4GI3C

Crystal structure of greglin in complex with subtilisin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
CPSICPLIYAPVCVEDSNQDFYLFVNECEVRKCGCEAGFVYTFVPREMCKATTSLCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords KerA
publication title Crystal structure of greglin, a novel non-classical Kazal inhibitor, in complex with subtilisin
pubmed doi rcsb
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4gi3C00
2N17A 1CGII 1SGQI 3B4VC 2KMOA 1DS3I 1Y1CA 3TJQA 2LEOA 1MT1A 1UUCA 2KCXA 1SGDI 1LR8A 4GI3C 2JYYA 1Y1BA 1Z7KB 1HPTA 1IY5A 2SGFI 1OMTA 1H0ZA 2B0UC 2GKVA 1TIHA 1UVFA 1FYBA 1AN1I 1CE3A 2SGDI 2XRCA 2P6AC 1CT2I 1LR9A 1TGSI 3OVOA 4SGBI 2ERWA 5JHWC 1SGPI 1LR7A 1TBRR 1PJUA 2NU2I 4OVOA 1CGJI 2SGQI 2JXDA 1SGYI 2N71A 1BUSA 1UVGA 1YU6C 2V53A 1TURA 3SGBI 1NUBA 1YTPA 1DS2I 3QTLD 2SGPI 2NU3I 1SGRI 1CHOI 2BUSA 1CT4I 2KMRA 1PPFI 1HJAI 1OVOA 2ARPF 2KMPA 1SGNI 1TBQR 1SGEI 3SEKC 2NU1I 2GKRI 2GKTI 2N52A 2OVOA 1IY6A 1N13A 1OMUA 3HH2C 1CSOI 1IW4A 2QQDA 3SGQI 2M5XA 1M8CA 2KMQA 1CT0I 1R0RI 1TUSA 1PCEA 2NU4I 1OYVI 2WCYA 2NU0I 1KMAA 4HGUA 1M8BA 2JZMA 2QQCA 1HDLA 2F3CI 1BMOA 2SGEI 5DAEA
chains in the Genus database with same CATH superfamily
3TO9A 2N17A 3TOAA 1CGII 5FUYA 1SGQI 2GVIA 4UXJA 3B4VC 2DB6A 2KMOA 5EX0A 1DS3I 2A20A 1Y1CA 3TJQA 2QQEA 2CJSC 2L8EA 2LEOA 1MT1A 1UUCA 1WTJA 2KCXA 3OL0A 5EX3A 3UGIA 1SGDI 3OXFA 1LR8A 3OXGA 4GI3C 2JA1A 2JYYA 2N1AB 1U5KA 1S20A 2ROWA 1Y1BA 1Z7KB 3UEYA 1HPTA 1IY5A 2SGFI 3CXLA 1OMTA 1TBOA 2B0UC 2GKVA 1H0ZA 1V1IA 1FAQA 1TIHA 1UVFA 2ENNA 2V1CA 3E59A 4DNCA 1FYBA 1ULKA 1AN1I 1CE3A 3TOBA 1WGTA 3TO6A 2YQPA 1K7TA 2DIPA 4UXIA 2JW6A 2SGDI 2XRCA 2P6AC 1CT2I 1LR9A 1TGSI 3OVOA 4SGBI 2ELIA 5FUXA 1HEVA 3QWPA 2ERWA 5JHWC 1SGPI 1LR7A 5FUWA 3PDNA 1TBRR 1K7VA 1PJUA 3UEJA 2NU2I 1ULNA 4OVOA 1P9ZA 1CGJI 2CWHA 2FNFX 2JXDA 2SGQI 3RU0A 1NXUA 3D00A 5E3PA 1WKXA 1SGYI 2ORVA 5J8CA 2N71A 1BUSA 2RIJA 2L7XA 1UVGA 2E73A 1PTQA 1YU6C 1TURA 2V53A 1MJAA 3E2IA 5FUVA 2LUYA 3UOEA 2CWGA 2UZ3A 2X3TA 1Z2IA 2ODDA 3SGBI 1NUBA 1Q9BA 4FKDA 1YTPA 1DS2I 7WGAA 3QTLD 1P9GA 2SGPI 3OXLA 2CWFA 3R5DA 2B8TA 3VDPA 1PTRA 4E1PA 1Y8FA 2NU3I 1TOTA 1UHAA 2YUUA 2UVOA 1KBEA 1IY6A 1KBFA 2RC4A 3FSXA 2OZUA 3R5BA 1MJ9A 1W4RA 1WGCA 1SGRI 3GOXA 1XA6A 4B6DA 4A24A 1CHOI 3MEKA 3R5CA 5CCMA 2BUSA 5CCLA 2LB7A 1CT4I 2OD1A 3TO7A 2KMRA 1R79A 1TBNA 1PPFI 5J8FA 1MJBA 1X4SA 1K7UA 2QQ0A 1HJAI 1OVOA 3KY9A 1ULMA 2ARPF 4L9MA 2KMPA 1SGNI 1TBQR 3R5AA 1SGEI 1RFHA 1XX6A 2J87A 3SEKC 1FY7A 2X52A 3FC3A 2NU1I 4E1RA 2GKRI 2ENZA 2VRWB 5HI7A 1X74A 2GKTI 4JCVE 2N52A 2OVOA 2K9HA 2PQ8A 2W0TA 1N13A 1OMUA 3FSYA 5E3QA 3HH2C 3UGDA 5HQ8A 1CSOI 2OU2A 3QAHA 4AMLA 2QQDA 1IW4A 3SGQI 1XBTA 2M5XA 1M8CA 2GIVA 1CT0I 2KMQA 2ORWA 4MPIA 3VDUA 1R0RI 2QPOA 1TUSA 1PCEA 1VDDA 2NU4I 4WP4A 2WVJA 5E3RA 1OYVI 1V1HA 2V1CC 2WCYA 2NU0I 9WGAA 1KMAA 1W3SA 3VE5A 4HGUA 1M8BA 2JZMA 2QQCA 1HDLA 3UFFA 2E5RA 2WGCA 2F3CI 2DKVA 3UGLA 2J9RA 1BMOA 1FARA 4UXHA 3BJIA 2SGEI 2Y0MA 5DAEA
chains in the Genus database with same CATH topology
2N17A 1CGII 5FUYA 1SGQI 2GVIA 4UXJA 3B4VC 2DB6A 2KMOA 5EX0A 1DS3I 2A20A 1Y1CA 3TJQA 2QQEA 2CJSC 2L8EA 2LEOA 1MT1A 1UUCA 2KCXA 3OL0A 5EX3A 3UGIA 1SGDI 3OXFA 1LR8A 3OXGA 4GI3C 2JA1A 2JYYA 2N1AB 1U5KA 2ROWA 1Y1BA 1Z7KB 3UEYA 1HPTA 1IY5A 2SGFI 3CXLA 1OMTA 1TBOA 2B0UC 2GKVA 1H0ZA 1V1IA 1FAQA 1TIHA 1UVFA 2ENNA 2V1CA 3E59A 1FYBA 1AN1I 1CE3A 2YQPA 2DIPA 4UXIA 2JW6A 2SGDI 2XRCA 2P6AC 1CT2I 1LR9A 1TGSI 3OVOA 4SGBI 2ELIA 5FUXA 3QWPA 2ERWA 5JHWC 1SGPI 1LR7A 5FUWA 3PDNA 1TBRR 1PJUA 3UEJA 2NU2I 4OVOA 1CGJI 2SGQI 2FNFX 2JXDA 3RU0A 3D00A 1SGYI 2ORVA 2N71A 1BUSA 2L7XA 1UVGA 2E73A 1PTQA 1YU6C 1TURA 2V53A 5FUVA 3E2IA 2LUYA 2UZ3A 2ODDA 3SGBI 1NUBA 4FKDA 1YTPA 1DS2I 3QTLD 2SGPI 3OXLA 4E1PA 2B8TA 3VDPA 1PTRA 1Y8FA 2NU3I 1TOTA 2YUUA 1KBEA 1KBFA 1W4RA 1SGRI 3GOXA 1XA6A 4B6DA 4A24A 1CHOI 3MEKA 5CCMA 2BUSA 5CCLA 1CT4I 2OD1A 2KMRA 1R79A 1TBNA 1PPFI 1X4SA 2QQ0A 1HJAI 1OVOA 3KY9A 4L9MA 2ARPF 2KMPA 1SGNI 1TBQR 1SGEI 1RFHA 1XX6A 2J87A 3SEKC 3FC3A 2NU1I 4E1RA 2GKRI 2ENZA 2VRWB 5HI7A 1X74A 2GKTI 4JCVE 2N52A 2OVOA 2K9HA 2W0TA 1IY6A 1N13A 1OMUA 3UGDA 3HH2C 5HQ8A 1CSOI 1IW4A 2QQDA 3SGQI 1XBTA 2M5XA 1M8CA 2KMQA 1CT0I 2ORWA 3VDUA 1R0RI 2QPOA 1TUSA 1PCEA 1VDDA 2NU4I 2WVJA 1OYVI 1V1HA 2V1CC 2WCYA 2NU0I 1KMAA 1W3SA 3VE5A 4HGUA 1M8BA 2JZMA 2QQCA 1HDLA 3UFFA 2E5RA 2F3CI 3UGLA 2J9RA 1BMOA 1FARA 4UXHA 3BJIA 2SGEI 5DAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N17 A;  1CGI I;  1SGQ I;  3B4V C;  2KMO A;  1DS3 I;  1Y1C A;  3TJQ A;  2LEO A;  1MT1 A;  1UUC A;  2KCX A;  1SGD I;  1LR8 A;  4GI3 C;  2JYY A;  1Y1B A;  1Z7K B;  1HPT A;  1IY5 A;  2SGF I;  1OMT A;  1H0Z A;  2B0U C;  2GKV A;  1TIH A;  1UVF A;  1FYB A;  1AN1 I;  1CE3 A;  2SGD I;  2XRC A;  2P6A C;  1CT2 I;  1LR9 A;  1TGS I;  3OVO A;  4SGB I;  2ERW A;  5JHW C;  1SGP I;  1LR7 A;  1TBR R;  1PJU A;  2NU2 I;  4OVO A;  1CGJ I;  2SGQ I;  2JXD A;  1SGY I;  2N71 A;  1BUS A;  1UVG A;  1YU6 C;  2V53 A;  1TUR A;  3SGB I;  1NUB A;  1YTP A;  1DS2 I;  3QTL D;  2SGP I;  2NU3 I;  1SGR I;  1CHO I;  2BUS A;  1CT4 I;  2KMR A;  1PPF I;  1HJA I;  1OVO A;  2ARP F;  2KMP A;  1SGN I;  1TBQ R;  1SGE I;  3SEK C;  2NU1 I;  2GKR I;  2GKT I;  2N52 A;  2OVO A;  1IY6 A;  1N13 A;  1OMU A;  3HH2 C;  1CSO I;  1IW4 A;  2QQD A;  3SGQ I;  2M5X A;  1M8C A;  2KMQ A;  1CT0 I;  1R0R I;  1TUS A;  1PCE A;  2NU4 I;  1OYV I;  2WCY A;  2NU0 I;  1KMA A;  4HGU A;  1M8B A;  2JZM A;  2QQC A;  1HDL A;  2F3C I;  1BMO A;  2SGE I;  5DAE A; 
#chains in the Genus database with same CATH topology
 3TO9 A;  2N17 A;  3TOA A;  1CGI I;  5FUY A;  1SGQ I;  2GVI A;  4UXJ A;  3B4V C;  2DB6 A;  2KMO A;  5EX0 A;  1DS3 I;  2A20 A;  1Y1C A;  3TJQ A;  2QQE A;  2CJS C;  2L8E A;  2LEO A;  1MT1 A;  1UUC A;  1WTJ A;  2KCX A;  3OL0 A;  5EX3 A;  3UGI A;  1SGD I;  3OXF A;  1LR8 A;  3OXG A;  4GI3 C;  2JA1 A;  2JYY A;  2N1A B;  1U5K A;  1S20 A;  2ROW A;  1Y1B A;  1Z7K B;  3UEY A;  1HPT A;  1IY5 A;  2SGF I;  3CXL A;  1OMT A;  1TBO A;  2B0U C;  2GKV A;  1H0Z A;  1V1I A;  1FAQ A;  1TIH A;  1UVF A;  2ENN A;  2V1C A;  3E59 A;  4DNC A;  1FYB A;  1ULK A;  1AN1 I;  1CE3 A;  3TOB A;  1WGT A;  3TO6 A;  2YQP A;  1K7T A;  2DIP A;  4UXI A;  2JW6 A;  2SGD I;  2XRC A;  2P6A C;  1CT2 I;  1LR9 A;  1TGS I;  3OVO A;  4SGB I;  2ELI A;  5FUX A;  1HEV A;  3QWP A;  2ERW A;  5JHW C;  1SGP I;  1LR7 A;  5FUW A;  3PDN A;  1TBR R;  1K7V A;  1PJU A;  3UEJ A;  2NU2 I;  1ULN A;  4OVO A;  1P9Z A;  1CGJ I;  2CWH A;  2FNF X;  2JXD A;  2SGQ I;  3RU0 A;  1NXU A;  3D00 A;  5E3P A;  1WKX A;  1SGY I;  2ORV A;  5J8C A;  2N71 A;  1BUS A;  2RIJ A;  2L7X A;  1UVG A;  2E73 A;  1PTQ A;  1YU6 C;  1TUR A;  2V53 A;  1MJA A;  3E2I A;  5FUV A;  2LUY A;  3UOE A;  2CWG A;  2UZ3 A;  2X3T A;  1Z2I A;  2ODD A;  3SGB I;  1NUB A;  1Q9B A;  4FKD A;  1YTP A;  1DS2 I;  7WGA A;  3QTL D;  1P9G A;  2SGP I;  3OXL A;  2CWF A;  3R5D A;  2B8T A;  3VDP A;  1PTR A;  4E1P A;  1Y8F A;  2NU3 I;  1TOT A;  1UHA A;  2YUU A;  2UVO A;  1KBE A;  1IY6 A;  1KBF A;  2RC4 A;  3FSX A;  2OZU A;  3R5B A;  1MJ9 A;  1W4R A;  1WGC A;  1SGR I;  3GOX A;  1XA6 A;  4B6D A;  4A24 A;  1CHO I;  3MEK A;  3R5C A;  5CCM A;  2BUS A;  5CCL A;  2LB7 A;  1CT4 I;  2OD1 A;  3TO7 A;  2KMR A;  1R79 A;  1TBN A;  1PPF I;  5J8F A;  1MJB A;  1X4S A;  1K7U A;  2QQ0 A;  1HJA I;  1OVO A;  3KY9 A;  1ULM A;  2ARP F;  4L9M A;  2KMP A;  1SGN I;  1TBQ R;  3R5A A;  1SGE I;  1RFH A;  1XX6 A;  2J87 A;  3SEK C;  1FY7 A;  2X52 A;  3FC3 A;  2NU1 I;  4E1R A;  2GKR I;  2ENZ A;  2VRW B;  5HI7 A;  1X74 A;  2GKT I;  4JCV E;  2N52 A;  2OVO A;  2K9H A;  2PQ8 A;  2W0T A;  1N13 A;  1OMU A;  3FSY A;  5E3Q A;  3HH2 C;  3UGD A;  5HQ8 A;  1CSO I;  2OU2 A;  3QAH A;  4AML A;  2QQD A;  1IW4 A;  3SGQ I;  1XBT A;  2M5X A;  1M8C A;  2GIV A;  1CT0 I;  2KMQ A;  2ORW A;  4MPI A;  3VDU A;  1R0R I;  2QPO A;  1TUS A;  1PCE A;  1VDD A;  2NU4 I;  4WP4 A;  2WVJ A;  5E3R A;  1OYV I;  1V1H A;  2V1C C;  2WCY A;  2NU0 I;  9WGA A;  1KMA A;  1W3S A;  3VE5 A;  4HGU A;  1M8B A;  2JZM A;  2QQC A;  1HDL A;  3UFF A;  2E5R A;  2WGC A;  2F3C I;  2DKV A;  3UGL A;  2J9R A;  1BMO A;  1FAR A;  4UXH A;  3BJI A;  2SGE I;  2Y0M A;  5DAE A; 
#chains in the Genus database with same CATH homology
 2N17 A;  1CGI I;  5FUY A;  1SGQ I;  2GVI A;  4UXJ A;  3B4V C;  2DB6 A;  2KMO A;  5EX0 A;  1DS3 I;  2A20 A;  1Y1C A;  3TJQ A;  2QQE A;  2CJS C;  2L8E A;  2LEO A;  1MT1 A;  1UUC A;  2KCX A;  3OL0 A;  5EX3 A;  3UGI A;  1SGD I;  3OXF A;  1LR8 A;  3OXG A;  4GI3 C;  2JA1 A;  2JYY A;  2N1A B;  1U5K A;  2ROW A;  1Y1B A;  1Z7K B;  3UEY A;  1HPT A;  1IY5 A;  2SGF I;  3CXL A;  1OMT A;  1TBO A;  2B0U C;  2GKV A;  1H0Z A;  1V1I A;  1FAQ A;  1TIH A;  1UVF A;  2ENN A;  2V1C A;  3E59 A;  1FYB A;  1AN1 I;  1CE3 A;  2YQP A;  2DIP A;  4UXI A;  2JW6 A;  2SGD I;  2XRC A;  2P6A C;  1CT2 I;  1LR9 A;  1TGS I;  3OVO A;  4SGB I;  2ELI A;  5FUX A;  3QWP A;  2ERW A;  5JHW C;  1SGP I;  1LR7 A;  5FUW A;  3PDN A;  1TBR R;  1PJU A;  3UEJ A;  2NU2 I;  4OVO A;  1CGJ I;  2SGQ I;  2FNF X;  2JXD A;  3RU0 A;  3D00 A;  1SGY I;  2ORV A;  2N71 A;  1BUS A;  2L7X A;  1UVG A;  2E73 A;  1PTQ A;  1YU6 C;  1TUR A;  2V53 A;  5FUV A;  3E2I A;  2LUY A;  2UZ3 A;  2ODD A;  3SGB I;  1NUB A;  4FKD A;  1YTP A;  1DS2 I;  3QTL D;  2SGP I;  3OXL A;  4E1P A;  2B8T A;  3VDP A;  1PTR A;  1Y8F A;  2NU3 I;  1TOT A;  2YUU A;  1KBE A;  1KBF A;  1W4R A;  1SGR I;  3GOX A;  1XA6 A;  4B6D A;  4A24 A;  1CHO I;  3MEK A;  5CCM A;  2BUS A;  5CCL A;  1CT4 I;  2OD1 A;  2KMR A;  1R79 A;  1TBN A;  1PPF I;  1X4S A;  2QQ0 A;  1HJA I;  1OVO A;  3KY9 A;  4L9M A;  2ARP F;  2KMP A;  1SGN I;  1TBQ R;  1SGE I;  1RFH A;  1XX6 A;  2J87 A;  3SEK C;  3FC3 A;  2NU1 I;  4E1R A;  2GKR I;  2ENZ A;  2VRW B;  5HI7 A;  1X74 A;  2GKT I;  4JCV E;  2N52 A;  2OVO A;  2K9H A;  2W0T A;  1IY6 A;  1N13 A;  1OMU A;  3UGD A;  3HH2 C;  5HQ8 A;  1CSO I;  1IW4 A;  2QQD A;  3SGQ I;  1XBT A;  2M5X A;  1M8C A;  2KMQ A;  1CT0 I;  2ORW A;  3VDU A;  1R0R I;  2QPO A;  1TUS A;  1PCE A;  1VDD A;  2NU4 I;  2WVJ A;  1OYV I;  1V1H A;  2V1C C;  2WCY A;  2NU0 I;  1KMA A;  1W3S A;  3VE5 A;  4HGU A;  1M8B A;  2JZM A;  2QQC A;  1HDL A;  3UFF A;  2E5R A;  2F3C I;  3UGL A;  2J9R A;  1BMO A;  1FAR A;  4UXH A;  3BJI A;  2SGE I;  5DAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...