4WP4A

Hev b 6.02 (hevein) extracted from surgical gloves
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
43
structure length
43
Chain Sequence
EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-hevein
publication title Impact of the vulcanization process on the structural characteristics and IgE recognition of two allergens, Hev b 2 and Hev b 6.02, extracted from latex surgical gloves.
pubmed doi rcsb
molecule tags Allergen
total genus 13
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 4wp4A00
1UHAA 4WP4A 1P9ZA 1K7VA 4MPIA 2X52A 9WGAA 1WKXA 1K7TA 7WGAA 2WGCA 2DKVA 2X3TA 2CWGA 4AMLA 1ULMA 1ULKA 1WGTA 1P9GA 1Q9BA 2LB7A 1WGCA 2UVOA 1K7UA 1HEVA 1ULNA
chains in the Genus database with same CATH superfamily
1UHAA 2GIVA 2P6AC 2OZUA 2DIPA 4WP4A 3VDPA 2ERWA 3FC3A 1CE3A 2JYYA 1K7VA 1IY5A 2E5RA 2WCYA 1LR8A 9WGAA 3QTLD 2WVJA 1K7TA 2F3CI 1TBNA 3UEYA 1OYVI 2GVIA 1YTPA 2OD1A 1R79A 2WGCA 1SGDI 2V53A 2YUUA 3MEKA 3QWPA 3UGDA 4UXIA 3TOBA 2N17A 2CWGA 3TOAA 1CSOI 1ULMA 2OVOA 1MJAA 2RIJA 1ULKA 2SGEI 2N71A 1U5KA 1WGTA 1V1HA 3KY9A 4UXHA 3OXFA 1X4SA 1X74A 2KMOA 2OU2A 4SGBI 4OVOA 3UOEA 3PDNA 4B6DA 5CCLA 2NU0I 2NU3I 2K9HA 1XX6A 5J8FA 5HQ8A 1MJBA 1N13A 5E3PA 1IY6A 2ELIA 1Y1CA 1ULNA 1NXUA 2GKVA 2NU2I 1BUSA 1SGEI 3TO6A 1YU6C 2DB6A 2UZ3A 1KBFA 1CHOI 1TURA 1XBTA 1TIHA 3VE5A 1W4RA 2A20A 2Y0MA 2LUYA 1CT0I 1SGYI 1KBEA 1OMUA 2V1CC 4MPIA 3SEKC 3OXLA 1H0ZA 2NU4I 3FSYA 1KMAA 2ARPF 1OMTA 2KMQA 1FAQA 7WGAA 1TBRR 2DKVA 3OVOA 4DNCA 3RU0A 2L7XA 2YQPA 1XA6A 5HI7A 3UEJA 1DS2I 1HJAI 2J87A 4UXJA 2VRWB 1P9GA 1V1IA 1PPFI 1WGCA 4JCVE 2B0UC 1M8CA 3R5CA 2NU1I 3D00A 1CT2I 4GI3C 1HDLA 3UGLA 1OVOA 1K7UA 1PTQA 1TUSA 2CWHA 2ODDA 3E59A 3VDUA 1TBQR 1IW4A 2J9RA 4FKDA 1HPTA 1Z7KB 3FSXA 5FUWA 3TO9A 2CWFA 1P9ZA 2SGFI 1MT1A 1R0RI 3GOXA 2E73A 3R5AA 1SGQI 1CGJI 1SGPI 1PJUA 2ORVA 1LR7A 3TJQA 1CT4I 2GKTI 1Y8FA 1CGII 5FUVA 1RFHA 1LR9A 1PCEA 2ENZA 2RC4A 2ROWA 3TO7A 1TGSI 1Q9BA 2LB7A 1UVFA 2BUSA 1M8BA 2JXDA 2UVOA 2ORWA 2SGDI 3SGBI 3UGIA 2W0TA 5CCMA 1TOTA 1AN1I 1FYBA 1VDDA 5E3QA 2M5XA 5FUYA 3B4VC 4HGUA 1UUCA 2L8EA 5EX0A 2CJSC 2KMRA 2QPOA 3CXLA 5EX3A 3UFFA 1FY7A 1PTRA 1MJ9A 2FNFX 1W3SA 2QQ0A 2X52A 3OXGA 5E3RA 2LEOA 1HEVA 1SGRI 1WKXA 3OL0A 4E1RA 4A24A 2GKRI 3R5BA 2KMPA 1TBOA 2QQDA 2V1CA 2X3TA 3HH2C 2JW6A 2QQEA 3E2IA 1DS3I 2XRCA 3SGQI 4AMLA 2N1AB 4E1PA 3QAHA 1BMOA 2ENNA 2JA1A 2KCXA 2SGQI 2B8TA 4L9MA 5FUXA 3BJIA 1NUBA 2QQCA 1S20A 2SGPI 5J8CA 2N52A 2JZMA 1FARA 1Y1BA 1WTJA 5DAEA 3R5DA 5JHWC 1SGNI 1UVGA 2PQ8A 1Z2IA
chains in the Genus database with same CATH topology
1UHAA 4WP4A 1P9ZA 1K7VA 4MPIA 2X52A 9WGAA 1WKXA 1K7TA 7WGAA 2WGCA 2DKVA 2X3TA 2CWGA 4AMLA 1ULMA 1ULKA 1WGTA 1P9GA 1Q9BA 2LB7A 1WGCA 2UVOA 1K7UA 1HEVA 1ULNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHA A;  4WP4 A;  1P9Z A;  1K7V A;  4MPI A;  2X52 A;  9WGA A;  1WKX A;  1K7T A;  7WGA A;  2WGC A;  2DKV A;  2X3T A;  2CWG A;  4AML A;  1ULM A;  1ULK A;  1WGT A;  1P9G A;  1Q9B A;  2LB7 A;  1WGC A;  2UVO A;  1K7U A;  1HEV A;  1ULN A; 
#chains in the Genus database with same CATH topology
 1UHA A;  2GIV A;  2P6A C;  2OZU A;  2DIP A;  4WP4 A;  3VDP A;  2ERW A;  3FC3 A;  1CE3 A;  2JYY A;  1K7V A;  1IY5 A;  2E5R A;  2WCY A;  1LR8 A;  9WGA A;  3QTL D;  2WVJ A;  1K7T A;  2F3C I;  1TBN A;  3UEY A;  1OYV I;  2GVI A;  1YTP A;  2OD1 A;  1R79 A;  2WGC A;  1SGD I;  2V53 A;  2YUU A;  3MEK A;  3QWP A;  3UGD A;  4UXI A;  3TOB A;  2N17 A;  2CWG A;  3TOA A;  1CSO I;  1ULM A;  2OVO A;  1MJA A;  2RIJ A;  1ULK A;  2SGE I;  2N71 A;  1U5K A;  1WGT A;  1V1H A;  3KY9 A;  4UXH A;  3OXF A;  1X4S A;  1X74 A;  2KMO A;  2OU2 A;  4SGB I;  4OVO A;  3UOE A;  3PDN A;  4B6D A;  5CCL A;  2NU0 I;  2NU3 I;  2K9H A;  1XX6 A;  5J8F A;  5HQ8 A;  1MJB A;  1N13 A;  5E3P A;  1IY6 A;  2ELI A;  1Y1C A;  1ULN A;  1NXU A;  2GKV A;  2NU2 I;  1BUS A;  1SGE I;  3TO6 A;  1YU6 C;  2DB6 A;  2UZ3 A;  1KBF A;  1CHO I;  1TUR A;  1XBT A;  1TIH A;  3VE5 A;  1W4R A;  2A20 A;  2Y0M A;  2LUY A;  1CT0 I;  1SGY I;  1KBE A;  1OMU A;  2V1C C;  4MPI A;  3SEK C;  3OXL A;  1H0Z A;  2NU4 I;  3FSY A;  1KMA A;  2ARP F;  1OMT A;  2KMQ A;  1FAQ A;  7WGA A;  1TBR R;  2DKV A;  3OVO A;  4DNC A;  3RU0 A;  2L7X A;  2YQP A;  1XA6 A;  5HI7 A;  3UEJ A;  1DS2 I;  1HJA I;  2J87 A;  4UXJ A;  2VRW B;  1P9G A;  1V1I A;  1PPF I;  1WGC A;  4JCV E;  2B0U C;  1M8C A;  3R5C A;  2NU1 I;  3D00 A;  1CT2 I;  4GI3 C;  1HDL A;  3UGL A;  1OVO A;  1K7U A;  1PTQ A;  1TUS A;  2CWH A;  2ODD A;  3E59 A;  3VDU A;  1TBQ R;  1IW4 A;  2J9R A;  4FKD A;  1HPT A;  1Z7K B;  3FSX A;  5FUW A;  3TO9 A;  2CWF A;  1P9Z A;  2SGF I;  1MT1 A;  1R0R I;  3GOX A;  2E73 A;  3R5A A;  1SGQ I;  1CGJ I;  1SGP I;  1PJU A;  2ORV A;  1LR7 A;  3TJQ A;  1CT4 I;  2GKT I;  1Y8F A;  1CGI I;  5FUV A;  1RFH A;  1LR9 A;  1PCE A;  2ENZ A;  2RC4 A;  2ROW A;  3TO7 A;  1TGS I;  1Q9B A;  2LB7 A;  1UVF A;  2BUS A;  1M8B A;  2JXD A;  2UVO A;  2ORW A;  2SGD I;  3SGB I;  3UGI A;  2W0T A;  5CCM A;  1TOT A;  1AN1 I;  1FYB A;  1VDD A;  5E3Q A;  2M5X A;  5FUY A;  3B4V C;  4HGU A;  1UUC A;  2L8E A;  5EX0 A;  2CJS C;  2KMR A;  2QPO A;  3CXL A;  5EX3 A;  3UFF A;  1FY7 A;  1PTR A;  1MJ9 A;  2FNF X;  1W3S A;  2QQ0 A;  2X52 A;  3OXG A;  5E3R A;  2LEO A;  1HEV A;  1SGR I;  1WKX A;  3OL0 A;  4E1R A;  4A24 A;  2GKR I;  3R5B A;  2KMP A;  1TBO A;  2QQD A;  2V1C A;  2X3T A;  3HH2 C;  2JW6 A;  2QQE A;  3E2I A;  1DS3 I;  2XRC A;  3SGQ I;  4AML A;  2N1A B;  4E1P A;  3QAH A;  1BMO A;  2ENN A;  2JA1 A;  2KCX A;  2SGQ I;  2B8T A;  4L9M A;  5FUX A;  3BJI A;  1NUB A;  2QQC A;  1S20 A;  2SGP I;  5J8C A;  2N52 A;  2JZM A;  1FAR A;  1Y1B A;  1WTJ A;  5DAE A;  3R5D A;  5JHW C;  1SGN I;  1UVG A;  2PQ8 A;  1Z2I A; 
#chains in the Genus database with same CATH homology
 1UHA A;  4WP4 A;  1P9Z A;  1K7V A;  4MPI A;  2X52 A;  9WGA A;  1WKX A;  1K7T A;  7WGA A;  2WGC A;  2DKV A;  2X3T A;  2CWG A;  4AML A;  1ULM A;  1ULK A;  1WGT A;  1P9G A;  1Q9B A;  2LB7 A;  1WGC A;  2UVO A;  1K7U A;  1HEV A;  1ULN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...