OVO A;  2SGE I;  3HH2 C;  1OMU A;  1HPT A;  1LR9 A;  1OYV I;  1KMA A;  1Y1C A;  2M5X A;  2P6A C;  5DAE A;  1SGY I;  2WCY A;  2JZM A;  1R0R I;  1HDL A;  1MT1 A;  2NU3 I;  1BUS A;  1SGE I;  1TBQ R;  1UVG A;  1NUB A;  2NU1 I;  2JYY A;  1HJA I;  3B4V C;  1IY6 A;  1PJU A;  2SGP I;  1LR8 A;  3OVO A;  1TGS I;  1YTP A;  2GKT I; 
#chains in the Genus database with same CATH topology
 3OL0 A;  1VDD A;  2SGQ I;  1CT2 I;  2N52 A;  2GIV A;  5E3P A;  1BMO A;  1H0Z A;  5E3Q A;  5EX3 A;  3SGQ I;  2QQC A;  3SGB I;  2KMP A;  2UZ3 A;  1Q9B A;  2YUU A;  3D00 A;  3UGD A;  1P9G A;  1TUS A;  3SEK C;  3E2I A;  1DS3 I;  2JA1 A;  1W4R A;  3OXF A;  5FUW A;  2OU2 A;  4A24 A;  1WTJ A;  1PTQ A;  2B8T A;  2B0U C;  1CSO I;  1M8B A;  2KMQ A;  1DS2 I;  3QWP A;  1MJB A;  2GKV A;  3FSY A;  2CJS C;  2QQE A;  3TJQ A;  1V1H A;  2NU0 I;  2ARP F;  2E73 A;  4WP4 A;  3TO7 A;  2KCX A;  5J8C A;  3TO6 A;  1UVF A;  3UEY A;  2KMO A;  1U5K A;  1XA6 A;  2OVO A;  2N1A B;  5FUX A;  5FUV A;  1WGT A;  2XRC A;  4MPI A;  3PDN A;  1RFH A;  4AML A;  3UFF A;  1FYB A;  1SGQ I;  1W3S A;  1M8C A;  3TOA A;  1TBR R;  1Z7K B;  2RC4 A;  1V1I A;  1S20 A;  2CWG A;  1OMT A;  1X74 A;  4HGU A;  1SGD I;  1TBO A;  4SGB I;  2K9H A;  3OXL A;  1CT0 I;  1KBE A;  3KY9 A;  2N17 A;  5EX0 A;  2SGD I;  5JHW C;  3UOE A;  1OVO A;  1WGC A;  1TUR A;  1IY5 A;  1CT4 I;  1ULN A;  1K7V A;  1Y1B A;  2DB6 A;  1SGP I;  2CWH A;  2GKR I;  3GOX A;  1CHO I;  1PPF I;  3R5B A;  1IW4 A;  4UXH A;  2NU2 I;  2VRW B;  2QPO A;  2V1C C;  2N71 A;  2A20 A;  2JXD A;  3UEJ A;  1HEV A;  2NU4 I;  2SGF I;  2YQP A;  2RIJ A;  1UUC A;  2OZU A;  3R5D A;  4E1R A;  2QQD A;  2WVJ A;  3MEK A;  1N13 A;  4UXI A;  5HI7 A;  1CGJ I;  1SGN I;  1FAR A;  2ENZ A;  2GVI A;  3E59 A;  3VE5 A;  2WGC A;  1CE3 A;  2LEO A;  2OD1 A;  2V53 A;  4FKD A;  3RU0 A;  2L7X A;  1MJ9 A;  2BUS A;  1LR7 A;  2E5R A;  4E1P A;  1AN1 I;  1P9Z A;  1PCE A;  1TBN A;  1XX6 A;  2KMR A;  2ORW A;  2F3C I;  2ERW A;  2QQ0 A;  4GI3 C;  1YU6 C;  3UGI A;  3VDU A;  5J8F A;  3FC3 A;  3QTL D;  2JW6 A;  1Z2I A;  4B6D A;  1CGI I;  1SGR I;  9WGA A;  1TIH A;  2LUY A;  1ULK A;  4OVO A;  2SGE I;  1FY7 A;  2W0T A;  3HH2 C;  1OMU A;  1HPT A;  1UHA A;  3R5A A;  7WGA A;  4DNC A;  3OXG A;  1LR9 A;  1OYV I;  1R79 A;  1Y8F A;  1KMA A;  5CCM A;  1ULM A;  1Y1C A;  2V1C A;  2M5X A;  5E3R A;  3VDP A;  2P6A C;  5DAE A;  1SGY I;  2LB7 A;  2WCY A;  1X4S A;  2JZM A;  1PTR A;  1XBT A;  1R0R I;  1TOT A;  1HDL A;  1MT1 A;  2NU3 I;  2CWF A;  2L8E A;  5HQ8 A;  1BUS A;  1SGE I;  1TBQ R;  1UVG A;  2DKV A;  2ROW A;  3BJI A;  3CXL A;  4UXJ A;  3TOB A;  2UVO A;  1NUB A;  2NU1 I;  3QAH A;  3FSX A;  1KBF A;  2JYY A;  1HJA I;  3TO9 A;  3B4V C;  2J87 A;  2X52 A;  2FNF X;  3R5C A;  1IY6 A;  4L9M A;  3UGL A;  1PJU A;  2SGP I;  1LR8 A;  3OVO A;  5CCL A;  1MJA A;  2X3T A;  2ORV A;  2ELI A;  2DIP A;  1FAQ A;  1K7T A;  1TGS I;  2PQ8 A;  5FUY A;  4JCV E;  2ODD A;  1K7U A;  1WKX A;  1YTP A;  2J9R A;  2ENN A;  2Y0M A;  1NXU A;  2GKT I; 
#chains in the Genus database with same CATH homology
 3OL0 A;  1VDD A;  2SGQ I;  1CT2 I;  2N52 A;  1BMO A;  1H0Z A;  5EX3 A;  3SGQ I;  2QQC A;  3SGB I;  2KMP A;  2UZ3 A;  2YUU A;  3D00 A;  3UGD A;  1TUS A;  3SEK C;  3E2I A;  1DS3 I;  2JA1 A;  1W4R A;  3OXF A;  5FUW A;  4A24 A;  1PTQ A;  2B8T A;  2B0U C;  1CSO I;  1M8B A;  2KMQ A;  1DS2 I;  3QWP A;  2GKV A;  3TJQ A;  2CJS C;  2QQE A;  1V1H A;  2NU0 I;  2ARP F;  2E73 A;  2KCX A;  1UVF A;  3UEY A;  2KMO A;  1XA6 A;  1U5K A;  2OVO A;  2N1A B;  5FUX A;  5FUV A;  2XRC A;  3PDN A;  1RFH A;  3UFF A;  1FYB A;  1SGQ I;  1W3S A;  1M8C A;  1TBR R;  1Z7K B;  1V1I A;  4HGU A;  1OMT A;  1X74 A;  1SGD I;  1TBO A;  4SGB I;  2K9H A;  3OXL A;  1CT0 I;  1KBE A;  3KY9 A;  2N17 A;  5EX0 A;  2SGD I;  5JHW C;  1OVO A;  1TUR A;  1IY5 A;  1CT4 I;  1Y1B A;  2DB6 A;  1SGP I;  2GKR I;  3GOX A;  1CHO I;  1PPF I;  1IW4 A;  4UXH A;  2NU2 I;  2VRW B;  2QPO A;  2V1C C;  2N71 A;  2A20 A;  2JXD A;  3UEJ A;  2NU4 I;  2SGF I;  2YQP A;  1UUC A;  4E1R A;  2QQD A;  2WVJ A;  3MEK A;  1N13 A;  4UXI A;  5HI7 A;  1CGJ I;  1SGN I;  1FAR A;  2ENZ A;  2GVI A;  3E59 A;  3VE5 A;  1CE3 A;  2LEO A;  2OD1 A;  2V53 A;  4FKD A;  3RU0 A;  2L7X A;  2BUS A;  1LR7 A;  2E5R A;  4E1P A;  1AN1 I;  1PCE A;  1TBN A;  1XX6 A;  2KMR A;  2ORW A;  2F3C I;  2ERW A;  2QQ0 A;  4GI3 C;  1YU6 C;  3VDU A;  3FC3 A;  3QTL D;  2JW6 A;  4B6D A;  1CGI I;  1SGR I;  1TIH A;  2LUY A;  4OVO A;  2SGE I;  2W0T A;  3HH2 C;  1OMU A;  1HPT A;  3OXG A;  1LR9 A;  1OYV I;  1R79 A;  1Y8F A;  1KMA A;  5CCM A;  2V1C A;  1Y1C A;  2M5X A;  3VDP A;  2P6A C;  5DAE A;  1SGY I;  2WCY A;  1X4S A;  2JZM A;  1PTR A;  1XBT A;  1R0R I;  1TOT A;  1HDL A;  1MT1 A;  2NU3 I;  2L8E A;  5HQ8 A;  1BUS A;  1SGE I;  1TBQ R;  1UVG A;  2ROW A;  3CXL A;  3BJI A;  4UXJ A;  3UGI A;  1NUB A;  2NU1 I;  1KBF A;  2JYY A;  1HJA I;  3B4V C;  2J87 A;  2FNF X;  1IY6 A;  4L9M A;  3UGL A;  1PJU A;  2SGP I;  1LR8 A;  3OVO A;  5CCL A;  2ORV A;  2ELI A;  2DIP A;  1FAQ A;  1TGS I;  5FUY A;  4JCV E;  2ODD A;  1YTP A;  2J9R A;  2ENN A;  2GKT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...