1KMAA

Nmr structure of the domain-i of the kazal-type thrombin inhibitor dipetalin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
55
structure length
55
Chain Sequence
FQGNPCECPRALHRVCGSDGNTYSNPCMLTCAKHEGNPDLVQVHEGPCDEHDHDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords DIPETALIN
publication title Interaction of Kazal-type inhibitor domains with serine proteinases: biochemical and structural studies.
pubmed doi rcsb
source organism Dipetalogaster maximus
total genus 6
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2001-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1kmaA00
1PCEA 1OMTA 1AN1I 1TUSA 1FYBA 2LEOA 1UVGA 1SGYI 1PJUA 2NU2I 1LR8A 1SGPI 1BUSA 4SGBI 2JZMA 5DAEA 2KMPA 1SGEI 2SGPI 2F3CI 2ERWA 2JYYA 1KMAA 1Z7KB 1CE3A 3TJQA 2KMQA 1R0RI 1TBRR 1SGQI 2BUSA 2M5XA 3SGQI 1OYVI 2V53A 1CT4I 2GKRI 2N17A 1SGNI 1SGRI 2NU4I 1Y1CA 2GKVA 3HH2C 1BMOA 2OVOA 2NU3I 1MT1A 1HDLA 3SEKC 1YTPA 2KMRA 1IW4A 1TBQR 1CGII 1Y1BA 3SGBI 4OVOA 1HJAI 2ARPF 1DS3I 2KMOA 1HPTA 2XRCA 1TIHA 3QTLD 1OMUA 1CGJI 1H0ZA 1TGSI 1LR7A 2SGEI 1CSOI 2KCXA 4GI3C 2B0UC 1YU6C 1LR9A 1DS2I 2QQDA 2SGQI 2WCYA 1CT2I 1M8BA 5JHWC 2N52A 2QQCA 2NU1I 4HGUA 1NUBA 1PPFI 1SGDI 1N13A 1IY5A 3OVOA 1OVOA 2JXDA 1TURA 2NU0I 3B4VC 2P6AC 2SGFI 1UUCA 2N71A 1UVFA 2GKTI 1IY6A 1CHOI 2SGDI 1CT0I 1M8CA
chains in the Genus database with same CATH superfamily
1PCEA 5FUYA 1OMTA 2JW6A 3R5AA 4AMLA 1AN1I 2B8TA 1PTRA 3R5DA 1TUSA 1FYBA 1TOTA 3UGDA 2LEOA 1R79A 1KBFA 2RIJA 1UVGA 1SGYI 1KBEA 5E3QA 5CCMA 1PJUA 4FKDA 5J8CA 2QQ0A 2FNFX 1XBTA 2NU2I 1LR8A 1SGPI 4UXHA 1BUSA 4SGBI 2JZMA 5DAEA 2KMPA 1SGEI 7WGAA 2SGPI 2F3CI 1KMAA 2ERWA 2X52A 2QPOA 2QQEA 2JYYA 5EX3A 1K7VA 2K9HA 3UGLA 1Z7KB 2ORVA 3BJIA 4DNCA 3GOXA 3TJQA 2KMQA 2GIVA 1CE3A 1FAQA 1K7TA 1R0RI 1K7UA 1TBRR 1TBOA 2W0TA 5FUWA 2YUUA 4B6DA 2N1AB 1SGQI 2BUSA 2M5XA 1WTJA 3SGQI 3VDUA 1OYVI 2V53A 1CT4I 2GKRI 2N17A 1SGNI 1UHAA 2V1CC 1ULMA 2UZ3A 1WGCA 3TO6A 1SGRI 3OXGA 2NU4I 1Y1CA 5FUVA 1W3SA 2GVIA 1Y8FA 2GKVA 3HH2C 1BMOA 2OD1A 2OVOA 2NU3I 2WVJA 3UEJA 1MT1A 1HDLA 3SEKC 1YTPA 2DIPA 2KMRA 1TBQR 1IW4A 1CGII 1Y1BA 3R5CA 1MJ9A 3SGBI 1W4RA 2DKVA 1XX6A 4OVOA 1HJAI 2L7XA 1MJAA 2ARPF 1VDDA 1DS3I 1Z2IA 2KMOA 2V1CA 3E59A 4UXIA 4E1PA 4JCVE 1HPTA 2XRCA 1TIHA 2CWFA 3QTLD 2J87A 3TOAA 2X3TA 2ORWA 3VDPA 1S20A 2OZUA 1OMUA 1CGJI 2E5RA 1H0ZA 1TGSI 1LR7A 2A20A 3UEYA 5J8FA 1RFHA 1PTQA 1XA6A 5HI7A 1NXUA 2SGEI 1X74A 2L8EA 1CSOI 2KCXA 3PDNA 3FSXA 4GI3C 2B0UC 2LB7A 1YU6C 1IY6A 1LR9A 1HEVA 1DS2I 3FC3A 3CXLA 2QQDA 3OL0A 3VE5A 2SGQI 3RU0A 2JA1A 1CT2I 2WCYA 3D00A 2ELIA 2RC4A 5HQ8A 9WGAA 1M8BA 2UVOA 5JHWC 2N52A 2QQCA 1V1IA 2NU1I 3E2IA 4HGUA 3TO7A 1NUBA 4UXJA 3QAHA 2ROWA 3TO9A 1PPFI 3OXFA 4A24A 1SGDI 5EX0A 2J9RA 4MPIA 4WP4A 1N13A 2OU2A 1IY5A 3UOEA 3UFFA 2WGCA 3OVOA 1OVOA 2CWGA 2Y0MA 2JXDA 1TURA 2ENZA 5FUXA 2DB6A 3FSYA 2NU0I 3B4VC 3UGIA 1U5KA 2CJSC 2LUYA 2ODDA 5E3PA 1FARA 3TOBA 1MJBA 2P6AC 2PQ8A 1P9ZA 1P9GA 5E3RA 1ULNA 2SGFI 3KY9A 5CCLA 1UUCA 1Q9BA 4L9MA 2N71A 4E1RA 1UVFA 1V1HA 2CWHA 2ENNA 1M8CA 2GKTI 2VRWB 2YQPA 1WKXA 3QWPA 1CHOI 1TBNA 1WGTA 1X4SA 1CT0I 2E73A 2SGDI 1ULKA 3OXLA 3MEKA 3R5BA 1FY7A
chains in the Genus database with same CATH topology
1PCEA 5FUYA 1OMTA 2JW6A 1AN1I 2B8TA 1PTRA 1TUSA 1FYBA 1TOTA 3UGDA 2LEOA 1R79A 1KBFA 1UVGA 1SGYI 1KBEA 5CCMA 1PJUA 4FKDA 2QQ0A 2FNFX 1XBTA 2NU2I 1LR8A 1SGPI 4UXHA 1BUSA 4SGBI 2JZMA 5DAEA 2KMPA 1SGEI 2SGPI 2F3CI 2ERWA 2QPOA 2QQEA 2JYYA 5EX3A 2K9HA 3UGLA 3GOXA 1Z7KB 2ORVA 3BJIA 1FAQA 1CE3A 3TJQA 2KMQA 1KMAA 1R0RI 1TBRR 1TBOA 2W0TA 5FUWA 2YUUA 4B6DA 2N1AB 1SGQI 2BUSA 2M5XA 3SGQI 3VDUA 1OYVI 2V53A 1CT4I 2GKRI 2N17A 1SGNI 2V1CC 2UZ3A 1SGRI 3OXGA 2NU4I 1Y1CA 5FUVA 1W3SA 2GVIA 1Y8FA 2GKVA 3HH2C 1BMOA 2OD1A 2OVOA 2NU3I 2WVJA 3UEJA 1MT1A 1HDLA 3SEKC 1YTPA 2DIPA 2KMRA 1TBQR 1IW4A 1CGII 1Y1BA 3SGBI 1W4RA 1XX6A 4OVOA 1HJAI 2L7XA 2ARPF 1VDDA 1DS3I 2KMOA 2V1CA 3E59A 4UXIA 4E1PA 4JCVE 1HPTA 2XRCA 1TIHA 3QTLD 2J87A 2ORWA 3VDPA 1OMUA 1CGJI 2E5RA 1H0ZA 1TGSI 1LR7A 2A20A 3UEYA 1RFHA 1PTQA 1XA6A 5HI7A 2SGEI 1X74A 2L8EA 1CSOI 2KCXA 3PDNA 4GI3C 2B0UC 1YU6C 1LR9A 1DS2I 3FC3A 3CXLA 2QQDA 3OL0A 3VE5A 2SGQI 3RU0A 2JA1A 1CT2I 2WCYA 3D00A 2ELIA 5HQ8A 1M8BA 5JHWC 2N52A 2QQCA 1V1IA 2NU1I 3E2IA 4HGUA 1NUBA 4UXJA 2ROWA 1PPFI 3OXFA 4A24A 1SGDI 5EX0A 2J9RA 1N13A 1IY5A 3UFFA 3OVOA 1OVOA 2JXDA 1TURA 2ENZA 5FUXA 2DB6A 3UGIA 2NU0I 3B4VC 1U5KA 2CJSC 2LUYA 2ODDA 1FARA 2P6AC 2SGFI 3KY9A 5CCLA 1UUCA 4L9MA 2N71A 4E1RA 1UVFA 1V1HA 2GKTI 2ENNA 2VRWB 2YQPA 3QWPA 1CHOI 1TBNA 1X4SA 2SGDI 1CT0I 2E73A 3OXLA 1M8CA 1IY6A 3MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PCE A;  1OMT A;  1AN1 I;  1TUS A;  1FYB A;  2LEO A;  1UVG A;  1SGY I;  1PJU A;  2NU2 I;  1LR8 A;  1SGP I;  1BUS A;  4SGB I;  2JZM A;  5DAE A;  2KMP A;  1SGE I;  2SGP I;  2F3C I;  2ERW A;  2JYY A;  1KMA A;  1Z7K B;  1CE3 A;  3TJQ A;  2KMQ A;  1R0R I;  1TBR R;  1SGQ I;  2BUS A;  2M5X A;  3SGQ I;  1OYV I;  2V53 A;  1CT4 I;  2GKR I;  2N17 A;  1SGN I;  1SGR I;  2NU4 I;  1Y1C A;  2GKV A;  3HH2 C;  1BMO A;  2OVO A;  2NU3 I;  1MT1 A;  1HDL A;  3SEK C;  1YTP A;  2KMR A;  1IW4 A;  1TBQ R;  1CGI I;  1Y1B A;  3SGB I;  4OVO A;  1HJA I;  2ARP F;  1DS3 I;  2KMO A;  1HPT A;  2XRC A;  1TIH A;  3QTL D;  1OMU A;  1CGJ I;  1H0Z A;  1TGS I;  1LR7 A;  2SGE I;  1CSO I;  2KCX A;  4GI3 C;  2B0U C;  1YU6 C;  1LR9 A;  1DS2 I;  2QQD A;  2SGQ I;  2WCY A;  1CT2 I;  1M8B A;  5JHW C;  2N52 A;  2QQC A;  2NU1 I;  4HGU A;  1NUB A;  1PPF I;  1SGD I;  1N13 A;  1IY5 A;  3OVO A;  1OVO A;  2JXD A;  1TUR A;  2NU0 I;  3B4V C;  2P6A C;  2SGF I;  1UUC A;  2N71 A;  1UVF A;  2GKT I;  1IY6 A;  1CHO I;  2SGD I;  1CT0 I;  1M8C A; 
#chains in the Genus database with same CATH topology
 1PCE A;  5FUY A;  1OMT A;  2JW6 A;  3R5A A;  4AML A;  1AN1 I;  2B8T A;  1PTR A;  3R5D A;  1TUS A;  1FYB A;  1TOT A;  3UGD A;  2LEO A;  1R79 A;  1KBF A;  2RIJ A;  1UVG A;  1SGY I;  1KBE A;  5E3Q A;  5CCM A;  1PJU A;  4FKD A;  5J8C A;  2QQ0 A;  2FNF X;  1XBT A;  2NU2 I;  1LR8 A;  1SGP I;  4UXH A;  1BUS A;  4SGB I;  2JZM A;  5DAE A;  2KMP A;  1SGE I;  7WGA A;  2SGP I;  2F3C I;  1KMA A;  2ERW A;  2X52 A;  2QPO A;  2QQE A;  2JYY A;  5EX3 A;  1K7V A;  2K9H A;  3UGL A;  1Z7K B;  2ORV A;  3BJI A;  4DNC A;  3GOX A;  3TJQ A;  2KMQ A;  2GIV A;  1CE3 A;  1FAQ A;  1K7T A;  1R0R I;  1K7U A;  1TBR R;  1TBO A;  2W0T A;  5FUW A;  2YUU A;  4B6D A;  2N1A B;  1SGQ I;  2BUS A;  2M5X A;  1WTJ A;  3SGQ I;  3VDU A;  1OYV I;  2V53 A;  1CT4 I;  2GKR I;  2N17 A;  1SGN I;  1UHA A;  2V1C C;  1ULM A;  2UZ3 A;  1WGC A;  3TO6 A;  1SGR I;  3OXG A;  2NU4 I;  1Y1C A;  5FUV A;  1W3S A;  2GVI A;  1Y8F A;  2GKV A;  3HH2 C;  1BMO A;  2OD1 A;  2OVO A;  2NU3 I;  2WVJ A;  3UEJ A;  1MT1 A;  1HDL A;  3SEK C;  1YTP A;  2DIP A;  2KMR A;  1TBQ R;  1IW4 A;  1CGI I;  1Y1B A;  3R5C A;  1MJ9 A;  3SGB I;  1W4R A;  2DKV A;  1XX6 A;  4OVO A;  1HJA I;  2L7X A;  1MJA A;  2ARP F;  1VDD A;  1DS3 I;  1Z2I A;  2KMO A;  2V1C A;  3E59 A;  4UXI A;  4E1P A;  4JCV E;  1HPT A;  2XRC A;  1TIH A;  2CWF A;  3QTL D;  2J87 A;  3TOA A;  2X3T A;  2ORW A;  3VDP A;  1S20 A;  2OZU A;  1OMU A;  1CGJ I;  2E5R A;  1H0Z A;  1TGS I;  1LR7 A;  2A20 A;  3UEY A;  5J8F A;  1RFH A;  1PTQ A;  1XA6 A;  5HI7 A;  1NXU A;  2SGE I;  1X74 A;  2L8E A;  1CSO I;  2KCX A;  3PDN A;  3FSX A;  4GI3 C;  2B0U C;  2LB7 A;  1YU6 C;  1IY6 A;  1LR9 A;  1HEV A;  1DS2 I;  3FC3 A;  3CXL A;  2QQD A;  3OL0 A;  3VE5 A;  2SGQ I;  3RU0 A;  2JA1 A;  1CT2 I;  2WCY A;  3D00 A;  2ELI A;  2RC4 A;  5HQ8 A;  9WGA A;  1M8B A;  2UVO A;  5JHW C;  2N52 A;  2QQC A;  1V1I A;  2NU1 I;  3E2I A;  4HGU A;  3TO7 A;  1NUB A;  4UXJ A;  3QAH A;  2ROW A;  3TO9 A;  1PPF I;  3OXF A;  4A24 A;  1SGD I;  5EX0 A;  2J9R A;  4MPI A;  4WP4 A;  1N13 A;  2OU2 A;  1IY5 A;  3UOE A;  3UFF A;  2WGC A;  3OVO A;  1OVO A;  2CWG A;  2Y0M A;  2JXD A;  1TUR A;  2ENZ A;  5FUX A;  2DB6 A;  3FSY A;  2NU0 I;  3B4V C;  3UGI A;  1U5K A;  2CJS C;  2LUY A;  2ODD A;  5E3P A;  1FAR A;  3TOB A;  1MJB A;  2P6A C;  2PQ8 A;  1P9Z A;  1P9G A;  5E3R A;  1ULN A;  2SGF I;  3KY9 A;  5CCL A;  1UUC A;  1Q9B A;  4L9M A;  2N71 A;  4E1R A;  1UVF A;  1V1H A;  2CWH A;  2ENN A;  1M8C A;  2GKT I;  2VRW B;  2YQP A;  1WKX A;  3QWP A;  1CHO I;  1TBN A;  1WGT A;  1X4S A;  1CT0 I;  2E73 A;  2SGD I;  1ULK A;  3OXL A;  3MEK A;  3R5B A;  1FY7 A; 
#chains in the Genus database with same CATH homology
 1PCE A;  5FUY A;  1OMT A;  2JW6 A;  1AN1 I;  2B8T A;  1PTR A;  1TUS A;  1FYB A;  1TOT A;  3UGD A;  2LEO A;  1R79 A;  1KBF A;  1UVG A;  1SGY I;  1KBE A;  5CCM A;  1PJU A;  4FKD A;  2QQ0 A;  2FNF X;  1XBT A;  2NU2 I;  1LR8 A;  1SGP I;  4UXH A;  1BUS A;  4SGB I;  2JZM A;  5DAE A;  2KMP A;  1SGE I;  2SGP I;  2F3C I;  2ERW A;  2QPO A;  2QQE A;  2JYY A;  5EX3 A;  2K9H A;  3UGL A;  3GOX A;  1Z7K B;  2ORV A;  3BJI A;  1FAQ A;  1CE3 A;  3TJQ A;  2KMQ A;  1KMA A;  1R0R I;  1TBR R;  1TBO A;  2W0T A;  5FUW A;  2YUU A;  4B6D A;  2N1A B;  1SGQ I;  2BUS A;  2M5X A;  3SGQ I;  3VDU A;  1OYV I;  2V53 A;  1CT4 I;  2GKR I;  2N17 A;  1SGN I;  2V1C C;  2UZ3 A;  1SGR I;  3OXG A;  2NU4 I;  1Y1C A;  5FUV A;  1W3S A;  2GVI A;  1Y8F A;  2GKV A;  3HH2 C;  1BMO A;  2OD1 A;  2OVO A;  2NU3 I;  2WVJ A;  3UEJ A;  1MT1 A;  1HDL A;  3SEK C;  1YTP A;  2DIP A;  2KMR A;  1TBQ R;  1IW4 A;  1CGI I;  1Y1B A;  3SGB I;  1W4R A;  1XX6 A;  4OVO A;  1HJA I;  2L7X A;  2ARP F;  1VDD A;  1DS3 I;  2KMO A;  2V1C A;  3E59 A;  4UXI A;  4E1P A;  4JCV E;  1HPT A;  2XRC A;  1TIH A;  3QTL D;  2J87 A;  2ORW A;  3VDP A;  1OMU A;  1CGJ I;  2E5R A;  1H0Z A;  1TGS I;  1LR7 A;  2A20 A;  3UEY A;  1RFH A;  1PTQ A;  1XA6 A;  5HI7 A;  2SGE I;  1X74 A;  2L8E A;  1CSO I;  2KCX A;  3PDN A;  4GI3 C;  2B0U C;  1YU6 C;  1LR9 A;  1DS2 I;  3FC3 A;  3CXL A;  2QQD A;  3OL0 A;  3VE5 A;  2SGQ I;  3RU0 A;  2JA1 A;  1CT2 I;  2WCY A;  3D00 A;  2ELI A;  5HQ8 A;  1M8B A;  5JHW C;  2N52 A;  2QQC A;  1V1I A;  2NU1 I;  3E2I A;  4HGU A;  1NUB A;  4UXJ A;  2ROW A;  1PPF I;  3OXF A;  4A24 A;  1SGD I;  5EX0 A;  2J9R A;  1N13 A;  1IY5 A;  3UFF A;  3OVO A;  1OVO A;  2JXD A;  1TUR A;  2ENZ A;  5FUX A;  2DB6 A;  3UGI A;  2NU0 I;  3B4V C;  1U5K A;  2CJS C;  2LUY A;  2ODD A;  1FAR A;  2P6A C;  2SGF I;  3KY9 A;  5CCL A;  1UUC A;  4L9M A;  2N71 A;  4E1R A;  1UVF A;  1V1H A;  2GKT I;  2ENN A;  2VRW B;  2YQP A;  3QWP A;  1CHO I;  1TBN A;  1X4S A;  2SGD I;  1CT0 I;  2E73 A;  3OXL A;  1M8C A;  1IY6 A;  3MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...