4GI3C

Crystal structure of greglin in complex with subtilisin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
CPSICPLIYAPVCVEDSNQDFYLFVNECEVRKCGCEAGFVYTFVPREMCKATTSLCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KerA
publication title Crystal structure of greglin, a novel non-classical Kazal inhibitor, in complex with subtilisin
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4gi3C00
1SGDI 1HPTA 1KMAA 2V53A 1CE3A 1HJAI 3TJQA 1Y1BA 1TIHA 1BMOA 1Y1CA 2ARPF 1N13A 1OMTA 1TURA 1CSOI 1UVGA 2N71A 1CGII 1LR9A 1CT4I 1NUBA 1OMUA 4GI3C 1SGPI 2SGFI 1Z7KB 2WCYA 3B4VC 1IY5A 3OVOA 3QTLD 2KMOA 1SGRI 3HH2C 2M5XA 1DS3I 1PPFI 4OVOA 2N17A 1BUSA 5DAEA 3SGBI 1CT0I 2GKRI 1UVFA 2QQDA 1LR7A 1CGJI 2GKTI 2NU2I 1H0ZA 5JHWC 2JZMA 1LR8A 2KCXA 1CHOI 4SGBI 2KMPA 1M8CA 2SGQI 2NU3I 1IW4A 1SGYI 1TBQR 1OVOA 2SGPI 2XRCA 3SGQI 2JXDA 2B0UC 4HGUA 2BUSA 1TBRR 2KMQA 2NU1I 1SGNI 1AN1I 2KMRA 1PCEA 1PJUA 1M8BA 2JYYA 2F3CI 2GKVA 1OYVI 1SGEI 2ERWA 1CT2I 1TUSA 1IY6A 1FYBA 2NU4I 1HDLA 1DS2I 2QQCA 1YU6C 3SEKC 1TGSI 1YTPA 1R0RI 2P6AC 2LEOA 2SGEI 1UUCA 2N52A 1MT1A 1SGQI 2SGDI 2NU0I 2OVOA
chains in the Genus database with same CATH superfamily
1SGDI 1HPTA 5EX0A 1P9ZA 5FUXA 1KMAA 2V53A 2OU2A 2L7XA 1CE3A 1HJAI 2WVJA 1TBNA 3TJQA 1Y1BA 1Y8FA 1TIHA 2L8EA 2Y0MA 1BMOA 4UXJA 5EX3A 3OXGA 4A24A 1Y1CA 1R79A 1XBTA 2ARPF 2X52A 5J8CA 1N13A 1OMTA 1TURA 2QQEA 1CSOI 1UVGA 3VDUA 3TOBA 4MPIA 2N71A 1CGII 1LR9A 7WGAA 1CT4I 1NUBA 2OD1A 1OMUA 2ODDA 4E1PA 1UHAA 1V1HA 2ENZA 1WKXA 1SGPI 4GI3C 1W4RA 2SGFI 4UXHA 1Z7KB 1MJAA 2WCYA 3UGDA 3QWPA 3VE5A 2ELIA 2OZUA 3FSXA 2A20A 3B4VC 1NXUA 1U5KA 1IY5A 4FKDA 1WTJA 2GVIA 3OVOA 3QTLD 1MJBA 2DKVA 5E3QA 2KMOA 1ULKA 3UOEA 1SGRI 3HH2C 2V1CC 1FARA 2JW6A 3BJIA 2ROWA 3QAHA 2M5XA 2QQ0A 1DS3I 1PPFI 4OVOA 2E73A 2N17A 2CWHA 1WGTA 5DAEA 4DNCA 1BUSA 2DIPA 1WGCA 1CT0I 3SGBI 1P9GA 2GKRI 1UVFA 2QQDA 2QPOA 2UZ3A 1S20A 1ULNA 2V1CA 2E5RA 3R5BA 1LR7A 3MEKA 1CGJI 2GKTI 5E3RA 2NU2I 1H0ZA 5JHWC 2WGCA 2K9HA 3KY9A 2JZMA 1LR8A 1V1IA 2KCXA 1PTQA 2LB7A 3UGLA 2DB6A 5J8FA 2N1AB 2X3TA 1CHOI 2CJSC 3OL0A 4JCVE 2RC4A 2CWFA 3E2IA 4SGBI 2GIVA 9WGAA 2KMPA 1M8CA 1ULMA 2SGQI 2J87A 5CCLA 2B8TA 2VRWB 2YQPA 2NU3I 1IW4A 1SGYI 5HQ8A 1FY7A 2ORVA 5FUWA 1TBQR 3UFFA 3UGIA 1K7UA 1OVOA 1PTRA 1K7VA 2SGPI 3TOAA 1X74A 2XRCA 3SGQI 2JXDA 3UEJA 2B0UC 3GOXA 3OXLA 3FSYA 4E1RA 5CCMA 1KBEA 4HGUA 3OXFA 3R5DA 3R5CA 2BUSA 4WP4A 3CXLA 1TBRR 3UEYA 2KMQA 2NU1I 1HEVA 2CWGA 4AMLA 1SGNI 1AN1I 2JA1A 1XA6A 2KMRA 4UXIA 3FC3A 4B6DA 1PCEA 1W3SA 4L9MA 5FUYA 2RIJA 3TO6A 1PJUA 2PQ8A 1M8BA 3E59A 2FNFX 2LUYA 1X4SA 2F3CI 2JYYA 5HI7A 2GKVA 1TBOA 1TOTA 3TO7A 2YUUA 1OYVI 1SGEI 2ERWA 1CT2I 1K7TA 1TUSA 1IY6A 1FAQA 3PDNA 2J9RA 1Q9BA 1FYBA 2ENNA 2NU4I 1HDLA 1VDDA 3D00A 1DS2I 2QQCA 1YU6C 3RU0A 3TO9A 3SEKC 3R5AA 1TGSI 1YTPA 1R0RI 1KBFA 2P6AC 5FUVA 2LEOA 2SGEI 2UVOA 1Z2IA 2W0TA 1UUCA 1MJ9A 2N52A 1MT1A 1SGQI 2SGDI 1XX6A 5E3PA 3VDPA 2ORWA 2NU0I 1RFHA 2OVOA
chains in the Genus database with same CATH topology
1SGDI 1HPTA 5EX0A 5FUXA 1KMAA 2V53A 2L7XA 1CE3A 1HJAI 2WVJA 1TBNA 3TJQA 1Y1BA 1Y8FA 1TIHA 2L8EA 1BMOA 4UXJA 5EX3A 3OXGA 4A24A 1Y1CA 1R79A 1XBTA 2ARPF 1N13A 1OMTA 1TURA 2QQEA 1CSOI 1UVGA 3VDUA 2N71A 1CGII 1LR9A 1CT4I 1NUBA 2OD1A 1OMUA 2ODDA 4E1PA 1V1HA 2ENZA 4GI3C 1SGPI 1W4RA 2SGFI 4UXHA 1Z7KB 3UGDA 2WCYA 3QWPA 3VE5A 2ELIA 2A20A 3B4VC 1U5KA 1IY5A 4FKDA 2GVIA 3OVOA 3QTLD 2KMOA 1SGRI 3HH2C 2V1CC 1FARA 2JW6A 3BJIA 2ROWA 2M5XA 2QQ0A 1DS3I 1PPFI 4OVOA 2E73A 2N17A 1BUSA 5DAEA 2DIPA 3SGBI 1CT0I 2GKRI 2UZ3A 1UVFA 2QQDA 2QPOA 2V1CA 2E5RA 1LR7A 3MEKA 1CGJI 2GKTI 2NU2I 1H0ZA 5JHWC 3UGLA 2K9HA 3KY9A 2JZMA 1LR8A 1V1IA 2KCXA 1PTQA 2DB6A 2N1AB 3OL0A 1CHOI 2CJSC 4JCVE 3E2IA 4SGBI 2KMPA 1M8CA 2SGQI 2J87A 5CCLA 2B8TA 2VRWB 2YQPA 2NU3I 1IW4A 1SGYI 5HQ8A 2ORVA 5FUWA 1TBQR 3UFFA 3UGIA 1OVOA 1PTRA 2SGPI 1X74A 2XRCA 3SGQI 2JXDA 3UEJA 2B0UC 3GOXA 3OXLA 4E1RA 5CCMA 1KBEA 4HGUA 3OXFA 2BUSA 3CXLA 1TBRR 3UEYA 2KMQA 2NU1I 1SGNI 1AN1I 2JA1A 1XA6A 2KMRA 4UXIA 3FC3A 4B6DA 1PCEA 1W3SA 4L9MA 5FUYA 1PJUA 1M8BA 3E59A 2FNFX 2LUYA 1X4SA 2F3CI 2JYYA 5HI7A 2GKVA 1TBOA 1TOTA 2YUUA 1OYVI 1SGEI 2ERWA 1CT2I 1TUSA 1IY6A 1FAQA 3PDNA 2J9RA 1FYBA 2ENNA 2NU4I 1HDLA 1VDDA 3D00A 1DS2I 2QQCA 1YU6C 3RU0A 3SEKC 1TGSI 1YTPA 1R0RI 1KBFA 2P6AC 5FUVA 2LEOA 2SGEI 2W0TA 1UUCA 2N52A 3VDPA 1MT1A 1SGQI 2SGDI 1XX6A 2ORWA 2NU0I 1RFHA 2OVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGD I;  1HPT A;  1KMA A;  2V53 A;  1CE3 A;  1HJA I;  3TJQ A;  1Y1B A;  1TIH A;  1BMO A;  1Y1C A;  2ARP F;  1N13 A;  1OMT A;  1TUR A;  1CSO I;  1UVG A;  2N71 A;  1CGI I;  1LR9 A;  1CT4 I;  1NUB A;  1OMU A;  4GI3 C;  1SGP I;  2SGF I;  1Z7K B;  2WCY A;  3B4V C;  1IY5 A;  3OVO A;  3QTL D;  2KMO A;  1SGR I;  3HH2 C;  2M5X A;  1DS3 I;  1PPF I;  4OVO A;  2N17 A;  1BUS A;  5DAE A;  3SGB I;  1CT0 I;  2GKR I;  1UVF A;  2QQD A;  1LR7 A;  1CGJ I;  2GKT I;  2NU2 I;  1H0Z A;  5JHW C;  2JZM A;  1LR8 A;  2KCX A;  1CHO I;  4SGB I;  2KMP A;  1M8C A;  2SGQ I;  2NU3 I;  1IW4 A;  1SGY I;  1TBQ R;  1OVO A;  2SGP I;  2XRC A;  3SGQ I;  2JXD A;  2B0U C;  4HGU A;  2BUS A;  1TBR R;  2KMQ A;  2NU1 I;  1SGN I;  1AN1 I;  2KMR A;  1PCE A;  1PJU A;  1M8B A;  2JYY A;  2F3C I;  2GKV A;  1OYV I;  1SGE I;  2ERW A;  1CT2 I;  1TUS A;  1IY6 A;  1FYB A;  2NU4 I;  1HDL A;  1DS2 I;  2QQC A;  1YU6 C;  3SEK C;  1TGS I;  1YTP A;  1R0R I;  2P6A C;  2LEO A;  2SGE I;  1UUC A;  2N52 A;  1MT1 A;  1SGQ I;  2SGD I;  2NU0 I;  2OVO A; 
#chains in the Genus database with same CATH topology
 1SGD I;  1HPT A;  5EX0 A;  1P9Z A;  5FUX A;  1KMA A;  2V53 A;  2OU2 A;  2L7X A;  1CE3 A;  1HJA I;  2WVJ A;  1TBN A;  3TJQ A;  1Y1B A;  1Y8F A;  1TIH A;  2L8E A;  2Y0M A;  1BMO A;  4UXJ A;  5EX3 A;  3OXG A;  4A24 A;  1Y1C A;  1R79 A;  1XBT A;  2ARP F;  2X52 A;  5J8C A;  1N13 A;  1OMT A;  1TUR A;  2QQE A;  1CSO I;  1UVG A;  3VDU A;  3TOB A;  4MPI A;  2N71 A;  1CGI I;  1LR9 A;  7WGA A;  1CT4 I;  1NUB A;  2OD1 A;  1OMU A;  2ODD A;  4E1P A;  1UHA A;  1V1H A;  2ENZ A;  1WKX A;  1SGP I;  4GI3 C;  1W4R A;  2SGF I;  4UXH A;  1Z7K B;  1MJA A;  2WCY A;  3UGD A;  3QWP A;  3VE5 A;  2ELI A;  2OZU A;  3FSX A;  2A20 A;  3B4V C;  1NXU A;  1U5K A;  1IY5 A;  4FKD A;  1WTJ A;  2GVI A;  3OVO A;  3QTL D;  1MJB A;  2DKV A;  5E3Q A;  2KMO A;  1ULK A;  3UOE A;  1SGR I;  3HH2 C;  2V1C C;  1FAR A;  2JW6 A;  3BJI A;  2ROW A;  3QAH A;  2M5X A;  2QQ0 A;  1DS3 I;  1PPF I;  4OVO A;  2E73 A;  2N17 A;  2CWH A;  1WGT A;  5DAE A;  4DNC A;  1BUS A;  2DIP A;  1WGC A;  1CT0 I;  3SGB I;  1P9G A;  2GKR I;  1UVF A;  2QQD A;  2QPO A;  2UZ3 A;  1S20 A;  1ULN A;  2V1C A;  2E5R A;  3R5B A;  1LR7 A;  3MEK A;  1CGJ I;  2GKT I;  5E3R A;  2NU2 I;  1H0Z A;  5JHW C;  2WGC A;  2K9H A;  3KY9 A;  2JZM A;  1LR8 A;  1V1I A;  2KCX A;  1PTQ A;  2LB7 A;  3UGL A;  2DB6 A;  5J8F A;  2N1A B;  2X3T A;  1CHO I;  2CJS C;  3OL0 A;  4JCV E;  2RC4 A;  2CWF A;  3E2I A;  4SGB I;  2GIV A;  9WGA A;  2KMP A;  1M8C A;  1ULM A;  2SGQ I;  2J87 A;  5CCL A;  2B8T A;  2VRW B;  2YQP A;  2NU3 I;  1IW4 A;  1SGY I;  5HQ8 A;  1FY7 A;  2ORV A;  5FUW A;  1TBQ R;  3UFF A;  3UGI A;  1K7U A;  1OVO A;  1PTR A;  1K7V A;  2SGP I;  3TOA A;  1X74 A;  2XRC A;  3SGQ I;  2JXD A;  3UEJ A;  2B0U C;  3GOX A;  3OXL A;  3FSY A;  4E1R A;  5CCM A;  1KBE A;  4HGU A;  3OXF A;  3R5D A;  3R5C A;  2BUS A;  4WP4 A;  3CXL A;  1TBR R;  3UEY A;  2KMQ A;  2NU1 I;  1HEV A;  2CWG A;  4AML A;  1SGN I;  1AN1 I;  2JA1 A;  1XA6 A;  2KMR A;  4UXI A;  3FC3 A;  4B6D A;  1PCE A;  1W3S A;  4L9M A;  5FUY A;  2RIJ A;  3TO6 A;  1PJU A;  2PQ8 A;  1M8B A;  3E59 A;  2FNF X;  2LUY A;  1X4S A;  2F3C I;  2JYY A;  5HI7 A;  2GKV A;  1TBO A;  1TOT A;  3TO7 A;  2YUU A;  1OYV I;  1SGE I;  2ERW A;  1CT2 I;  1K7T A;  1TUS A;  1IY6 A;  1FAQ A;  3PDN A;  2J9R A;  1Q9B A;  1FYB A;  2ENN A;  2NU4 I;  1HDL A;  1VDD A;  3D00 A;  1DS2 I;  2QQC A;  1YU6 C;  3RU0 A;  3TO9 A;  3SEK C;  3R5A A;  1TGS I;  1YTP A;  1R0R I;  1KBF A;  2P6A C;  5FUV A;  2LEO A;  2SGE I;  2UVO A;  1Z2I A;  2W0T A;  1UUC A;  1MJ9 A;  2N52 A;  1MT1 A;  1SGQ I;  2SGD I;  1XX6 A;  5E3P A;  3VDP A;  2ORW A;  2NU0 I;  1RFH A;  2OVO A; 
#chains in the Genus database with same CATH homology
 1SGD I;  1HPT A;  5EX0 A;  5FUX A;  1KMA A;  2V53 A;  2L7X A;  1CE3 A;  1HJA I;  2WVJ A;  1TBN A;  3TJQ A;  1Y1B A;  1Y8F A;  1TIH A;  2L8E A;  1BMO A;  4UXJ A;  5EX3 A;  3OXG A;  4A24 A;  1Y1C A;  1R79 A;  1XBT A;  2ARP F;  1N13 A;  1OMT A;  1TUR A;  2QQE A;  1CSO I;  1UVG A;  3VDU A;  2N71 A;  1CGI I;  1LR9 A;  1CT4 I;  1NUB A;  2OD1 A;  1OMU A;  2ODD A;  4E1P A;  1V1H A;  2ENZ A;  4GI3 C;  1SGP I;  1W4R A;  2SGF I;  4UXH A;  1Z7K B;  3UGD A;  2WCY A;  3QWP A;  3VE5 A;  2ELI A;  2A20 A;  3B4V C;  1U5K A;  1IY5 A;  4FKD A;  2GVI A;  3OVO A;  3QTL D;  2KMO A;  1SGR I;  3HH2 C;  2V1C C;  1FAR A;  2JW6 A;  3BJI A;  2ROW A;  2M5X A;  2QQ0 A;  1DS3 I;  1PPF I;  4OVO A;  2E73 A;  2N17 A;  1BUS A;  5DAE A;  2DIP A;  3SGB I;  1CT0 I;  2GKR I;  2UZ3 A;  1UVF A;  2QQD A;  2QPO A;  2V1C A;  2E5R A;  1LR7 A;  3MEK A;  1CGJ I;  2GKT I;  2NU2 I;  1H0Z A;  5JHW C;  3UGL A;  2K9H A;  3KY9 A;  2JZM A;  1LR8 A;  1V1I A;  2KCX A;  1PTQ A;  2DB6 A;  2N1A B;  3OL0 A;  1CHO I;  2CJS C;  4JCV E;  3E2I A;  4SGB I;  2KMP A;  1M8C A;  2SGQ I;  2J87 A;  5CCL A;  2B8T A;  2VRW B;  2YQP A;  2NU3 I;  1IW4 A;  1SGY I;  5HQ8 A;  2ORV A;  5FUW A;  1TBQ R;  3UFF A;  3UGI A;  1OVO A;  1PTR A;  2SGP I;  1X74 A;  2XRC A;  3SGQ I;  2JXD A;  3UEJ A;  2B0U C;  3GOX A;  3OXL A;  4E1R A;  5CCM A;  1KBE A;  4HGU A;  3OXF A;  2BUS A;  3CXL A;  1TBR R;  3UEY A;  2KMQ A;  2NU1 I;  1SGN I;  1AN1 I;  2JA1 A;  1XA6 A;  2KMR A;  4UXI A;  3FC3 A;  4B6D A;  1PCE A;  1W3S A;  4L9M A;  5FUY A;  1PJU A;  1M8B A;  3E59 A;  2FNF X;  2LUY A;  1X4S A;  2F3C I;  2JYY A;  5HI7 A;  2GKV A;  1TBO A;  1TOT A;  2YUU A;  1OYV I;  1SGE I;  2ERW A;  1CT2 I;  1TUS A;  1IY6 A;  1FAQ A;  3PDN A;  2J9R A;  1FYB A;  2ENN A;  2NU4 I;  1HDL A;  1VDD A;  3D00 A;  1DS2 I;  2QQC A;  1YU6 C;  3RU0 A;  3SEK C;  1TGS I;  1YTP A;  1R0R I;  1KBF A;  2P6A C;  5FUV A;  2LEO A;  2SGE I;  2W0T A;  1UUC A;  2N52 A;  3VDP A;  1MT1 A;  1SGQ I;  2SGD I;  1XX6 A;  2ORW A;  2NU0 I;  1RFH A;  2OVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...