1KMAA

Nmr structure of the domain-i of the kazal-type thrombin inhibitor dipetalin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
55
structure length
55
Chain Sequence
FQGNPCECPRALHRVCGSDGNTYSNPCMLTCAKHEGNPDLVQVHEGPCDEHDHDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPETALIN
publication title Interaction of Kazal-type inhibitor domains with serine proteinases: biochemical and structural studies.
pubmed doi rcsb
source organism Dipetalogaster maximus
molecule tags Blood clotting
total genus 6
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2001-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1kmaA00
1Y1CA 1SGEI 2KCXA 2B0UC 1Z7KB 2GKRI 1MT1A 2KMOA 2SGPI 4HGUA 2SGDI 1HDLA 1CT4I 2NU1I 2KMPA 1IY5A 1CSOI 2SGEI 2BUSA 2GKTI 1OYVI 2QQCA 1DS3I 4GI3C 5DAEA 2WCYA 2N71A 2P6AC 4SGBI 1UUCA 2F3CI 2N17A 2SGQI 2OVOA 1N13A 2NU4I 2SGFI 1R0RI 1Y1BA 2M5XA 2NU0I 2ARPF 2KMQA 1CHOI 1YU6C 1CT2I 2N52A 1TIHA 3HH2C 1M8CA 1PPFI 1SGQI 1TUSA 3SGQI 2NU3I 1IW4A 1UVFA 1CT0I 1SGDI 1BUSA 1TBRR 1KMAA 1TGSI 3OVOA 1CE3A 1CGJI 3B4VC 1SGPI 1TBQR 1PCEA 1LR8A 1IY6A 1AN1I 2GKVA 1FYBA 1M8BA 1UVGA 1TURA 1SGNI 5JHWC 2LEOA 2ERWA 2JXDA 1BMOA 1SGRI 3QTLD 2KMRA 2JZMA 3SGBI 4OVOA 1LR7A 1OMUA 1H0ZA 1HJAI 1HPTA 2JYYA 1SGYI 1YTPA 2XRCA 3TJQA 1LR9A 2NU2I 1DS2I 2QQDA 2V53A 1CGII 1OVOA 1OMTA 3SEKC 1NUBA 1PJUA
chains in the Genus database with same CATH superfamily
1KBEA 1Y1CA 3OL0A 1SGEI 2KCXA 4E1PA 5E3RA 2B0UC 4E1RA 1K7VA 1Z7KB 3GOXA 1P9GA 2GKRI 1R79A 2QQ0A 3FSXA 1ULMA 7WGAA 1MT1A 3TOAA 2KMOA 1MJ9A 2DIPA 2SGPI 3KY9A 4HGUA 2SGDI 5E3QA 3OXLA 3FSYA 1HDLA 5FUWA 1K7TA 1CT4I 2NU1I 1MJAA 3UOEA 2KMPA 1XBTA 1IY5A 1WKXA 1CSOI 3QAHA 2E5RA 1ULKA 2BUSA 2SGEI 4UXHA 2GKTI 3UFFA 1OYVI 2L8EA 1FARA 2ORVA 2A20A 2V1CA 3CXLA 2K9HA 1PTRA 2QQCA 1DS3I 2L7XA 3UEYA 1TBOA 2PQ8A 4GI3C 2Y0MA 3BJIA 3TO9A 5DAEA 2WCYA 2N71A 2P6AC 3MEKA 4JCVE 3TO6A 2N1AB 4SGBI 2UZ3A 4A24A 1UUCA 1Y8FA 1MJBA 1P9ZA 2JW6A 3OXGA 1Q9BA 2F3CI 2N17A 2SGQI 3E2IA 2LB7A 2ENNA 4MPIA 2X3TA 2OVOA 1N13A 2NU4I 2X52A 5CCMA 2ROWA 1PTQA 5E3PA 2GIVA 2SGFI 5HI7A 1R0RI 1Y1BA 2OZUA 9WGAA 2M5XA 1WGTA 5CCLA 3UGDA 5J8CA 1V1HA 2NU0I 2ARPF 2GVIA 3OXFA 2KMQA 4DNCA 2FNFX 3TO7A 2UVOA 1CHOI 1RFHA 2YUUA 2YQPA 1YU6C 1CT2I 3D00A 2N52A 1TIHA 5J8FA 2DKVA 1NXUA 1VDDA 3HH2C 3E59A 3PDNA 3R5CA 1M8CA 1X4SA 2J87A 3VDPA 2CWGA 2QPOA 5FUXA 1PPFI 2CJSC 3TOBA 1SGQI 1TUSA 1WTJA 4WP4A 1U5KA 3SGQI 1FAQA 2ENZA 2NU3I 1K7UA 1IW4A 1UVFA 1HEVA 1CT0I 1SGDI 4AMLA 1BUSA 3FC3A 1W3SA 1TBRR 1TOTA 2RIJA 1KMAA 3QWPA 3VE5A 1TGSI 1ULNA 3OVOA 3UEJA 1CGJI 3B4VC 1CE3A 1SGPI 1XX6A 1TBQR 1PCEA 1LR8A 2DB6A 1AN1I 2GKVA 2OD1A 3R5AA 1M8BA 1UVGA 1IY6A 5FUYA 1FYBA 2JA1A 1TURA 1SGNI 5JHWC 1TBNA 2W0TA 2LEOA 2ERWA 2VRWB 5HQ8A 2JXDA 1UHAA 1XA6A 2CWFA 1BMOA 3UGIA 1SGRI 2ORWA 3QTLD 2KMRA 3R5BA 2JZMA 3SGBI 2V1CC 4OVOA 4L9MA 1KBFA 1X74A 2ODDA 1LR7A 1OMUA 1H0ZA 1WGCA 2RC4A 1HJAI 4UXIA 5EX0A 1HPTA 2JYYA 1FY7A 1SGYI 4UXJA 3UGLA 1YTPA 2XRCA 4FKDA 5EX3A 3TJQA 1LR9A 2E73A 2NU2I 3VDUA 2QQEA 1DS2I 2QQDA 3R5DA 3RU0A 1V1IA 2V53A 2OU2A 1CGII 1OVOA 1Z2IA 2CWHA 2LUYA 4B6DA 1OMTA 2B8TA 2ELIA 3SEKC 2WGCA 1NUBA 1PJUA 1S20A 1W4RA 2J9RA 5FUVA 2WVJA
chains in the Genus database with same CATH topology
1KBEA 1Y1CA 4E1PA 1SGEI 2KCXA 2B0UC 4E1RA 1Z7KB 3GOXA 2GKRI 2QQ0A 1R79A 1MT1A 2KMOA 2DIPA 2SGPI 3KY9A 4HGUA 2SGDI 3OXLA 1HDLA 5FUWA 1CT4I 2NU1I 2KMPA 1XBTA 1IY5A 1CSOI 2E5RA 2SGEI 2BUSA 4UXHA 2GKTI 3UFFA 1OYVI 2L8EA 1FARA 2ORVA 2A20A 2V1CA 3CXLA 2K9HA 1PTRA 2QQCA 1DS3I 2L7XA 3UEYA 1TBOA 4GI3C 3BJIA 5DAEA 2WCYA 2N71A 2P6AC 3MEKA 4JCVE 4A24A 2N1AB 4SGBI 2UZ3A 1UUCA 1Y8FA 3OXGA 2JW6A 2F3CI 2N17A 2SGQI 3E2IA 2ENNA 2OVOA 1N13A 2NU4I 5CCMA 2ROWA 1PTQA 2SGFI 5HI7A 1R0RI 1Y1BA 2M5XA 5CCLA 3UGDA 1V1HA 2NU0I 2ARPF 2GVIA 3OXFA 2KMQA 2FNFX 1CHOI 1RFHA 2YUUA 2YQPA 1YU6C 1CT2I 3D00A 2N52A 1TIHA 3HH2C 1VDDA 3E59A 3PDNA 1M8CA 1X4SA 2J87A 3VDPA 2QPOA 5FUXA 1PPFI 2CJSC 1SGQI 1TUSA 3SGQI 1U5KA 1FAQA 2ENZA 2NU3I 1IW4A 1UVFA 1CT0I 1SGDI 1BUSA 3FC3A 1W3SA 1TBRR 1TOTA 1KMAA 3QWPA 3VE5A 1TGSI 3OVOA 1CE3A 3UEJA 1CGJI 3B4VC 1SGPI 1XX6A 1TBQR 1PCEA 1LR8A 2DB6A 1AN1I 2GKVA 2OD1A 1IY6A 1M8BA 1UVGA 1FYBA 5FUYA 2JA1A 1TURA 1SGNI 5JHWC 1TBNA 2W0TA 2LEOA 2ERWA 2VRWB 5HQ8A 2JXDA 1XA6A 1BMOA 3UGIA 1SGRI 2ORWA 3QTLD 2KMRA 2JZMA 3SGBI 2V1CC 4OVOA 4L9MA 1KBFA 1X74A 2ODDA 1LR7A 1OMUA 1H0ZA 1HJAI 4UXIA 5EX0A 1HPTA 2JYYA 4UXJA 1SGYI 3UGLA 1YTPA 2XRCA 4FKDA 5EX3A 3TJQA 1LR9A 2E73A 2NU2I 3VDUA 2QQEA 1DS2I 2QQDA 3RU0A 1V1IA 2V53A 1CGII 1OVOA 2LUYA 4B6DA 1OMTA 2B8TA 2ELIA 3SEKC 1NUBA 1PJUA 1W4RA 2J9RA 3OL0A 5FUVA 2WVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1C A;  1SGE I;  2KCX A;  2B0U C;  1Z7K B;  2GKR I;  1MT1 A;  2KMO A;  2SGP I;  4HGU A;  2SGD I;  1HDL A;  1CT4 I;  2NU1 I;  2KMP A;  1IY5 A;  1CSO I;  2SGE I;  2BUS A;  2GKT I;  1OYV I;  2QQC A;  1DS3 I;  4GI3 C;  5DAE A;  2WCY A;  2N71 A;  2P6A C;  4SGB I;  1UUC A;  2F3C I;  2N17 A;  2SGQ I;  2OVO A;  1N13 A;  2NU4 I;  2SGF I;  1R0R I;  1Y1B A;  2M5X A;  2NU0 I;  2ARP F;  2KMQ A;  1CHO I;  1YU6 C;  1CT2 I;  2N52 A;  1TIH A;  3HH2 C;  1M8C A;  1PPF I;  1SGQ I;  1TUS A;  3SGQ I;  2NU3 I;  1IW4 A;  1UVF A;  1CT0 I;  1SGD I;  1BUS A;  1TBR R;  1KMA A;  1TGS I;  3OVO A;  1CE3 A;  1CGJ I;  3B4V C;  1SGP I;  1TBQ R;  1PCE A;  1LR8 A;  1IY6 A;  1AN1 I;  2GKV A;  1FYB A;  1M8B A;  1UVG A;  1TUR A;  1SGN I;  5JHW C;  2LEO A;  2ERW A;  2JXD A;  1BMO A;  1SGR I;  3QTL D;  2KMR A;  2JZM A;  3SGB I;  4OVO A;  1LR7 A;  1OMU A;  1H0Z A;  1HJA I;  1HPT A;  2JYY A;  1SGY I;  1YTP A;  2XRC A;  3TJQ A;  1LR9 A;  2NU2 I;  1DS2 I;  2QQD A;  2V53 A;  1CGI I;  1OVO A;  1OMT A;  3SEK C;  1NUB A;  1PJU A; 
#chains in the Genus database with same CATH topology
 1KBE A;  1Y1C A;  3OL0 A;  1SGE I;  2KCX A;  4E1P A;  5E3R A;  2B0U C;  4E1R A;  1K7V A;  1Z7K B;  3GOX A;  1P9G A;  2GKR I;  1R79 A;  2QQ0 A;  3FSX A;  1ULM A;  7WGA A;  1MT1 A;  3TOA A;  2KMO A;  1MJ9 A;  2DIP A;  2SGP I;  3KY9 A;  4HGU A;  2SGD I;  5E3Q A;  3OXL A;  3FSY A;  1HDL A;  5FUW A;  1K7T A;  1CT4 I;  2NU1 I;  1MJA A;  3UOE A;  2KMP A;  1XBT A;  1IY5 A;  1WKX A;  1CSO I;  3QAH A;  2E5R A;  1ULK A;  2BUS A;  2SGE I;  4UXH A;  2GKT I;  3UFF A;  1OYV I;  2L8E A;  1FAR A;  2ORV A;  2A20 A;  2V1C A;  3CXL A;  2K9H A;  1PTR A;  2QQC A;  1DS3 I;  2L7X A;  3UEY A;  1TBO A;  2PQ8 A;  4GI3 C;  2Y0M A;  3BJI A;  3TO9 A;  5DAE A;  2WCY A;  2N71 A;  2P6A C;  3MEK A;  4JCV E;  3TO6 A;  2N1A B;  4SGB I;  2UZ3 A;  4A24 A;  1UUC A;  1Y8F A;  1MJB A;  1P9Z A;  2JW6 A;  3OXG A;  1Q9B A;  2F3C I;  2N17 A;  2SGQ I;  3E2I A;  2LB7 A;  2ENN A;  4MPI A;  2X3T A;  2OVO A;  1N13 A;  2NU4 I;  2X52 A;  5CCM A;  2ROW A;  1PTQ A;  5E3P A;  2GIV A;  2SGF I;  5HI7 A;  1R0R I;  1Y1B A;  2OZU A;  9WGA A;  2M5X A;  1WGT A;  5CCL A;  3UGD A;  5J8C A;  1V1H A;  2NU0 I;  2ARP F;  2GVI A;  3OXF A;  2KMQ A;  4DNC A;  2FNF X;  3TO7 A;  2UVO A;  1CHO I;  1RFH A;  2YUU A;  2YQP A;  1YU6 C;  1CT2 I;  3D00 A;  2N52 A;  1TIH A;  5J8F A;  2DKV A;  1NXU A;  1VDD A;  3HH2 C;  3E59 A;  3PDN A;  3R5C A;  1M8C A;  1X4S A;  2J87 A;  3VDP A;  2CWG A;  2QPO A;  5FUX A;  1PPF I;  2CJS C;  3TOB A;  1SGQ I;  1TUS A;  1WTJ A;  4WP4 A;  1U5K A;  3SGQ I;  1FAQ A;  2ENZ A;  2NU3 I;  1K7U A;  1IW4 A;  1UVF A;  1HEV A;  1CT0 I;  1SGD I;  4AML A;  1BUS A;  3FC3 A;  1W3S A;  1TBR R;  1TOT A;  2RIJ A;  1KMA A;  3QWP A;  3VE5 A;  1TGS I;  1ULN A;  3OVO A;  3UEJ A;  1CGJ I;  3B4V C;  1CE3 A;  1SGP I;  1XX6 A;  1TBQ R;  1PCE A;  1LR8 A;  2DB6 A;  1AN1 I;  2GKV A;  2OD1 A;  3R5A A;  1M8B A;  1UVG A;  1IY6 A;  5FUY A;  1FYB A;  2JA1 A;  1TUR A;  1SGN I;  5JHW C;  1TBN A;  2W0T A;  2LEO A;  2ERW A;  2VRW B;  5HQ8 A;  2JXD A;  1UHA A;  1XA6 A;  2CWF A;  1BMO A;  3UGI A;  1SGR I;  2ORW A;  3QTL D;  2KMR A;  3R5B A;  2JZM A;  3SGB I;  2V1C C;  4OVO A;  4L9M A;  1KBF A;  1X74 A;  2ODD A;  1LR7 A;  1OMU A;  1H0Z A;  1WGC A;  2RC4 A;  1HJA I;  4UXI A;  5EX0 A;  1HPT A;  2JYY A;  1FY7 A;  1SGY I;  4UXJ A;  3UGL A;  1YTP A;  2XRC A;  4FKD A;  5EX3 A;  3TJQ A;  1LR9 A;  2E73 A;  2NU2 I;  3VDU A;  2QQE A;  1DS2 I;  2QQD A;  3R5D A;  3RU0 A;  1V1I A;  2V53 A;  2OU2 A;  1CGI I;  1OVO A;  1Z2I A;  2CWH A;  2LUY A;  4B6D A;  1OMT A;  2B8T A;  2ELI A;  3SEK C;  2WGC A;  1NUB A;  1PJU A;  1S20 A;  1W4R A;  2J9R A;  5FUV A;  2WVJ A; 
#chains in the Genus database with same CATH homology
 1KBE A;  1Y1C A;  4E1P A;  1SGE I;  2KCX A;  2B0U C;  4E1R A;  1Z7K B;  3GOX A;  2GKR I;  2QQ0 A;  1R79 A;  1MT1 A;  2KMO A;  2DIP A;  2SGP I;  3KY9 A;  4HGU A;  2SGD I;  3OXL A;  1HDL A;  5FUW A;  1CT4 I;  2NU1 I;  2KMP A;  1XBT A;  1IY5 A;  1CSO I;  2E5R A;  2SGE I;  2BUS A;  4UXH A;  2GKT I;  3UFF A;  1OYV I;  2L8E A;  1FAR A;  2ORV A;  2A20 A;  2V1C A;  3CXL A;  2K9H A;  1PTR A;  2QQC A;  1DS3 I;  2L7X A;  3UEY A;  1TBO A;  4GI3 C;  3BJI A;  5DAE A;  2WCY A;  2N71 A;  2P6A C;  3MEK A;  4JCV E;  4A24 A;  2N1A B;  4SGB I;  2UZ3 A;  1UUC A;  1Y8F A;  3OXG A;  2JW6 A;  2F3C I;  2N17 A;  2SGQ I;  3E2I A;  2ENN A;  2OVO A;  1N13 A;  2NU4 I;  5CCM A;  2ROW A;  1PTQ A;  2SGF I;  5HI7 A;  1R0R I;  1Y1B A;  2M5X A;  5CCL A;  3UGD A;  1V1H A;  2NU0 I;  2ARP F;  2GVI A;  3OXF A;  2KMQ A;  2FNF X;  1CHO I;  1RFH A;  2YUU A;  2YQP A;  1YU6 C;  1CT2 I;  3D00 A;  2N52 A;  1TIH A;  3HH2 C;  1VDD A;  3E59 A;  3PDN A;  1M8C A;  1X4S A;  2J87 A;  3VDP A;  2QPO A;  5FUX A;  1PPF I;  2CJS C;  1SGQ I;  1TUS A;  3SGQ I;  1U5K A;  1FAQ A;  2ENZ A;  2NU3 I;  1IW4 A;  1UVF A;  1CT0 I;  1SGD I;  1BUS A;  3FC3 A;  1W3S A;  1TBR R;  1TOT A;  1KMA A;  3QWP A;  3VE5 A;  1TGS I;  3OVO A;  1CE3 A;  3UEJ A;  1CGJ I;  3B4V C;  1SGP I;  1XX6 A;  1TBQ R;  1PCE A;  1LR8 A;  2DB6 A;  1AN1 I;  2GKV A;  2OD1 A;  1IY6 A;  1M8B A;  1UVG A;  1FYB A;  5FUY A;  2JA1 A;  1TUR A;  1SGN I;  5JHW C;  1TBN A;  2W0T A;  2LEO A;  2ERW A;  2VRW B;  5HQ8 A;  2JXD A;  1XA6 A;  1BMO A;  3UGI A;  1SGR I;  2ORW A;  3QTL D;  2KMR A;  2JZM A;  3SGB I;  2V1C C;  4OVO A;  4L9M A;  1KBF A;  1X74 A;  2ODD A;  1LR7 A;  1OMU A;  1H0Z A;  1HJA I;  4UXI A;  5EX0 A;  1HPT A;  2JYY A;  4UXJ A;  1SGY I;  3UGL A;  1YTP A;  2XRC A;  4FKD A;  5EX3 A;  3TJQ A;  1LR9 A;  2E73 A;  2NU2 I;  3VDU A;  2QQE A;  1DS2 I;  2QQD A;  3RU0 A;  1V1I A;  2V53 A;  1CGI I;  1OVO A;  2LUY A;  4B6D A;  1OMT A;  2B8T A;  2ELI A;  3SEK C;  1NUB A;  1PJU A;  1W4R A;  2J9R A;  3OL0 A;  5FUV A;  2WVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...