4WP4A

Hev b 6.02 (hevein) extracted from surgical gloves
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
43
structure length
43
Chain Sequence
EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Pro-hevein
publication title Impact of the vulcanization process on the structural characteristics and IgE recognition of two allergens, Hev b 2 and Hev b 6.02, extracted from latex surgical gloves.
pubmed doi rcsb
total genus 13
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 4wp4A00
4WP4A 1UHAA 1ULKA 1WGCA 2WGCA 9WGAA 1WKXA 1K7TA 1ULMA 1K7UA 1K7VA 1Q9BA 2CWGA 1HEVA 2LB7A 1P9GA 2X3TA 7WGAA 1ULNA 4MPIA 1P9ZA 1WGTA 2UVOA 2DKVA 2X52A 4AMLA
chains in the Genus database with same CATH superfamily
2WVJA 2E5RA 3VE5A 3OXLA 2N71A 3UEJA 3UFFA 2M5XA 3MEKA 1W3SA 2ORWA 2ODDA 2ORVA 3SEKC 9WGAA 1M8BA 2GIVA 2JA1A 3UOEA 2GKTI 1SGNI 3R5BA 2LEOA 2JYYA 2A20A 1CT0I 1PPFI 1ULMA 1TUSA 1M8CA 1OVOA 1Y1CA 2QQCA 1YTPA 1DS2I 2CWGA 3OL0A 1FY7A 3OXFA 1V1HA 1MJAA 1W4RA 2SGFI 2W0TA 3R5CA 1MJBA 2QPOA 1V1IA 2KMRA 3TO9A 1VDDA 4HGUA 5FUYA 1SGDI 3OXGA 4MPIA 1PCEA 3E59A 2DKVA 1MT1A 3RU0A 2KMQA 5JHWC 2JXDA 4A24A 5EX3A 2QQ0A 1TBRR 2V1CC 2J87A 2V1CA 2CWFA 1WGCA 2SGQI 2OZUA 4UXHA 1N13A 3TO7A 2WCYA 3FSYA 2L8EA 3UEYA 1X74A 4GI3C 1HJAI 2VRWB 1XBTA 3B4VC 4OVOA 1X4SA 1SGPI 2NU3I 1CT2I 1CSOI 2KCXA 1HDLA 1Y1BA 1WTJA 3FC3A 1NXUA 3KY9A 5E3PA 2E73A 2JZMA 1SGYI 2SGEI 4E1RA 2B8TA 2OVOA 5FUWA 1R79A 5FUVA 1P9GA 1UVGA 1UVFA 4E1PA 2ELIA 1CGII 2XRCA 1Y8FA 1FAQA 1UUCA 2JW6A 2K9HA 5J8CA 1R0RI 1H0ZA 1OYVI 1KMAA 5E3RA 3UGDA 1S20A 3E2IA 3PDNA 2NU4I 4AMLA 1LR7A 2QQEA 1IY6A 1OMTA 2CWHA 3UGIA 5FUXA 1XX6A 1IY5A 1CGJI 1FYBA 1CHOI 2B0UC 1TGSI 1XA6A 3GOXA 1SGRI 1PJUA 1PTRA 2NU2I 1U5KA 2ERWA 3FSXA 4UXJA 1TURA 4L9MA 1WKXA 1TBNA 4FKDA 2ARPF 2KMPA 1K7TA 2N52A 2QQDA 2YUUA 2N1AB 3TJQA 1DS3I 1K7VA 2BUSA 3VDUA 2OU2A 1LR9A 2GVIA 2KMOA 2SGPI 3R5DA 1KBFA 5HI7A 1FARA 3CXLA 2LB7A 2OD1A 1KBEA 1Z2IA 2ENZA 3QAHA 3SGQI 2NU1I 4DNCA 1AN1I 1CE3A 5DAEA 1TBQR 2RC4A 2Y0MA 1WGTA 2UVOA 2ENNA 3HH2C 4JCVE 5CCMA 5CCLA 2X52A 4B6DA 2J9RA 3TOBA 2DB6A 1Z7KB 3SGBI 2NU0I 1BUSA 4WP4A 2F3CI 5HQ8A 2UZ3A 1OMUA 1UHAA 1ULKA 2SGDI 2L7XA 3QTLD 5J8FA 2RIJA 2N17A 4UXIA 1IW4A 2LUYA 2WGCA 1CT4I 2V53A 3D00A 1NUBA 2P6AC 3TO6A 5EX0A 3R5AA 1SGQI 1K7UA 1TOTA 1LR8A 3BJIA 4SGBI 3VDPA 1BMOA 2GKRI 3OVOA 1Q9BA 3QWPA 2FNFX 1HEVA 2CJSC 1HPTA 2YQPA 2X3TA 2DIPA 2PQ8A 1RFHA 1TBOA 2ROWA 3TOAA 1ULNA 7WGAA 1SGEI 3UGLA 1P9ZA 1PTQA 1TIHA 2GKVA 1YU6C 5E3QA 1MJ9A
chains in the Genus database with same CATH topology
4WP4A 1UHAA 1ULKA 1WGCA 2WGCA 9WGAA 1WKXA 1K7TA 1ULMA 1K7UA 1K7VA 1Q9BA 2CWGA 1HEVA 2LB7A 1P9GA 2X3TA 7WGAA 1ULNA 4MPIA 1P9ZA 1WGTA 2UVOA 2DKVA 2X52A 4AMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WP4 A;  1UHA A;  1ULK A;  1WGC A;  2WGC A;  9WGA A;  1WKX A;  1K7T A;  1ULM A;  1K7U A;  1K7V A;  1Q9B A;  2CWG A;  1HEV A;  2LB7 A;  1P9G A;  2X3T A;  7WGA A;  1ULN A;  4MPI A;  1P9Z A;  1WGT A;  2UVO A;  2DKV A;  2X52 A;  4AML A; 
#chains in the Genus database with same CATH topology
 2WVJ A;  2E5R A;  3VE5 A;  3OXL A;  2N71 A;  3UEJ A;  3UFF A;  2M5X A;  3MEK A;  1W3S A;  2ORW A;  2ODD A;  2ORV A;  3SEK C;  9WGA A;  1M8B A;  2GIV A;  2JA1 A;  3UOE A;  2GKT I;  1SGN I;  3R5B A;  2LEO A;  2JYY A;  2A20 A;  1CT0 I;  1PPF I;  1ULM A;  1TUS A;  1M8C A;  1OVO A;  1Y1C A;  2QQC A;  1YTP A;  1DS2 I;  2CWG A;  3OL0 A;  1FY7 A;  3OXF A;  1V1H A;  1MJA A;  1W4R A;  2SGF I;  2W0T A;  3R5C A;  1MJB A;  2QPO A;  1V1I A;  2KMR A;  3TO9 A;  1VDD A;  4HGU A;  5FUY A;  1SGD I;  3OXG A;  4MPI A;  1PCE A;  3E59 A;  2DKV A;  1MT1 A;  3RU0 A;  2KMQ A;  5JHW C;  2JXD A;  4A24 A;  5EX3 A;  2QQ0 A;  1TBR R;  2V1C C;  2J87 A;  2V1C A;  2CWF A;  1WGC A;  2SGQ I;  2OZU A;  4UXH A;  1N13 A;  3TO7 A;  2WCY A;  3FSY A;  2L8E A;  3UEY A;  1X74 A;  4GI3 C;  1HJA I;  2VRW B;  1XBT A;  3B4V C;  4OVO A;  1X4S A;  1SGP I;  2NU3 I;  1CT2 I;  1CSO I;  2KCX A;  1HDL A;  1Y1B A;  1WTJ A;  3FC3 A;  1NXU A;  3KY9 A;  5E3P A;  2E73 A;  2JZM A;  1SGY I;  2SGE I;  4E1R A;  2B8T A;  2OVO A;  5FUW A;  1R79 A;  5FUV A;  1P9G A;  1UVG A;  1UVF A;  4E1P A;  2ELI A;  1CGI I;  2XRC A;  1Y8F A;  1FAQ A;  1UUC A;  2JW6 A;  2K9H A;  5J8C A;  1R0R I;  1H0Z A;  1OYV I;  1KMA A;  5E3R A;  3UGD A;  1S20 A;  3E2I A;  3PDN A;  2NU4 I;  4AML A;  1LR7 A;  2QQE A;  1IY6 A;  1OMT A;  2CWH A;  3UGI A;  5FUX A;  1XX6 A;  1IY5 A;  1CGJ I;  1FYB A;  1CHO I;  2B0U C;  1TGS I;  1XA6 A;  3GOX A;  1SGR I;  1PJU A;  1PTR A;  2NU2 I;  1U5K A;  2ERW A;  3FSX A;  4UXJ A;  1TUR A;  4L9M A;  1WKX A;  1TBN A;  4FKD A;  2ARP F;  2KMP A;  1K7T A;  2N52 A;  2QQD A;  2YUU A;  2N1A B;  3TJQ A;  1DS3 I;  1K7V A;  2BUS A;  3VDU A;  2OU2 A;  1LR9 A;  2GVI A;  2KMO A;  2SGP I;  3R5D A;  1KBF A;  5HI7 A;  1FAR A;  3CXL A;  2LB7 A;  2OD1 A;  1KBE A;  1Z2I A;  2ENZ A;  3QAH A;  3SGQ I;  2NU1 I;  4DNC A;  1AN1 I;  1CE3 A;  5DAE A;  1TBQ R;  2RC4 A;  2Y0M A;  1WGT A;  2UVO A;  2ENN A;  3HH2 C;  4JCV E;  5CCM A;  5CCL A;  2X52 A;  4B6D A;  2J9R A;  3TOB A;  2DB6 A;  1Z7K B;  3SGB I;  2NU0 I;  1BUS A;  4WP4 A;  2F3C I;  5HQ8 A;  2UZ3 A;  1OMU A;  1UHA A;  1ULK A;  2SGD I;  2L7X A;  3QTL D;  5J8F A;  2RIJ A;  2N17 A;  4UXI A;  1IW4 A;  2LUY A;  2WGC A;  1CT4 I;  2V53 A;  3D00 A;  1NUB A;  2P6A C;  3TO6 A;  5EX0 A;  3R5A A;  1SGQ I;  1K7U A;  1TOT A;  1LR8 A;  3BJI A;  4SGB I;  3VDP A;  1BMO A;  2GKR I;  3OVO A;  1Q9B A;  3QWP A;  2FNF X;  1HEV A;  2CJS C;  1HPT A;  2YQP A;  2X3T A;  2DIP A;  2PQ8 A;  1RFH A;  1TBO A;  2ROW A;  3TOA A;  1ULN A;  7WGA A;  1SGE I;  3UGL A;  1P9Z A;  1PTQ A;  1TIH A;  2GKV A;  1YU6 C;  5E3Q A;  1MJ9 A; 
#chains in the Genus database with same CATH homology
 4WP4 A;  1UHA A;  1ULK A;  1WGC A;  2WGC A;  9WGA A;  1WKX A;  1K7T A;  1ULM A;  1K7U A;  1K7V A;  1Q9B A;  2CWG A;  1HEV A;  2LB7 A;  1P9G A;  2X3T A;  7WGA A;  1ULN A;  4MPI A;  1P9Z A;  1WGT A;  2UVO A;  2DKV A;  2X52 A;  4AML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...