2M5XA

Novel method of protein purification for structural research. example of ultra high resolution structure of spi-2 inhibitor by x-ray and nmr spectroscopy.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
40
structure length
40
Chain Sequence
EAAVCTTEWDPVCGKDGKTYSNLCWLNEAGVGLDHEGECL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Silk protease inhibitor 2
publication title Atomic resolution structure of a protein prepared by non-enzymatic His-tag removal. Crystallographic and NMR study of GmSPI-2 inhibitor.
pubmed doi rcsb
source organism Galleria mellonella
molecule tags Hydrolase inhibitor
total genus 7
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2m5xA00
3HH2C 1PPFI 2P6AC 3SEKC 1BUSA 1DS3I 2NU2I 1CHOI 1Y1BA 1R0RI 2KCXA 2F3CI 1UUCA 1SGRI 2SGEI 3OVOA 2B0UC 1TUSA 4HGUA 1CE3A 1SGPI 1MT1A 2NU0I 1SGEI 4GI3C 2KMRA 1Z7KB 1YU6C 1H0ZA 1LR7A 1IY6A 1HJAI 1SGYI 1CGJI 2SGQI 1TBRR 1Y1CA 2JXDA 1N13A 2WCYA 2N52A 3SGQI 1FYBA 2N71A 1BMOA 1OVOA 1PCEA 1YTPA 2OVOA 4OVOA 5DAEA 1IY5A 2N17A 1HDLA 1HPTA 1SGQI 1AN1I 1CT2I 2ARPF 1UVGA 1TIHA 2SGPI 3QTLD 2M5XA 2NU3I 1KMAA 2JYYA 1SGNI 5JHWC 1TGSI 3B4VC 1M8CA 1CGII 4SGBI 1OYVI 2NU1I 1OMUA 2KMOA 3TJQA 1CT4I 2SGDI 1DS2I 2JZMA 2V53A 2KMQA 1CT0I 2GKVA 1SGDI 1TBQR 1IW4A 1LR8A 3SGBI 1UVFA 2BUSA 2LEOA 1M8BA 2SGFI 2GKTI 2KMPA 2NU4I 1NUBA 1PJUA 1TURA 2XRCA 2ERWA 1OMTA 2GKRI 1CSOI 1LR9A 2QQDA 2QQCA
chains in the Genus database with same CATH superfamily
3FSYA 1ULNA 3HH2C 2GIVA 1PPFI 3PDNA 2OU2A 1TBNA 2P6AC 2PQ8A 2VRWB 1FARA 1TBOA 3SEKC 1ULKA 5HQ8A 2RC4A 3UOEA 5FUYA 1BUSA 2J87A 2GVIA 1DS3I 2NU2I 2UZ3A 3OXLA 1MJAA 3UEYA 4B6DA 1K7VA 1CHOI 1Y1BA 1XX6A 1R0RI 2YUUA 2KCXA 1K7UA 2QQDA 7WGAA 2F3CI 2ELIA 1X74A 1UUCA 4E1PA 1SGRI 2SGEI 3OVOA 3R5BA 2B0UC 1TOTA 1TUSA 3FSXA 4HGUA 1CE3A 1KBEA 3D00A 1SGPI 1V1IA 1MT1A 2L8EA 5E3RA 2NU0I 1SGEI 2QPOA 4A24A 4GI3C 1Z7KB 2KMRA 1YU6C 2ODDA 2OD1A 2J9RA 2B8TA 1H0ZA 1U5KA 1LR7A 2Y0MA 3UGDA 1IY6A 1HJAI 1SGYI 3TOBA 1CGJI 2WGCA 3VDPA 1MJ9A 2SGQI 2DKVA 1XBTA 1TBRR 2CWFA 3TO7A 1WGTA 1Y1CA 2JXDA 1N13A 2WCYA 5E3QA 3OXGA 2LB7A 4MPIA 2N52A 3SGQI 3MEKA 3E2IA 3RU0A 1Q9BA 2N71A 4AMLA 1FYBA 1WKXA 3QAHA 1KBFA 3VE5A 1P9GA 2CWHA 1BMOA 2X52A 1OVOA 1PCEA 1YTPA 2OVOA 4OVOA 4E1RA 2N1AB 5DAEA 3VDUA 1XA6A 1PTQA 2N17A 1IY5A 3R5CA 1HDLA 1HPTA 3CXLA 4UXHA 5HI7A 1SGQI 5J8CA 1X4SA 2X3TA 4JCVE 3TO9A 1AN1I 3KY9A 1CT2I 3GOXA 2QQ0A 2ARPF 1UVGA 1TIHA 1V1HA 2JA1A 2V1CA 3FC3A 2SGPI 1R79A 3QTLD 5CCLA 2M5XA 2NU3I 1PTRA 4UXIA 1KMAA 2ENZA 2JYYA 9WGAA 1SGNI 2FNFX 4DNCA 5JHWC 1Y8FA 2A20A 5CCMA 1TGSI 3B4VC 3UGIA 1M8CA 1CGII 4SGBI 2WVJA 4L9MA 3E59A 1OYVI 2LUYA 1FY7A 2NU1I 2ORWA 2YQPA 2CWGA 5FUWA 5FUVA 1RFHA 1OMUA 5EX0A 2KMOA 3TJQA 1CT4I 1W3SA 1DS2I 2ROWA 2SGDI 2JZMA 4UXJA 3UEJA 3QWPA 1UHAA 1WGCA 1VDDA 1FAQA 2V53A 1WTJA 2KMQA 3TO6A 1CT0I 2GKVA 1W4RA 4FKDA 1SGDI 1TBQR 1ULMA 2V1CC 2JW6A 1IW4A 1LR8A 1HEVA 3SGBI 2CJSC 2RIJA 1UVFA 2BUSA 2LEOA 2ORVA 3OL0A 1M8BA 2SGFI 3R5DA 5E3PA 2DIPA 2K9HA 3TOAA 5J8FA 2DB6A 2GKTI 2KMPA 2NU4I 1K7TA 1NUBA 5EX3A 5FUXA 1PJUA 1TURA 2XRCA 2ERWA 1S20A 1OMTA 2W0TA 3OXFA 1MJBA 2UVOA 3UGLA 2E5RA 2GKRI 2E73A 3BJIA 3R5AA 2QQEA 1CSOI 1LR9A 1NXUA 2ENNA 2L7XA 4WP4A 3UFFA 2OZUA 1P9ZA 1Z2IA 2QQCA
chains in the Genus database with same CATH topology
3HH2C 1PPFI 3PDNA 1TBNA 2P6AC 2VRWB 1FARA 1TBOA 3SEKC 5HQ8A 1BUSA 5FUYA 2J87A 2GVIA 1DS3I 2NU2I 2UZ3A 3OXLA 3UEYA 4B6DA 1CHOI 1Y1BA 1XX6A 1R0RI 2YUUA 2KCXA 2F3CI 2ELIA 1X74A 1UUCA 4E1PA 1SGRI 2SGEI 3OVOA 2B0UC 1TOTA 1TUSA 4HGUA 1CE3A 1KBEA 3D00A 1SGPI 1V1IA 1MT1A 2L8EA 2NU0I 1SGEI 2QPOA 4A24A 4GI3C 1Z7KB 2KMRA 1YU6C 2ODDA 2OD1A 2J9RA 2B8TA 1H0ZA 1U5KA 1LR7A 3UGDA 1IY6A 1HJAI 1SGYI 1CGJI 3VDPA 2SGQI 1XBTA 1TBRR 1Y1CA 2JXDA 1N13A 2WCYA 3OXGA 2N52A 3SGQI 3MEKA 3E2IA 3RU0A 2N71A 1FYBA 1KBFA 3VE5A 1BMOA 1OVOA 1PCEA 1YTPA 2OVOA 4OVOA 4E1RA 2N1AB 5DAEA 3VDUA 1XA6A 1PTQA 2N17A 1IY5A 1HDLA 1HPTA 3CXLA 4UXHA 5HI7A 1SGQI 1X4SA 4JCVE 1AN1I 3KY9A 1CT2I 3GOXA 2QQ0A 2ARPF 1UVGA 1TIHA 1V1HA 2JA1A 2V1CA 3FC3A 2SGPI 1R79A 3QTLD 5CCLA 2M5XA 2NU3I 1PTRA 4UXIA 1KMAA 2ENZA 2JYYA 1SGNI 2FNFX 5JHWC 1Y8FA 2A20A 5CCMA 1TGSI 3B4VC 3UGIA 1M8CA 1CGII 4SGBI 2WVJA 4L9MA 3E59A 1OYVI 2LUYA 2NU1I 5FUWA 2ORWA 2YQPA 5FUVA 1RFHA 1OMUA 5EX0A 2KMOA 3TJQA 1CT4I 1W3SA 1DS2I 2ROWA 2SGDI 2JZMA 4UXJA 3UEJA 3QWPA 1VDDA 1FAQA 2V53A 2KMQA 1CT0I 2GKVA 1W4RA 4FKDA 1SGDI 1TBQR 2V1CC 2JW6A 1IW4A 1LR8A 3SGBI 2CJSC 1UVFA 2BUSA 2LEOA 2ORVA 3OL0A 1M8BA 2SGFI 2DIPA 2K9HA 2DB6A 2GKTI 2KMPA 2NU4I 1NUBA 5EX3A 5FUXA 1PJUA 1TURA 2XRCA 2ERWA 2W0TA 1OMTA 3OXFA 3UGLA 2E5RA 2GKRI 2E73A 3BJIA 2QQEA 1CSOI 1LR9A 2ENNA 2L7XA 3UFFA 2QQDA 2QQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HH2 C;  1PPF I;  2P6A C;  3SEK C;  1BUS A;  1DS3 I;  2NU2 I;  1CHO I;  1Y1B A;  1R0R I;  2KCX A;  2F3C I;  1UUC A;  1SGR I;  2SGE I;  3OVO A;  2B0U C;  1TUS A;  4HGU A;  1CE3 A;  1SGP I;  1MT1 A;  2NU0 I;  1SGE I;  4GI3 C;  2KMR A;  1Z7K B;  1YU6 C;  1H0Z A;  1LR7 A;  1IY6 A;  1HJA I;  1SGY I;  1CGJ I;  2SGQ I;  1TBR R;  1Y1C A;  2JXD A;  1N13 A;  2WCY A;  2N52 A;  3SGQ I;  1FYB A;  2N71 A;  1BMO A;  1OVO A;  1PCE A;  1YTP A;  2OVO A;  4OVO A;  5DAE A;  1IY5 A;  2N17 A;  1HDL A;  1HPT A;  1SGQ I;  1AN1 I;  1CT2 I;  2ARP F;  1UVG A;  1TIH A;  2SGP I;  3QTL D;  2M5X A;  2NU3 I;  1KMA A;  2JYY A;  1SGN I;  5JHW C;  1TGS I;  3B4V C;  1M8C A;  1CGI I;  4SGB I;  1OYV I;  2NU1 I;  1OMU A;  2KMO A;  3TJQ A;  1CT4 I;  2SGD I;  1DS2 I;  2JZM A;  2V53 A;  2KMQ A;  1CT0 I;  2GKV A;  1SGD I;  1TBQ R;  1IW4 A;  1LR8 A;  3SGB I;  1UVF A;  2BUS A;  2LEO A;  1M8B A;  2SGF I;  2GKT I;  2KMP A;  2NU4 I;  1NUB A;  1PJU A;  1TUR A;  2XRC A;  2ERW A;  1OMT A;  2GKR I;  1CSO I;  1LR9 A;  2QQD A;  2QQC A; 
#chains in the Genus database with same CATH topology
 3FSY A;  1ULN A;  3HH2 C;  2GIV A;  1PPF I;  3PDN A;  2OU2 A;  1TBN A;  2P6A C;  2PQ8 A;  2VRW B;  1FAR A;  1TBO A;  3SEK C;  1ULK A;  5HQ8 A;  2RC4 A;  3UOE A;  5FUY A;  1BUS A;  2J87 A;  2GVI A;  1DS3 I;  2NU2 I;  2UZ3 A;  3OXL A;  1MJA A;  3UEY A;  4B6D A;  1K7V A;  1CHO I;  1Y1B A;  1XX6 A;  1R0R I;  2YUU A;  2KCX A;  1K7U A;  2QQD A;  7WGA A;  2F3C I;  2ELI A;  1X74 A;  1UUC A;  4E1P A;  1SGR I;  2SGE I;  3OVO A;  3R5B A;  2B0U C;  1TOT A;  1TUS A;  3FSX A;  4HGU A;  1CE3 A;  1KBE A;  3D00 A;  1SGP I;  1V1I A;  1MT1 A;  2L8E A;  5E3R A;  2NU0 I;  1SGE I;  2QPO A;  4A24 A;  4GI3 C;  1Z7K B;  2KMR A;  1YU6 C;  2ODD A;  2OD1 A;  2J9R A;  2B8T A;  1H0Z A;  1U5K A;  1LR7 A;  2Y0M A;  3UGD A;  1IY6 A;  1HJA I;  1SGY I;  3TOB A;  1CGJ I;  2WGC A;  3VDP A;  1MJ9 A;  2SGQ I;  2DKV A;  1XBT A;  1TBR R;  2CWF A;  3TO7 A;  1WGT A;  1Y1C A;  2JXD A;  1N13 A;  2WCY A;  5E3Q A;  3OXG A;  2LB7 A;  4MPI A;  2N52 A;  3SGQ I;  3MEK A;  3E2I A;  3RU0 A;  1Q9B A;  2N71 A;  4AML A;  1FYB A;  1WKX A;  3QAH A;  1KBF A;  3VE5 A;  1P9G A;  2CWH A;  1BMO A;  2X52 A;  1OVO A;  1PCE A;  1YTP A;  2OVO A;  4OVO A;  4E1R A;  2N1A B;  5DAE A;  3VDU A;  1XA6 A;  1PTQ A;  2N17 A;  1IY5 A;  3R5C A;  1HDL A;  1HPT A;  3CXL A;  4UXH A;  5HI7 A;  1SGQ I;  5J8C A;  1X4S A;  2X3T A;  4JCV E;  3TO9 A;  1AN1 I;  3KY9 A;  1CT2 I;  3GOX A;  2QQ0 A;  2ARP F;  1UVG A;  1TIH A;  1V1H A;  2JA1 A;  2V1C A;  3FC3 A;  2SGP I;  1R79 A;  3QTL D;  5CCL A;  2M5X A;  2NU3 I;  1PTR A;  4UXI A;  1KMA A;  2ENZ A;  2JYY A;  9WGA A;  1SGN I;  2FNF X;  4DNC A;  5JHW C;  1Y8F A;  2A20 A;  5CCM A;  1TGS I;  3B4V C;  3UGI A;  1M8C A;  1CGI I;  4SGB I;  2WVJ A;  4L9M A;  3E59 A;  1OYV I;  2LUY A;  1FY7 A;  2NU1 I;  2ORW A;  2YQP A;  2CWG A;  5FUW A;  5FUV A;  1RFH A;  1OMU A;  5EX0 A;  2KMO A;  3TJQ A;  1CT4 I;  1W3S A;  1DS2 I;  2ROW A;  2SGD I;  2JZM A;  4UXJ A;  3UEJ A;  3QWP A;  1UHA A;  1WGC A;  1VDD A;  1FAQ A;  2V53 A;  1WTJ A;  2KMQ A;  3TO6 A;  1CT0 I;  2GKV A;  1W4R A;  4FKD A;  1SGD I;  1TBQ R;  1ULM A;  2V1C C;  2JW6 A;  1IW4 A;  1LR8 A;  1HEV A;  3SGB I;  2CJS C;  2RIJ A;  1UVF A;  2BUS A;  2LEO A;  2ORV A;  3OL0 A;  1M8B A;  2SGF I;  3R5D A;  5E3P A;  2DIP A;  2K9H A;  3TOA A;  5J8F A;  2DB6 A;  2GKT I;  2KMP A;  2NU4 I;  1K7T A;  1NUB A;  5EX3 A;  5FUX A;  1PJU A;  1TUR A;  2XRC A;  2ERW A;  1S20 A;  1OMT A;  2W0T A;  3OXF A;  1MJB A;  2UVO A;  3UGL A;  2E5R A;  2GKR I;  2E73 A;  3BJI A;  3R5A A;  2QQE A;  1CSO I;  1LR9 A;  1NXU A;  2ENN A;  2L7X A;  4WP4 A;  3UFF A;  2OZU A;  1P9Z A;  1Z2I A;  2QQC A; 
#chains in the Genus database with same CATH homology
 3HH2 C;  1PPF I;  3PDN A;  1TBN A;  2P6A C;  2VRW B;  1FAR A;  1TBO A;  3SEK C;  5HQ8 A;  1BUS A;  5FUY A;  2J87 A;  2GVI A;  1DS3 I;  2NU2 I;  2UZ3 A;  3OXL A;  3UEY A;  4B6D A;  1CHO I;  1Y1B A;  1XX6 A;  1R0R I;  2YUU A;  2KCX A;  2F3C I;  2ELI A;  1X74 A;  1UUC A;  4E1P A;  1SGR I;  2SGE I;  3OVO A;  2B0U C;  1TOT A;  1TUS A;  4HGU A;  1CE3 A;  1KBE A;  3D00 A;  1SGP I;  1V1I A;  1MT1 A;  2L8E A;  2NU0 I;  1SGE I;  2QPO A;  4A24 A;  4GI3 C;  1Z7K B;  2KMR A;  1YU6 C;  2ODD A;  2OD1 A;  2J9R A;  2B8T A;  1H0Z A;  1U5K A;  1LR7 A;  3UGD A;  1IY6 A;  1HJA I;  1SGY I;  1CGJ I;  3VDP A;  2SGQ I;  1XBT A;  1TBR R;  1Y1C A;  2JXD A;  1N13 A;  2WCY A;  3OXG A;  2N52 A;  3SGQ I;  3MEK A;  3E2I A;  3RU0 A;  2N71 A;  1FYB A;  1KBF A;  3VE5 A;  1BMO A;  1OVO A;  1PCE A;  1YTP A;  2OVO A;  4OVO A;  4E1R A;  2N1A B;  5DAE A;  3VDU A;  1XA6 A;  1PTQ A;  2N17 A;  1IY5 A;  1HDL A;  1HPT A;  3CXL A;  4UXH A;  5HI7 A;  1SGQ I;  1X4S A;  4JCV E;  1AN1 I;  3KY9 A;  1CT2 I;  3GOX A;  2QQ0 A;  2ARP F;  1UVG A;  1TIH A;  1V1H A;  2JA1 A;  2V1C A;  3FC3 A;  2SGP I;  1R79 A;  3QTL D;  5CCL A;  2M5X A;  2NU3 I;  1PTR A;  4UXI A;  1KMA A;  2ENZ A;  2JYY A;  1SGN I;  2FNF X;  5JHW C;  1Y8F A;  2A20 A;  5CCM A;  1TGS I;  3B4V C;  3UGI A;  1M8C A;  1CGI I;  4SGB I;  2WVJ A;  4L9M A;  3E59 A;  1OYV I;  2LUY A;  2NU1 I;  5FUW A;  2ORW A;  2YQP A;  5FUV A;  1RFH A;  1OMU A;  5EX0 A;  2KMO A;  3TJQ A;  1CT4 I;  1W3S A;  1DS2 I;  2ROW A;  2SGD I;  2JZM A;  4UXJ A;  3UEJ A;  3QWP A;  1VDD A;  1FAQ A;  2V53 A;  2KMQ A;  1CT0 I;  2GKV A;  1W4R A;  4FKD A;  1SGD I;  1TBQ R;  2V1C C;  2JW6 A;  1IW4 A;  1LR8 A;  3SGB I;  2CJS C;  1UVF A;  2BUS A;  2LEO A;  2ORV A;  3OL0 A;  1M8B A;  2SGF I;  2DIP A;  2K9H A;  2DB6 A;  2GKT I;  2KMP A;  2NU4 I;  1NUB A;  5EX3 A;  5FUX A;  1PJU A;  1TUR A;  2XRC A;  2ERW A;  2W0T A;  1OMT A;  3OXF A;  3UGL A;  2E5R A;  2GKR I;  2E73 A;  3BJI A;  2QQE A;  1CSO I;  1LR9 A;  2ENN A;  2L7X A;  3UFF A;  2QQD A;  2QQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...