2LEOA

Solution structure of esophageal cancer-related gene 2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease inhibitor Kazal-type 7
publication title NMR structure note: human esophageal cancer-related gene 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2leoA00
2GKTI 1IW4A 2SGFI 1TBQR 2N17A 1SGDI 1CE3A 2SGDI 1DS3I 1SGQI 1HPTA 2JZMA 1FYBA 1SGYI 1SGPI 3TJQA 1DS2I 1OYVI 2WCYA 2NU2I 5JHWC 1MT1A 1OMTA 2QQDA 2N71A 2KMQA 3SEKC 1UUCA 1TUSA 2KCXA 2NU0I 1CT2I 1IY6A 1SGRI 2M5XA 4SGBI 1CGII 2P6AC 2GKVA 5DAEA 2ARPF 1CT4I 2JYYA 2KMOA 2B0UC 2GKRI 1AN1I 1Z7KB 1BMOA 1PPFI 2NU3I 2LEOA 1CGJI 1OMUA 1HDLA 2JXDA 3QTLD 4HGUA 3OVOA 1M8BA 1TIHA 1R0RI 1N13A 1PCEA 1CT0I 1UVFA 1OVOA 2OVOA 1H0ZA 1Y1CA 2KMPA 1HJAI 1TGSI 1M8CA 2V53A 1Y1BA 2N52A 2XRCA 2BUSA 1TURA 2QQCA 1YU6C 2NU1I 2NU4I 1LR9A 3SGBI 1CSOI 1BUSA 1UVGA 1SGEI 3SGQI 1LR8A 2F3CI 4GI3C 1PJUA 1KMAA 2SGQI 2SGPI 1TBRR 1SGNI 3HH2C 1CHOI 1IY5A 1YTPA 1NUBA 1LR7A 3B4VC 2ERWA 2SGEI 4OVOA 2KMRA
chains in the Genus database with same CATH superfamily
5FUYA 2GKTI 2LB7A 1IW4A 2OU2A 1KBEA 2Y0MA 1R79A 1NXUA 2SGFI 1TBQR 3TO7A 2N17A 2CWHA 1SGDI 1FAQA 3TOBA 1ULKA 1XA6A 1DS3I 1ULNA 2PQ8A 2SGDI 3MEKA 1SGQI 4JCVE 5CCMA 1HPTA 1Q9BA 1V1HA 1SGYI 1SGPI 2JZMA 2L8EA 2ROWA 2UZ3A 1DS2I 2WVJA 3TJQA 1XBTA 2ODDA 1WGTA 3TO9A 1FYBA 2E73A 2CJSC 1OYVI 2VRWB 1P9ZA 2CWFA 2GIVA 1MJBA 2NU2I 1MT1A 2WCYA 2X3TA 2YUUA 1OMTA 1W3SA 2DIPA 2QQDA 1VDDA 3E59A 2ORWA 2N71A 2WGCA 2KMQA 2V1CA 3SEKC 2N1AB 1UUCA 2K9HA 2E5RA 1TUSA 2V1CC 4B6DA 2KCXA 1W4RA 5EX3A 1CE3A 1Y8FA 1TBNA 4AMLA 4E1RA 2NU0I 1CT2I 3R5BA 1HEVA 4WP4A 1IY6A 2QQ0A 3VE5A 1SGRI 4L9MA 3VDUA 2M5XA 1S20A 3UEJA 1FY7A 4SGBI 1CGII 1PTQA 1K7UA 2GKVA 2P6AC 3E2IA 1WTJA 5DAEA 4A24A 1P9GA 3CXLA 2YQPA 4MPIA 4UXHA 2ARPF 2ELIA 1CT4I 2JYYA 1WGCA 2DB6A 2KMOA 2B0UC 2L7XA 2ENNA 3OL0A 2GKRI 4E1PA 1K7VA 3KY9A 2QPOA 1AN1I 1Z7KB 1BMOA 1PPFI 5JHWC 2NU3I 5EX0A 2LEOA 1CGJI 1OMUA 5HQ8A 1HDLA 3VDPA 1Z2IA 1TBOA 2JXDA 1FARA 3BJIA 3RU0A 3QTLD 4HGUA 3OVOA 1M8BA 1TIHA 2JA1A 1R0RI 2RC4A 1N13A 2RIJA 3R5AA 3FSXA 3UFFA 2FNFX 3GOXA 1PCEA 1CT0I 2DKVA 1UVFA 3OXLA 3R5CA 1OVOA 2OVOA 1X4SA 5E3RA 5J8CA 1H0ZA 1V1IA 2ORVA 2J9RA 1Y1CA 2KMPA 1HJAI 1TGSI 4DNCA 1RFHA 1M8CA 2X52A 3QAHA 1TOTA 2V53A 1Y1BA 4UXIA 2N52A 2UVOA 2XRCA 3OXFA 2BUSA 5J8FA 2W0TA 3R5DA 1MJ9A 2A20A 1WKXA 2B8TA 5FUXA 2J87A 1TURA 2QQCA 1ULMA 1YU6C 3UGDA 2CWGA 5HI7A 3UOEA 1XX6A 2NU1I 2NU4I 5E3PA 4FKDA 1LR9A 5FUVA 2OD1A 3SGBI 1CSOI 3FC3A 1BUSA 1UVGA 5CCLA 1SGEI 1KBFA 2JW6A 3SGQI 2LUYA 1LR8A 2F3CI 4GI3C 1U5KA 3FSYA 1PJUA 2QQEA 1KMAA 2SGQI 2SGPI 5FUWA 3TOAA 1TBRR 5E3QA 1SGNI 3HH2C 1CHOI 3UGLA 1YTPA 3D00A 3QWPA 1NUBA 7WGAA 3PDNA 1LR7A 1IY5A 2GVIA 3OXGA 3UGIA 1PTRA 2ENZA 2OZUA 3B4VC 2ERWA 1K7TA 2SGEI 9WGAA 3TO6A 1MJAA 4OVOA 1UHAA 4UXJA 2KMRA 3UEYA 1X74A
chains in the Genus database with same CATH topology
5FUYA 2GKTI 1IW4A 1KBEA 1R79A 2SGFI 1TBQR 2N17A 1SGDI 1FAQA 1XA6A 2SGDI 1DS3I 3MEKA 4JCVE 1CE3A 1SGQI 5CCMA 1HPTA 2JZMA 1V1HA 1SGYI 1SGPI 2L8EA 2ROWA 2UZ3A 3TJQA 1DS2I 2WVJA 1XBTA 2ODDA 1FYBA 2E73A 2CJSC 1OYVI 2VRWB 2WCYA 2NU2I 5JHWC 1MT1A 2YUUA 1OMTA 1W3SA 2DIPA 2QQDA 1VDDA 3E59A 2ORWA 2N71A 2KMQA 2V1CA 3SEKC 2N1AB 1UUCA 2K9HA 2E5RA 1TUSA 2V1CC 4B6DA 2KCXA 1W4RA 5EX3A 1Y8FA 1TBNA 4E1RA 2NU0I 1CT2I 1IY6A 2QQ0A 3VE5A 1SGRI 4L9MA 3VDUA 2M5XA 3UEJA 4SGBI 1CGII 1PTQA 2GKVA 2P6AC 5DAEA 3E2IA 4A24A 3CXLA 2YQPA 4UXHA 2ARPF 2ELIA 1CT4I 2JYYA 2KMOA 2DB6A 2L7XA 2B0UC 3OL0A 2ENNA 2GKRI 4E1PA 3KY9A 2QPOA 1AN1I 1Z7KB 1BMOA 1PPFI 2NU3I 5EX0A 2LEOA 1CGJI 1OMUA 5HQ8A 1HDLA 3VDPA 1TBOA 2JXDA 1FARA 3BJIA 3RU0A 3QTLD 4HGUA 3OVOA 1M8BA 1TIHA 2JA1A 1R0RI 1N13A 3UFFA 2FNFX 3GOXA 1PCEA 1CT0I 1UVFA 3OXLA 1OVOA 2OVOA 1X4SA 1H0ZA 1V1IA 2ORVA 2J9RA 1Y1CA 2KMPA 1HJAI 1TGSI 1RFHA 1M8CA 1TOTA 2V53A 1Y1BA 4UXIA 2N52A 2XRCA 3OXFA 2BUSA 2W0TA 2A20A 2B8TA 5FUXA 2J87A 1TURA 2QQCA 1YU6C 3UGDA 5HI7A 1XX6A 2NU1I 2NU4I 4FKDA 1LR9A 5FUVA 2OD1A 3SGBI 1CSOI 3FC3A 1BUSA 1UVGA 5CCLA 1SGEI 1KBFA 2JW6A 3SGQI 2LUYA 1LR8A 2F3CI 4GI3C 1U5KA 1PJUA 2QQEA 1KMAA 2SGQI 2SGPI 5FUWA 1TBRR 1SGNI 3HH2C 1CHOI 3UGLA 1YTPA 3D00A 3QWPA 1NUBA 1IY5A 3PDNA 1LR7A 2GVIA 3OXGA 3UGIA 1PTRA 2ENZA 3B4VC 2ERWA 2SGEI 4OVOA 4UXJA 2KMRA 3UEYA 1X74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GKT I;  1IW4 A;  2SGF I;  1TBQ R;  2N17 A;  1SGD I;  1CE3 A;  2SGD I;  1DS3 I;  1SGQ I;  1HPT A;  2JZM A;  1FYB A;  1SGY I;  1SGP I;  3TJQ A;  1DS2 I;  1OYV I;  2WCY A;  2NU2 I;  5JHW C;  1MT1 A;  1OMT A;  2QQD A;  2N71 A;  2KMQ A;  3SEK C;  1UUC A;  1TUS A;  2KCX A;  2NU0 I;  1CT2 I;  1IY6 A;  1SGR I;  2M5X A;  4SGB I;  1CGI I;  2P6A C;  2GKV A;  5DAE A;  2ARP F;  1CT4 I;  2JYY A;  2KMO A;  2B0U C;  2GKR I;  1AN1 I;  1Z7K B;  1BMO A;  1PPF I;  2NU3 I;  2LEO A;  1CGJ I;  1OMU A;  1HDL A;  2JXD A;  3QTL D;  4HGU A;  3OVO A;  1M8B A;  1TIH A;  1R0R I;  1N13 A;  1PCE A;  1CT0 I;  1UVF A;  1OVO A;  2OVO A;  1H0Z A;  1Y1C A;  2KMP A;  1HJA I;  1TGS I;  1M8C A;  2V53 A;  1Y1B A;  2N52 A;  2XRC A;  2BUS A;  1TUR A;  2QQC A;  1YU6 C;  2NU1 I;  2NU4 I;  1LR9 A;  3SGB I;  1CSO I;  1BUS A;  1UVG A;  1SGE I;  3SGQ I;  1LR8 A;  2F3C I;  4GI3 C;  1PJU A;  1KMA A;  2SGQ I;  2SGP I;  1TBR R;  1SGN I;  3HH2 C;  1CHO I;  1IY5 A;  1YTP A;  1NUB A;  1LR7 A;  3B4V C;  2ERW A;  2SGE I;  4OVO A;  2KMR A; 
#chains in the Genus database with same CATH topology
 5FUY A;  2GKT I;  2LB7 A;  1IW4 A;  2OU2 A;  1KBE A;  2Y0M A;  1R79 A;  1NXU A;  2SGF I;  1TBQ R;  3TO7 A;  2N17 A;  2CWH A;  1SGD I;  1FAQ A;  3TOB A;  1ULK A;  1XA6 A;  1DS3 I;  1ULN A;  2PQ8 A;  2SGD I;  3MEK A;  1SGQ I;  4JCV E;  5CCM A;  1HPT A;  1Q9B A;  1V1H A;  1SGY I;  1SGP I;  2JZM A;  2L8E A;  2ROW A;  2UZ3 A;  1DS2 I;  2WVJ A;  3TJQ A;  1XBT A;  2ODD A;  1WGT A;  3TO9 A;  1FYB A;  2E73 A;  2CJS C;  1OYV I;  2VRW B;  1P9Z A;  2CWF A;  2GIV A;  1MJB A;  2NU2 I;  1MT1 A;  2WCY A;  2X3T A;  2YUU A;  1OMT A;  1W3S A;  2DIP A;  2QQD A;  1VDD A;  3E59 A;  2ORW A;  2N71 A;  2WGC A;  2KMQ A;  2V1C A;  3SEK C;  2N1A B;  1UUC A;  2K9H A;  2E5R A;  1TUS A;  2V1C C;  4B6D A;  2KCX A;  1W4R A;  5EX3 A;  1CE3 A;  1Y8F A;  1TBN A;  4AML A;  4E1R A;  2NU0 I;  1CT2 I;  3R5B A;  1HEV A;  4WP4 A;  1IY6 A;  2QQ0 A;  3VE5 A;  1SGR I;  4L9M A;  3VDU A;  2M5X A;  1S20 A;  3UEJ A;  1FY7 A;  4SGB I;  1CGI I;  1PTQ A;  1K7U A;  2GKV A;  2P6A C;  3E2I A;  1WTJ A;  5DAE A;  4A24 A;  1P9G A;  3CXL A;  2YQP A;  4MPI A;  4UXH A;  2ARP F;  2ELI A;  1CT4 I;  2JYY A;  1WGC A;  2DB6 A;  2KMO A;  2B0U C;  2L7X A;  2ENN A;  3OL0 A;  2GKR I;  4E1P A;  1K7V A;  3KY9 A;  2QPO A;  1AN1 I;  1Z7K B;  1BMO A;  1PPF I;  5JHW C;  2NU3 I;  5EX0 A;  2LEO A;  1CGJ I;  1OMU A;  5HQ8 A;  1HDL A;  3VDP A;  1Z2I A;  1TBO A;  2JXD A;  1FAR A;  3BJI A;  3RU0 A;  3QTL D;  4HGU A;  3OVO A;  1M8B A;  1TIH A;  2JA1 A;  1R0R I;  2RC4 A;  1N13 A;  2RIJ A;  3R5A A;  3FSX A;  3UFF A;  2FNF X;  3GOX A;  1PCE A;  1CT0 I;  2DKV A;  1UVF A;  3OXL A;  3R5C A;  1OVO A;  2OVO A;  1X4S A;  5E3R A;  5J8C A;  1H0Z A;  1V1I A;  2ORV A;  2J9R A;  1Y1C A;  2KMP A;  1HJA I;  1TGS I;  4DNC A;  1RFH A;  1M8C A;  2X52 A;  3QAH A;  1TOT A;  2V53 A;  1Y1B A;  4UXI A;  2N52 A;  2UVO A;  2XRC A;  3OXF A;  2BUS A;  5J8F A;  2W0T A;  3R5D A;  1MJ9 A;  2A20 A;  1WKX A;  2B8T A;  5FUX A;  2J87 A;  1TUR A;  2QQC A;  1ULM A;  1YU6 C;  3UGD A;  2CWG A;  5HI7 A;  3UOE A;  1XX6 A;  2NU1 I;  2NU4 I;  5E3P A;  4FKD A;  1LR9 A;  5FUV A;  2OD1 A;  3SGB I;  1CSO I;  3FC3 A;  1BUS A;  1UVG A;  5CCL A;  1SGE I;  1KBF A;  2JW6 A;  3SGQ I;  2LUY A;  1LR8 A;  2F3C I;  4GI3 C;  1U5K A;  3FSY A;  1PJU A;  2QQE A;  1KMA A;  2SGQ I;  2SGP I;  5FUW A;  3TOA A;  1TBR R;  5E3Q A;  1SGN I;  3HH2 C;  1CHO I;  3UGL A;  1YTP A;  3D00 A;  3QWP A;  1NUB A;  7WGA A;  3PDN A;  1LR7 A;  1IY5 A;  2GVI A;  3OXG A;  3UGI A;  1PTR A;  2ENZ A;  2OZU A;  3B4V C;  2ERW A;  1K7T A;  2SGE I;  9WGA A;  3TO6 A;  1MJA A;  4OVO A;  1UHA A;  4UXJ A;  2KMR A;  3UEY A;  1X74 A; 
#chains in the Genus database with same CATH homology
 5FUY A;  2GKT I;  1IW4 A;  1KBE A;  1R79 A;  2SGF I;  1TBQ R;  2N17 A;  1SGD I;  1FAQ A;  1XA6 A;  2SGD I;  1DS3 I;  3MEK A;  4JCV E;  1CE3 A;  1SGQ I;  5CCM A;  1HPT A;  2JZM A;  1V1H A;  1SGY I;  1SGP I;  2L8E A;  2ROW A;  2UZ3 A;  3TJQ A;  1DS2 I;  2WVJ A;  1XBT A;  2ODD A;  1FYB A;  2E73 A;  2CJS C;  1OYV I;  2VRW B;  2WCY A;  2NU2 I;  5JHW C;  1MT1 A;  2YUU A;  1OMT A;  1W3S A;  2DIP A;  2QQD A;  1VDD A;  3E59 A;  2ORW A;  2N71 A;  2KMQ A;  2V1C A;  3SEK C;  2N1A B;  1UUC A;  2K9H A;  2E5R A;  1TUS A;  2V1C C;  4B6D A;  2KCX A;  1W4R A;  5EX3 A;  1Y8F A;  1TBN A;  4E1R A;  2NU0 I;  1CT2 I;  1IY6 A;  2QQ0 A;  3VE5 A;  1SGR I;  4L9M A;  3VDU A;  2M5X A;  3UEJ A;  4SGB I;  1CGI I;  1PTQ A;  2GKV A;  2P6A C;  5DAE A;  3E2I A;  4A24 A;  3CXL A;  2YQP A;  4UXH A;  2ARP F;  2ELI A;  1CT4 I;  2JYY A;  2KMO A;  2DB6 A;  2L7X A;  2B0U C;  3OL0 A;  2ENN A;  2GKR I;  4E1P A;  3KY9 A;  2QPO A;  1AN1 I;  1Z7K B;  1BMO A;  1PPF I;  2NU3 I;  5EX0 A;  2LEO A;  1CGJ I;  1OMU A;  5HQ8 A;  1HDL A;  3VDP A;  1TBO A;  2JXD A;  1FAR A;  3BJI A;  3RU0 A;  3QTL D;  4HGU A;  3OVO A;  1M8B A;  1TIH A;  2JA1 A;  1R0R I;  1N13 A;  3UFF A;  2FNF X;  3GOX A;  1PCE A;  1CT0 I;  1UVF A;  3OXL A;  1OVO A;  2OVO A;  1X4S A;  1H0Z A;  1V1I A;  2ORV A;  2J9R A;  1Y1C A;  2KMP A;  1HJA I;  1TGS I;  1RFH A;  1M8C A;  1TOT A;  2V53 A;  1Y1B A;  4UXI A;  2N52 A;  2XRC A;  3OXF A;  2BUS A;  2W0T A;  2A20 A;  2B8T A;  5FUX A;  2J87 A;  1TUR A;  2QQC A;  1YU6 C;  3UGD A;  5HI7 A;  1XX6 A;  2NU1 I;  2NU4 I;  4FKD A;  1LR9 A;  5FUV A;  2OD1 A;  3SGB I;  1CSO I;  3FC3 A;  1BUS A;  1UVG A;  5CCL A;  1SGE I;  1KBF A;  2JW6 A;  3SGQ I;  2LUY A;  1LR8 A;  2F3C I;  4GI3 C;  1U5K A;  1PJU A;  2QQE A;  1KMA A;  2SGQ I;  2SGP I;  5FUW A;  1TBR R;  1SGN I;  3HH2 C;  1CHO I;  3UGL A;  1YTP A;  3D00 A;  3QWP A;  1NUB A;  1IY5 A;  3PDN A;  1LR7 A;  2GVI A;  3OXG A;  3UGI A;  1PTR A;  2ENZ A;  3B4V C;  2ERW A;  2SGE I;  4OVO A;  4UXJ A;  2KMR A;  3UEY A;  1X74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...