2LEOA

Solution structure of esophageal cancer-related gene 2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Serine protease inhibitor Kazal-type 7
publication title NMR structure note: human esophageal cancer-related gene 2
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2leoA00
1CGII 2GKTI 1UUCA 1PPFI 1TURA 2N17A 3SEKC 1CT0I 2P6AC 2BUSA 5JHWC 2B0UC 1SGRI 1LR8A 2OVOA 2JXDA 2NU1I 1FYBA 1OYVI 2SGDI 4SGBI 1HJAI 1DS3I 1SGQI 1OVOA 1UVFA 2NU3I 3OVOA 1SGDI 2SGPI 1Y1CA 1N13A 2GKRI 2QQDA 1HDLA 2SGEI 1OMTA 1Z7KB 2NU4I 1BMOA 1MT1A 1TBRR 1PCEA 2KMPA 1IW4A 2V53A 2QQCA 1H0ZA 1CHOI 1SGPI 2JZMA 3HH2C 2N52A 1AN1I 5DAEA 2NU0I 4OVOA 1LR9A 1UVGA 2XRCA 2LEOA 1TGSI 1TBQR 2KMOA 1CGJI 1YTPA 2F3CI 2JYYA 4HGUA 2SGQI 2M5XA 1TIHA 3B4VC 1IY6A 1KMAA 3SGBI 1CSOI 4GI3C 1R0RI 2KCXA 3QTLD 2SGFI 1M8CA 1OMUA 2N71A 2NU2I 2WCYA 1SGEI 1SGNI 1TUSA 3SGQI 1Y1BA 1YU6C 1LR7A 1PJUA 1DS2I 2KMQA 3TJQA 2KMRA 1BUSA 2ARPF 2ERWA 1HPTA 1SGYI 1CE3A 1CT2I 1NUBA 1M8BA 1CT4I 1IY5A 2GKVA
chains in the Genus database with same CATH superfamily
2LUYA 1CGII 2N1AB 3QAHA 5CCMA 1Z2IA 2GKTI 2L7XA 1UUCA 1PPFI 2GVIA 1X74A 3QWPA 1TURA 2N17A 3SEKC 1W3SA 1CT0I 1WKXA 3BJIA 2P6AC 2RIJA 2BUSA 4UXHA 5JHWC 3R5AA 4A24A 2B0UC 3RU0A 1SGRI 3R5DA 1LR8A 1PTQA 2OVOA 2WVJA 2JXDA 4FKDA 2NU1I 2ELIA 1K7TA 2QQEA 2RC4A 1OYVI 5CCLA 3GOXA 1FYBA 2LB7A 3KY9A 2B8TA 2CWHA 1Y8FA 2SGDI 4L9MA 4SGBI 1HJAI 1V1HA 3VDUA 3CXLA 1DS3I 1SGQI 5FUXA 1OVOA 1UVFA 2NU3I 2A20A 3OVOA 1SGDI 7WGAA 1P9ZA 5EX0A 5J8FA 2X3TA 1ULKA 1Y1CA 2QQ0A 2SGPI 4UXIA 3FSXA 1FAQA 1N13A 1U5KA 1ULNA 3UFFA 3FC3A 2L8EA 1NXUA 2GKRI 1X4SA 2J9RA 1WGTA 2QQDA 2SGEI 1HDLA 1OMTA 2V1CA 1Z7KB 3TOBA 1XBTA 1BMOA 2ENZA 2NU4I 1MT1A 1TBRR 1P9GA 1KBEA 2DKVA 1WTJA 1K7UA 2ENNA 1PCEA 1XX6A 2KMPA 3D00A 3E59A 1IW4A 1PTRA 2J87A 2DIPA 2ORWA 2V53A 1HEVA 1WGCA 2QQCA 2V1CC 3UEYA 2ROWA 1K7VA 4MPIA 5E3PA 1H0ZA 3UOEA 3OXGA 1CHOI 1MJAA 1SGPI 2JZMA 3HH2C 3OXLA 2N52A 2CWFA 2GIVA 1AN1I 5DAEA 3UGLA 2NU0I 2QPOA 2WGCA 1TBNA 4OVOA 2YUUA 1ULMA 5HI7A 4JCVE 5HQ8A 1LR9A 1UVGA 1XA6A 2XRCA 2LEOA 3FSYA 1TGSI 1S20A 1TBQR 1TBOA 9WGAA 4E1RA 1VDDA 2KMOA 2Y0MA 2W0TA 2FNFX 1CGJI 1MJ9A 1YTPA 2F3CI 3E2IA 4B6DA 3UGIA 2JYYA 3R5BA 4HGUA 3PDNA 2SGQI 2M5XA 5E3QA 2OD1A 5J8CA 1TIHA 2JW6A 3B4VC 1IY6A 1KMAA 2ORVA 3TOAA 3R5CA 5FUWA 3SGBI 4UXJA 1CSOI 4AMLA 2PQ8A 4GI3C 2K9HA 4E1PA 2X52A 1R0RI 1MJBA 2KCXA 1Q9BA 2SGFI 3QTLD 1RFHA 1M8CA 1OMUA 2E73A 3VE5A 2N71A 3VDPA 1V1IA 2OZUA 2DB6A 2NU2I 2WCYA 1SGEI 1TOTA 2JA1A 2VRWB 2CWGA 1SGNI 1TUSA 5E3RA 2ODDA 3SGQI 1Y1BA 2UZ3A 1YU6C 3UGDA 1LR7A 1PJUA 1DS2I 3TO9A 2CJSC 2KMQA 3OXFA 3TO7A 3TJQA 2KMRA 1BUSA 2OU2A 2ARPF 3MEKA 5EX3A 3OL0A 2ERWA 1FY7A 1W4RA 1HPTA 1UHAA 5FUVA 3TO6A 2E5RA 4WP4A 5FUYA 1R79A 1SGYI 1KBFA 1CE3A 1CT2I 4DNCA 1NUBA 2UVOA 1M8BA 2YQPA 1FARA 3UEJA 1CT4I 1IY5A 2GKVA
chains in the Genus database with same CATH topology
2LUYA 1CGII 2N1AB 5CCMA 2GKTI 2L7XA 1UUCA 1PPFI 2GVIA 1X74A 3QWPA 1TURA 2N17A 3SEKC 1W3SA 1CT0I 3BJIA 2P6AC 2BUSA 4UXHA 5JHWC 4A24A 2B0UC 3RU0A 1SGRI 1LR8A 1PTQA 2OVOA 2WVJA 2JXDA 4FKDA 2NU1I 2ELIA 2QQEA 5CCLA 1OYVI 3GOXA 1FYBA 3KY9A 2B8TA 2SGDI 1Y8FA 4L9MA 4SGBI 3VDUA 1HJAI 1V1HA 3CXLA 1DS3I 1SGQI 5FUXA 1OVOA 1UVFA 2NU3I 2A20A 3OVOA 1SGDI 5EX0A 2SGPI 1Y1CA 2QQ0A 4UXIA 1FAQA 1N13A 1U5KA 3UFFA 3FC3A 2L8EA 2GKRI 2J9RA 1X4SA 2QQDA 2SGEI 1HDLA 1KBFA 1OMTA 2V1CA 1Z7KB 1XBTA 1BMOA 2ENZA 2NU4I 1MT1A 1TBRR 2ENNA 1KBEA 1PCEA 1XX6A 2KMPA 3D00A 3E59A 1IW4A 1PTRA 2J87A 2DIPA 2ORWA 2V53A 2QQCA 2V1CC 3UEYA 2ROWA 1H0ZA 3OXGA 1CHOI 1SGPI 2JZMA 3HH2C 3OXLA 2N52A 3UGLA 1AN1I 5DAEA 2NU0I 2QPOA 1TBNA 4OVOA 2YUUA 5HI7A 4JCVE 5HQ8A 1LR9A 1XA6A 1UVGA 2XRCA 2LEOA 1TGSI 1TBQR 1TBOA 4E1RA 1VDDA 2KMOA 2W0TA 2FNFX 1CGJI 1YTPA 2F3CI 3E2IA 4B6DA 3UGIA 2JYYA 4HGUA 3PDNA 2SGQI 2M5XA 2OD1A 1TIHA 2JW6A 3B4VC 1IY6A 1KMAA 2ORVA 5FUWA 3SGBI 4UXJA 1CSOI 4GI3C 2K9HA 4E1PA 1R0RI 2KCXA 3QTLD 2SGFI 1RFHA 1M8CA 1OMUA 2E73A 3VE5A 2N71A 3VDPA 1V1IA 2DB6A 2NU2I 2WCYA 1SGEI 1TOTA 2JA1A 2VRWB 1SGNI 1TUSA 2ODDA 3SGQI 1Y1BA 2UZ3A 1YU6C 3UGDA 1LR7A 1PJUA 1DS2I 2CJSC 2KMQA 3OXFA 3TJQA 2KMRA 1BUSA 5EX3A 2ARPF 3MEKA 3OL0A 2ERWA 1W4RA 1HPTA 5FUVA 2E5RA 5FUYA 1R79A 1SGYI 1CE3A 1CT2I 1NUBA 1M8BA 2YQPA 1FARA 3UEJA 1CT4I 1IY5A 2GKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGI I;  2GKT I;  1UUC A;  1PPF I;  1TUR A;  2N17 A;  3SEK C;  1CT0 I;  2P6A C;  2BUS A;  5JHW C;  2B0U C;  1SGR I;  1LR8 A;  2OVO A;  2JXD A;  2NU1 I;  1FYB A;  1OYV I;  2SGD I;  4SGB I;  1HJA I;  1DS3 I;  1SGQ I;  1OVO A;  1UVF A;  2NU3 I;  3OVO A;  1SGD I;  2SGP I;  1Y1C A;  1N13 A;  2GKR I;  2QQD A;  1HDL A;  2SGE I;  1OMT A;  1Z7K B;  2NU4 I;  1BMO A;  1MT1 A;  1TBR R;  1PCE A;  2KMP A;  1IW4 A;  2V53 A;  2QQC A;  1H0Z A;  1CHO I;  1SGP I;  2JZM A;  3HH2 C;  2N52 A;  1AN1 I;  5DAE A;  2NU0 I;  4OVO A;  1LR9 A;  1UVG A;  2XRC A;  2LEO A;  1TGS I;  1TBQ R;  2KMO A;  1CGJ I;  1YTP A;  2F3C I;  2JYY A;  4HGU A;  2SGQ I;  2M5X A;  1TIH A;  3B4V C;  1IY6 A;  1KMA A;  3SGB I;  1CSO I;  4GI3 C;  1R0R I;  2KCX A;  3QTL D;  2SGF I;  1M8C A;  1OMU A;  2N71 A;  2NU2 I;  2WCY A;  1SGE I;  1SGN I;  1TUS A;  3SGQ I;  1Y1B A;  1YU6 C;  1LR7 A;  1PJU A;  1DS2 I;  2KMQ A;  3TJQ A;  2KMR A;  1BUS A;  2ARP F;  2ERW A;  1HPT A;  1SGY I;  1CE3 A;  1CT2 I;  1NUB A;  1M8B A;  1CT4 I;  1IY5 A;  2GKV A; 
#chains in the Genus database with same CATH topology
 2LUY A;  1CGI I;  2N1A B;  3QAH A;  5CCM A;  1Z2I A;  2GKT I;  2L7X A;  1UUC A;  1PPF I;  2GVI A;  1X74 A;  3QWP A;  1TUR A;  2N17 A;  3SEK C;  1W3S A;  1CT0 I;  1WKX A;  3BJI A;  2P6A C;  2RIJ A;  2BUS A;  4UXH A;  5JHW C;  3R5A A;  4A24 A;  2B0U C;  3RU0 A;  1SGR I;  3R5D A;  1LR8 A;  1PTQ A;  2OVO A;  2WVJ A;  2JXD A;  4FKD A;  2NU1 I;  2ELI A;  1K7T A;  2QQE A;  2RC4 A;  1OYV I;  5CCL A;  3GOX A;  1FYB A;  2LB7 A;  3KY9 A;  2B8T A;  2CWH A;  1Y8F A;  2SGD I;  4L9M A;  4SGB I;  1HJA I;  1V1H A;  3VDU A;  3CXL A;  1DS3 I;  1SGQ I;  5FUX A;  1OVO A;  1UVF A;  2NU3 I;  2A20 A;  3OVO A;  1SGD I;  7WGA A;  1P9Z A;  5EX0 A;  5J8F A;  2X3T A;  1ULK A;  1Y1C A;  2QQ0 A;  2SGP I;  4UXI A;  3FSX A;  1FAQ A;  1N13 A;  1U5K A;  1ULN A;  3UFF A;  3FC3 A;  2L8E A;  1NXU A;  2GKR I;  1X4S A;  2J9R A;  1WGT A;  2QQD A;  2SGE I;  1HDL A;  1OMT A;  2V1C A;  1Z7K B;  3TOB A;  1XBT A;  1BMO A;  2ENZ A;  2NU4 I;  1MT1 A;  1TBR R;  1P9G A;  1KBE A;  2DKV A;  1WTJ A;  1K7U A;  2ENN A;  1PCE A;  1XX6 A;  2KMP A;  3D00 A;  3E59 A;  1IW4 A;  1PTR A;  2J87 A;  2DIP A;  2ORW A;  2V53 A;  1HEV A;  1WGC A;  2QQC A;  2V1C C;  3UEY A;  2ROW A;  1K7V A;  4MPI A;  5E3P A;  1H0Z A;  3UOE A;  3OXG A;  1CHO I;  1MJA A;  1SGP I;  2JZM A;  3HH2 C;  3OXL A;  2N52 A;  2CWF A;  2GIV A;  1AN1 I;  5DAE A;  3UGL A;  2NU0 I;  2QPO A;  2WGC A;  1TBN A;  4OVO A;  2YUU A;  1ULM A;  5HI7 A;  4JCV E;  5HQ8 A;  1LR9 A;  1UVG A;  1XA6 A;  2XRC A;  2LEO A;  3FSY A;  1TGS I;  1S20 A;  1TBQ R;  1TBO A;  9WGA A;  4E1R A;  1VDD A;  2KMO A;  2Y0M A;  2W0T A;  2FNF X;  1CGJ I;  1MJ9 A;  1YTP A;  2F3C I;  3E2I A;  4B6D A;  3UGI A;  2JYY A;  3R5B A;  4HGU A;  3PDN A;  2SGQ I;  2M5X A;  5E3Q A;  2OD1 A;  5J8C A;  1TIH A;  2JW6 A;  3B4V C;  1IY6 A;  1KMA A;  2ORV A;  3TOA A;  3R5C A;  5FUW A;  3SGB I;  4UXJ A;  1CSO I;  4AML A;  2PQ8 A;  4GI3 C;  2K9H A;  4E1P A;  2X52 A;  1R0R I;  1MJB A;  2KCX A;  1Q9B A;  2SGF I;  3QTL D;  1RFH A;  1M8C A;  1OMU A;  2E73 A;  3VE5 A;  2N71 A;  3VDP A;  1V1I A;  2OZU A;  2DB6 A;  2NU2 I;  2WCY A;  1SGE I;  1TOT A;  2JA1 A;  2VRW B;  2CWG A;  1SGN I;  1TUS A;  5E3R A;  2ODD A;  3SGQ I;  1Y1B A;  2UZ3 A;  1YU6 C;  3UGD A;  1LR7 A;  1PJU A;  1DS2 I;  3TO9 A;  2CJS C;  2KMQ A;  3OXF A;  3TO7 A;  3TJQ A;  2KMR A;  1BUS A;  2OU2 A;  2ARP F;  3MEK A;  5EX3 A;  3OL0 A;  2ERW A;  1FY7 A;  1W4R A;  1HPT A;  1UHA A;  5FUV A;  3TO6 A;  2E5R A;  4WP4 A;  5FUY A;  1R79 A;  1SGY I;  1KBF A;  1CE3 A;  1CT2 I;  4DNC A;  1NUB A;  2UVO A;  1M8B A;  2YQP A;  1FAR A;  3UEJ A;  1CT4 I;  1IY5 A;  2GKV A; 
#chains in the Genus database with same CATH homology
 2LUY A;  1CGI I;  2N1A B;  5CCM A;  2GKT I;  2L7X A;  1UUC A;  1PPF I;  2GVI A;  1X74 A;  3QWP A;  1TUR A;  2N17 A;  3SEK C;  1W3S A;  1CT0 I;  3BJI A;  2P6A C;  2BUS A;  4UXH A;  5JHW C;  4A24 A;  2B0U C;  3RU0 A;  1SGR I;  1LR8 A;  1PTQ A;  2OVO A;  2WVJ A;  2JXD A;  4FKD A;  2NU1 I;  2ELI A;  2QQE A;  5CCL A;  1OYV I;  3GOX A;  1FYB A;  3KY9 A;  2B8T A;  2SGD I;  1Y8F A;  4L9M A;  4SGB I;  3VDU A;  1HJA I;  1V1H A;  3CXL A;  1DS3 I;  1SGQ I;  5FUX A;  1OVO A;  1UVF A;  2NU3 I;  2A20 A;  3OVO A;  1SGD I;  5EX0 A;  2SGP I;  1Y1C A;  2QQ0 A;  4UXI A;  1FAQ A;  1N13 A;  1U5K A;  3UFF A;  3FC3 A;  2L8E A;  2GKR I;  2J9R A;  1X4S A;  2QQD A;  2SGE I;  1HDL A;  1KBF A;  1OMT A;  2V1C A;  1Z7K B;  1XBT A;  1BMO A;  2ENZ A;  2NU4 I;  1MT1 A;  1TBR R;  2ENN A;  1KBE A;  1PCE A;  1XX6 A;  2KMP A;  3D00 A;  3E59 A;  1IW4 A;  1PTR A;  2J87 A;  2DIP A;  2ORW A;  2V53 A;  2QQC A;  2V1C C;  3UEY A;  2ROW A;  1H0Z A;  3OXG A;  1CHO I;  1SGP I;  2JZM A;  3HH2 C;  3OXL A;  2N52 A;  3UGL A;  1AN1 I;  5DAE A;  2NU0 I;  2QPO A;  1TBN A;  4OVO A;  2YUU A;  5HI7 A;  4JCV E;  5HQ8 A;  1LR9 A;  1XA6 A;  1UVG A;  2XRC A;  2LEO A;  1TGS I;  1TBQ R;  1TBO A;  4E1R A;  1VDD A;  2KMO A;  2W0T A;  2FNF X;  1CGJ I;  1YTP A;  2F3C I;  3E2I A;  4B6D A;  3UGI A;  2JYY A;  4HGU A;  3PDN A;  2SGQ I;  2M5X A;  2OD1 A;  1TIH A;  2JW6 A;  3B4V C;  1IY6 A;  1KMA A;  2ORV A;  5FUW A;  3SGB I;  4UXJ A;  1CSO I;  4GI3 C;  2K9H A;  4E1P A;  1R0R I;  2KCX A;  3QTL D;  2SGF I;  1RFH A;  1M8C A;  1OMU A;  2E73 A;  3VE5 A;  2N71 A;  3VDP A;  1V1I A;  2DB6 A;  2NU2 I;  2WCY A;  1SGE I;  1TOT A;  2JA1 A;  2VRW B;  1SGN I;  1TUS A;  2ODD A;  3SGQ I;  1Y1B A;  2UZ3 A;  1YU6 C;  3UGD A;  1LR7 A;  1PJU A;  1DS2 I;  2CJS C;  2KMQ A;  3OXF A;  3TJQ A;  2KMR A;  1BUS A;  5EX3 A;  2ARP F;  3MEK A;  3OL0 A;  2ERW A;  1W4R A;  1HPT A;  5FUV A;  2E5R A;  5FUY A;  1R79 A;  1SGY I;  1CE3 A;  1CT2 I;  1NUB A;  1M8B A;  2YQP A;  1FAR A;  3UEJ A;  1CT4 I;  1IY5 A;  2GKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...