2M5XA

Novel method of protein purification for structural research. example of ultra high resolution structure of spi-2 inhibitor by x-ray and nmr spectroscopy.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
40
structure length
40
Chain Sequence
EAAVCTTEWDPVCGKDGKTYSNLCWLNEAGVGLDHEGECL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Silk protease inhibitor 2
publication title Atomic resolution structure of a protein prepared by non-enzymatic His-tag removal. Crystallographic and NMR study of GmSPI-2 inhibitor.
pubmed doi rcsb
source organism Galleria mellonella
total genus 7
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2m5xA00
2M5XA 3TJQA 1SGDI 1R0RI 2OVOA 3SGBI 1KMAA 1CSOI 1DS3I 1AN1I 1Y1BA 1CE3A 1BMOA 2SGPI 4HGUA 1MT1A 1TIHA 1IW4A 1CHOI 1PCEA 1TURA 1UVFA 1PPFI 1CGJI 4GI3C 2SGFI 3SGQI 2QQDA 2XRCA 2SGEI 1SGRI 2KMOA 1TBRR 2KCXA 1HJAI 3OVOA 4SGBI 1OYVI 2ERWA 1UVGA 1Z7KB 1CT2I 1TBQR 5DAEA 2NU0I 3B4VC 1LR8A 1IY6A 2N17A 2V53A 2F3CI 1CT4I 2SGDI 1YU6C 1FYBA 2NU1I 1CGII 2WCYA 1YTPA 2KMQA 1UUCA 1SGPI 2QQCA 1SGQI 1NUBA 2ARPF 1HDLA 1CT0I 2P6AC 1DS2I 1M8CA 1OMTA 2LEOA 1LR9A 2GKVA 2B0UC 2NU3I 2N71A 1SGNI 3HH2C 2JZMA 3SEKC 1SGEI 2KMRA 1H0ZA 2JYYA 2N52A 1OMUA 5JHWC 2NU4I 1TGSI 1PJUA 2SGQI 4OVOA 1SGYI 1HPTA 2GKTI 1LR7A 3QTLD 1Y1CA 2GKRI 2NU2I 2BUSA 1BUSA 2JXDA 2KMPA 1TUSA 1M8BA 1N13A 1IY5A 1OVOA
chains in the Genus database with same CATH superfamily
2M5XA 1TBNA 2YUUA 3FSYA 3TJQA 3VDUA 3PDNA 2CWGA 4UXJA 1K7UA 3OXFA 1SGDI 1P9ZA 5J8FA 1R0RI 1X74A 2OVOA 3KY9A 3SGBI 1KMAA 2QPOA 4JCVE 1CSOI 4E1PA 2X52A 3D00A 1ULKA 1DS3I 3OXGA 3R5CA 1AN1I 1V1HA 1Y1BA 1BMOA 2ENZA 5J8CA 2SGPI 2WVJA 1MT1A 4HGUA 3E59A 1TIHA 1UHAA 4WP4A 2J9RA 1WKXA 3OL0A 1XA6A 2UVOA 1IW4A 1P9GA 3E2IA 1CHOI 1W3SA 1PCEA 1TURA 1UVFA 2FNFX 5HQ8A 2A20A 1PPFI 7WGAA 1CGJI 3BJIA 5CCMA 1RFHA 4GI3C 2SGFI 1S20A 3R5DA 1KBEA 2QQDA 3SGQI 2E73A 1FY7A 2XRCA 1R79A 3CXLA 2RIJA 2SGEI 4UXHA 2ROWA 1SGRI 2KMOA 3UFFA 1HEVA 1TBRR 2KCXA 1HJAI 3OVOA 4SGBI 1OYVI 2ERWA 2VRWB 1V1IA 4FKDA 2DKVA 5E3RA 2N1AB 1UVGA 1PTQA 1Z7KB 3GOXA 3UGDA 3TO7A 1NXUA 3TO9A 1ULMA 1CT2I 1TBQR 2DIPA 5DAEA 1WGCA 2B8TA 2NU0I 3R5BA 3B4VC 3QWPA 1LR8A 1IY6A 2OZUA 1TOTA 2ODDA 2W0TA 2V1CA 2N17A 2ORVA 2V53A 2F3CI 5E3QA 1FARA 1CT4I 3UEYA 2ELIA 2SGDI 4DNCA 3MEKA 1YU6C 1K7VA 2CWFA 1FYBA 2NU1I 5E3PA 2YQPA 1CGII 2WCYA 1YTPA 2JA1A 3RU0A 1K7TA 3UGLA 2KMQA 1UUCA 1PTRA 1SGPI 1X4SA 2GIVA 2CJSC 1XX6A 4A24A 2E5RA 2QQCA 5EX3A 1SGQI 4UXIA 1NUBA 4AMLA 2ARPF 1HDLA 1CT0I 2P6AC 3VDPA 1DS2I 1M8CA 1OMTA 1Q9BA 1Z2IA 1Y8FA 2LEOA 1LR9A 2OD1A 2Y0MA 3QAHA 5FUVA 3TOBA 5FUWA 3VE5A 2CWHA 5HI7A 9WGAA 2DB6A 3TO6A 4B6DA 1KBFA 2RC4A 2GKVA 1TBOA 1MJ9A 2B0UC 2NU3I 4L9MA 1U5KA 1SGNI 1VDDA 2N71A 3HH2C 1CE3A 1XBTA 2JZMA 3SEKC 1SGEI 1MJBA 2K9HA 2KMRA 1H0ZA 1FAQA 2JYYA 2N52A 5CCLA 5EX0A 1OMUA 2L8EA 2UZ3A 5JHWC 2NU4I 2GVIA 3UOEA 2ORWA 1WTJA 1TGSI 1PJUA 2SGQI 4OVOA 2ENNA 2LUYA 1SGYI 3FSXA 4MPIA 1HPTA 2GKTI 2PQ8A 2JW6A 2V1CC 2X3TA 1LR7A 2QQEA 3QTLD 1WGTA 2QQ0A 2OU2A 1MJAA 4E1RA 3TOAA 2LB7A 3R5AA 2J87A 3UGIA 1ULNA 1Y1CA 2GKRI 2NU2I 5FUYA 3FC3A 5FUXA 2BUSA 1BUSA 2JXDA 2KMPA 1W4RA 1TUSA 3OXLA 3UEJA 1M8BA 1N13A 2WGCA 1IY5A 2L7XA 1OVOA
chains in the Genus database with same CATH topology
2M5XA 1TBNA 2YUUA 3TJQA 3VDUA 3PDNA 4UXJA 3OXFA 1SGDI 1R0RI 1X74A 2OVOA 3KY9A 3SGBI 1KMAA 2QPOA 4JCVE 1CSOI 4E1PA 3D00A 1DS3I 3OXGA 1AN1I 1V1HA 1Y1BA 1BMOA 2ENZA 1CE3A 2SGPI 2WVJA 1MT1A 4HGUA 3E59A 1TIHA 2J9RA 3OL0A 1XA6A 1IW4A 3E2IA 1CHOI 1W3SA 1PCEA 1TURA 1UVFA 2FNFX 5HQ8A 2A20A 1PPFI 1CGJI 3BJIA 5CCMA 1RFHA 4GI3C 2SGFI 1KBEA 2QQDA 3SGQI 2E73A 2XRCA 1R79A 3CXLA 2SGEI 4UXHA 2ROWA 1SGRI 2KMOA 3UFFA 1TBRR 2KCXA 1HJAI 3OVOA 4SGBI 1OYVI 2ERWA 2VRWB 1V1IA 4FKDA 2N1AB 1UVGA 1PTQA 1Z7KB 3GOXA 3UGDA 1CT2I 1TBQR 2DIPA 5DAEA 2B8TA 2NU0I 3B4VC 3QWPA 1LR8A 1IY6A 1TOTA 2ODDA 2W0TA 2V1CA 2N17A 2ORVA 2V53A 2F3CI 1FARA 1CT4I 3UEYA 2ELIA 2SGDI 3MEKA 1YU6C 1FYBA 2NU1I 2YQPA 1CGII 2WCYA 1YTPA 2JA1A 3RU0A 3UGLA 2KMQA 1UUCA 1PTRA 1SGPI 1X4SA 2CJSC 1XX6A 4A24A 2E5RA 2QQCA 5EX3A 1SGQI 4UXIA 1NUBA 2ARPF 1HDLA 1CT0I 2P6AC 3VDPA 1DS2I 1M8CA 1OMTA 2LEOA 1Y8FA 1LR9A 2OD1A 5FUVA 3VE5A 5FUWA 5HI7A 1KBFA 2DB6A 4B6DA 2GKVA 1TBOA 2B0UC 2NU3I 4L9MA 1U5KA 1SGNI 1VDDA 2N71A 3HH2C 1XBTA 2JZMA 3SEKC 1SGEI 2K9HA 2KMRA 1H0ZA 1FAQA 2JYYA 2N52A 5CCLA 5EX0A 1OMUA 2L8EA 2UZ3A 5JHWC 2NU4I 2GVIA 2ORWA 1TGSI 1PJUA 2SGQI 4OVOA 2ENNA 2LUYA 1SGYI 1HPTA 2GKTI 2JW6A 2V1CC 1LR7A 2QQEA 3QTLD 2QQ0A 4E1RA 2J87A 3UGIA 1Y1CA 2GKRI 2NU2I 5FUYA 3FC3A 5FUXA 2BUSA 1BUSA 2JXDA 2KMPA 1W4RA 1TUSA 3OXLA 3UEJA 1M8BA 1N13A 1IY5A 2L7XA 1OVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5X A;  3TJQ A;  1SGD I;  1R0R I;  2OVO A;  3SGB I;  1KMA A;  1CSO I;  1DS3 I;  1AN1 I;  1Y1B A;  1CE3 A;  1BMO A;  2SGP I;  4HGU A;  1MT1 A;  1TIH A;  1IW4 A;  1CHO I;  1PCE A;  1TUR A;  1UVF A;  1PPF I;  1CGJ I;  4GI3 C;  2SGF I;  3SGQ I;  2QQD A;  2XRC A;  2SGE I;  1SGR I;  2KMO A;  1TBR R;  2KCX A;  1HJA I;  3OVO A;  4SGB I;  1OYV I;  2ERW A;  1UVG A;  1Z7K B;  1CT2 I;  1TBQ R;  5DAE A;  2NU0 I;  3B4V C;  1LR8 A;  1IY6 A;  2N17 A;  2V53 A;  2F3C I;  1CT4 I;  2SGD I;  1YU6 C;  1FYB A;  2NU1 I;  1CGI I;  2WCY A;  1YTP A;  2KMQ A;  1UUC A;  1SGP I;  2QQC A;  1SGQ I;  1NUB A;  2ARP F;  1HDL A;  1CT0 I;  2P6A C;  1DS2 I;  1M8C A;  1OMT A;  2LEO A;  1LR9 A;  2GKV A;  2B0U C;  2NU3 I;  2N71 A;  1SGN I;  3HH2 C;  2JZM A;  3SEK C;  1SGE I;  2KMR A;  1H0Z A;  2JYY A;  2N52 A;  1OMU A;  5JHW C;  2NU4 I;  1TGS I;  1PJU A;  2SGQ I;  4OVO A;  1SGY I;  1HPT A;  2GKT I;  1LR7 A;  3QTL D;  1Y1C A;  2GKR I;  2NU2 I;  2BUS A;  1BUS A;  2JXD A;  2KMP A;  1TUS A;  1M8B A;  1N13 A;  1IY5 A;  1OVO A; 
#chains in the Genus database with same CATH topology
 2M5X A;  1TBN A;  2YUU A;  3FSY A;  3TJQ A;  3VDU A;  3PDN A;  2CWG A;  4UXJ A;  1K7U A;  3OXF A;  1SGD I;  1P9Z A;  5J8F A;  1R0R I;  1X74 A;  2OVO A;  3KY9 A;  3SGB I;  1KMA A;  2QPO A;  4JCV E;  1CSO I;  4E1P A;  2X52 A;  3D00 A;  1ULK A;  1DS3 I;  3OXG A;  3R5C A;  1AN1 I;  1V1H A;  1Y1B A;  1BMO A;  2ENZ A;  5J8C A;  2SGP I;  2WVJ A;  1MT1 A;  4HGU A;  3E59 A;  1TIH A;  1UHA A;  4WP4 A;  2J9R A;  1WKX A;  3OL0 A;  1XA6 A;  2UVO A;  1IW4 A;  1P9G A;  3E2I A;  1CHO I;  1W3S A;  1PCE A;  1TUR A;  1UVF A;  2FNF X;  5HQ8 A;  2A20 A;  1PPF I;  7WGA A;  1CGJ I;  3BJI A;  5CCM A;  1RFH A;  4GI3 C;  2SGF I;  1S20 A;  3R5D A;  1KBE A;  2QQD A;  3SGQ I;  2E73 A;  1FY7 A;  2XRC A;  1R79 A;  3CXL A;  2RIJ A;  2SGE I;  4UXH A;  2ROW A;  1SGR I;  2KMO A;  3UFF A;  1HEV A;  1TBR R;  2KCX A;  1HJA I;  3OVO A;  4SGB I;  1OYV I;  2ERW A;  2VRW B;  1V1I A;  4FKD A;  2DKV A;  5E3R A;  2N1A B;  1UVG A;  1PTQ A;  1Z7K B;  3GOX A;  3UGD A;  3TO7 A;  1NXU A;  3TO9 A;  1ULM A;  1CT2 I;  1TBQ R;  2DIP A;  5DAE A;  1WGC A;  2B8T A;  2NU0 I;  3R5B A;  3B4V C;  3QWP A;  1LR8 A;  1IY6 A;  2OZU A;  1TOT A;  2ODD A;  2W0T A;  2V1C A;  2N17 A;  2ORV A;  2V53 A;  2F3C I;  5E3Q A;  1FAR A;  1CT4 I;  3UEY A;  2ELI A;  2SGD I;  4DNC A;  3MEK A;  1YU6 C;  1K7V A;  2CWF A;  1FYB A;  2NU1 I;  5E3P A;  2YQP A;  1CGI I;  2WCY A;  1YTP A;  2JA1 A;  3RU0 A;  1K7T A;  3UGL A;  2KMQ A;  1UUC A;  1PTR A;  1SGP I;  1X4S A;  2GIV A;  2CJS C;  1XX6 A;  4A24 A;  2E5R A;  2QQC A;  5EX3 A;  1SGQ I;  4UXI A;  1NUB A;  4AML A;  2ARP F;  1HDL A;  1CT0 I;  2P6A C;  3VDP A;  1DS2 I;  1M8C A;  1OMT A;  1Q9B A;  1Z2I A;  1Y8F A;  2LEO A;  1LR9 A;  2OD1 A;  2Y0M A;  3QAH A;  5FUV A;  3TOB A;  5FUW A;  3VE5 A;  2CWH A;  5HI7 A;  9WGA A;  2DB6 A;  3TO6 A;  4B6D A;  1KBF A;  2RC4 A;  2GKV A;  1TBO A;  1MJ9 A;  2B0U C;  2NU3 I;  4L9M A;  1U5K A;  1SGN I;  1VDD A;  2N71 A;  3HH2 C;  1CE3 A;  1XBT A;  2JZM A;  3SEK C;  1SGE I;  1MJB A;  2K9H A;  2KMR A;  1H0Z A;  1FAQ A;  2JYY A;  2N52 A;  5CCL A;  5EX0 A;  1OMU A;  2L8E A;  2UZ3 A;  5JHW C;  2NU4 I;  2GVI A;  3UOE A;  2ORW A;  1WTJ A;  1TGS I;  1PJU A;  2SGQ I;  4OVO A;  2ENN A;  2LUY A;  1SGY I;  3FSX A;  4MPI A;  1HPT A;  2GKT I;  2PQ8 A;  2JW6 A;  2V1C C;  2X3T A;  1LR7 A;  2QQE A;  3QTL D;  1WGT A;  2QQ0 A;  2OU2 A;  1MJA A;  4E1R A;  3TOA A;  2LB7 A;  3R5A A;  2J87 A;  3UGI A;  1ULN A;  1Y1C A;  2GKR I;  2NU2 I;  5FUY A;  3FC3 A;  5FUX A;  2BUS A;  1BUS A;  2JXD A;  2KMP A;  1W4R A;  1TUS A;  3OXL A;  3UEJ A;  1M8B A;  1N13 A;  2WGC A;  1IY5 A;  2L7X A;  1OVO A; 
#chains in the Genus database with same CATH homology
 2M5X A;  1TBN A;  2YUU A;  3TJQ A;  3VDU A;  3PDN A;  4UXJ A;  3OXF A;  1SGD I;  1R0R I;  1X74 A;  2OVO A;  3KY9 A;  3SGB I;  1KMA A;  2QPO A;  4JCV E;  1CSO I;  4E1P A;  3D00 A;  1DS3 I;  3OXG A;  1AN1 I;  1V1H A;  1Y1B A;  1BMO A;  2ENZ A;  1CE3 A;  2SGP I;  2WVJ A;  1MT1 A;  4HGU A;  3E59 A;  1TIH A;  2J9R A;  3OL0 A;  1XA6 A;  1IW4 A;  3E2I A;  1CHO I;  1W3S A;  1PCE A;  1TUR A;  1UVF A;  2FNF X;  5HQ8 A;  2A20 A;  1PPF I;  1CGJ I;  3BJI A;  5CCM A;  1RFH A;  4GI3 C;  2SGF I;  1KBE A;  2QQD A;  3SGQ I;  2E73 A;  2XRC A;  1R79 A;  3CXL A;  2SGE I;  4UXH A;  2ROW A;  1SGR I;  2KMO A;  3UFF A;  1TBR R;  2KCX A;  1HJA I;  3OVO A;  4SGB I;  1OYV I;  2ERW A;  2VRW B;  1V1I A;  4FKD A;  2N1A B;  1UVG A;  1PTQ A;  1Z7K B;  3GOX A;  3UGD A;  1CT2 I;  1TBQ R;  2DIP A;  5DAE A;  2B8T A;  2NU0 I;  3B4V C;  3QWP A;  1LR8 A;  1IY6 A;  1TOT A;  2ODD A;  2W0T A;  2V1C A;  2N17 A;  2ORV A;  2V53 A;  2F3C I;  1FAR A;  1CT4 I;  3UEY A;  2ELI A;  2SGD I;  3MEK A;  1YU6 C;  1FYB A;  2NU1 I;  2YQP A;  1CGI I;  2WCY A;  1YTP A;  2JA1 A;  3RU0 A;  3UGL A;  2KMQ A;  1UUC A;  1PTR A;  1SGP I;  1X4S A;  2CJS C;  1XX6 A;  4A24 A;  2E5R A;  2QQC A;  5EX3 A;  1SGQ I;  4UXI A;  1NUB A;  2ARP F;  1HDL A;  1CT0 I;  2P6A C;  3VDP A;  1DS2 I;  1M8C A;  1OMT A;  2LEO A;  1Y8F A;  1LR9 A;  2OD1 A;  5FUV A;  3VE5 A;  5FUW A;  5HI7 A;  1KBF A;  2DB6 A;  4B6D A;  2GKV A;  1TBO A;  2B0U C;  2NU3 I;  4L9M A;  1U5K A;  1SGN I;  1VDD A;  2N71 A;  3HH2 C;  1XBT A;  2JZM A;  3SEK C;  1SGE I;  2K9H A;  2KMR A;  1H0Z A;  1FAQ A;  2JYY A;  2N52 A;  5CCL A;  5EX0 A;  1OMU A;  2L8E A;  2UZ3 A;  5JHW C;  2NU4 I;  2GVI A;  2ORW A;  1TGS I;  1PJU A;  2SGQ I;  4OVO A;  2ENN A;  2LUY A;  1SGY I;  1HPT A;  2GKT I;  2JW6 A;  2V1C C;  1LR7 A;  2QQE A;  3QTL D;  2QQ0 A;  4E1R A;  2J87 A;  3UGI A;  1Y1C A;  2GKR I;  2NU2 I;  5FUY A;  3FC3 A;  5FUX A;  2BUS A;  1BUS A;  2JXD A;  2KMP A;  1W4R A;  1TUS A;  3OXL A;  3UEJ A;  1M8B A;  1N13 A;  1IY5 A;  2L7X A;  1OVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...