1NUBA

Helix c deletion mutant of bm-40 fs-ec domain pair
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
226
structure length
226
Chain Sequence
APCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BASEMENT MEMBRANE PROTEIN BM-40
publication title Crystal structure and mapping by site-directed mutagenesis of the collagen-binding epitope of an activated form of BM-40/SPARC/osteonectin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Extracellular module
total genus 71
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
A PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nubA02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1nubA01
2WOSA 1SPYA 3AAJA 2MBXA 1BJFA 2KOTA 2LVIA 5DKQA 2WCYA 1CLBA 1QASA 1YVHA 1FI6A 1EJ3A 1KWOC 1FYBA 4XYNA 1SL8A 2BE6A 5KSZA 1KK8B 1IY5A 1S3PA 1DJHA 1SGPI 1TCFA 2KCXA 2Y5IA 2KDHA 1SKTA 2QACA 1BODA 1QTXA 1G33A 1TTXA 2F2OA 2BBMA 1YUUA 4JQ0D 1PRWA 2OS8C 2AAOA 1DJZA 1MXEA 2QPTA 1SR6B 2ZN9A 1NSHA 1J7PA 2TN4A 1S5GZ 1LR7A 1M46A 1PVBA 1ZUZA 2JPTA 2N71A 3GK1A 1RTP1 5TNCA 3SG4A 3TZ1A 2LC5A 1OYVI 4UPGA 3KF9A 1F55A 1JC2A 1OQPA 1WLMA 3LLEA 2PALA 1LINA 5CSJA 3TDIA 1JBAA 1DJYA 4ORCB 5AXIA 1CT4I 5HYDA 3ZWHA 1FPWA 1CM4A 3TUYB 1OZOA 1XO5A 1ALWA 1XVJA 4F0ZB 1SGRI 2KMRA 4HGUA 2MHHA 2KAXA 1J1DA 4C0KA 2JT3A 4N1FA 2KBIA 1CMFA 3DVJA 3EVUA 2O5GA 4PDZA 3EVRA 2I2RE 1M45A 2M7NA 1OMDA 1DF0A 1SYMA 2KI4C 1FW4A 5AERA 1IQ5A 2B0UC 1BLQA 3ICBA 2H2KA 2JRFA 3BUMB 1NCYA 1N2DA 1YUTA 2QQCA 3HH2C 2KMPA 4BY5A 1JFJA 2K8MB 3JTDC 3MSEB 4PE4A 2NU2I 2M7LA 2KGRA 2HQWA 5HLVA 1S5GY 3TJQA 2OPOA 1GGZA 4JWQA 1OMTA 1KQMB 3CWGA 2M5XA 3FS7A 2JU0A 3HCMA 4AQJA 1CDMA 2L2EA 3OB1B 5CSIA 2F3YA 2BL0C 3I5HC 2OTGC 3TS5C 2Q91A 2GV5A 2M8UA 1S6CA 2ERWA 4GPLB 2K7OA 1C07A 3KPXA 3SG7A 2NU4I 1K93D 1DS2I 1AJ5A 2JQ6A 2K2AA 5CPVA 1EXRA 2HETA 1BT6A 2KI6C 1KK7Z 1A03A 2SGQI 2AMIA 2L4HA 3CR5X 4I5JA 3PLFB 4OR9B 2XRCA 3NSOA 1CFFA 4OVOA 4ORAB 4PHJA 4QJ3B 1N13A 2SCPA 2K0JA 5AANA 3SG2A 1CGJI 1WY9A 1JF0A 4C0LA 1MHOA 2SASA 1KFXL 3K21A 3CGAA 4HRGA 1IH0A 1GJYA 1D1OA 5PALA 1PPFI 1S26D 1DF0B 2KAYA 1VRKA 1BOCA 1QX5B 2WCEA 3EK8A 2CTNA 2H61A 3RLZA 4DCKA 4MBEA 3EK7A 1SCVA 2GKVA 3LK1A 3A4UB 4P2YB 2F2PA 5KTYA 1B8RA 4Q04A 1KCYA 1SGYI 1QS7A 1TN4A 1TIHA 1CE3A 1QX7A 1DVIA 1W7JB 2HF5A 4YI8A 4MRYA 4YGCB 1XK4C 2JWWA 2LVKA 3FWCA 4NDDA 2MA2A 4DIRA 1IQ3A 2IS9A 2LUCA 4CIDA 4CLNA 4MN0A 1S1EA 1SBJA 4AOMA 5D69A 2BECA 2LP2A 4ETOA 3IQQA 1NP8A 1QXPA 1LVCD 4N5XA 1IGVA 3FIAA 4PHKA 1OMUA 2KFGA 3BUOB 2P6AC 3NSKA 3WHUB 3JVTB 4OVNF 1E8AA 2KGBC 2P6BB 1PULA 2M1UA 2OVOA 1WLZA 2ZRTA 2MLEC 1HJAI 1EL4A 2ZKMX 3WHTB 1UP5A 2M9GA 1AJ4A 2EC6B 2NU3I 1RWYA 1IWQA 2BUSA 1UVGA 1KMAA 1NYAA 4DRWA 1UWOA 1N65A 1JFKA 4JPZB 2JXDA 2LHLA 2NCPA 4CFQA 3BOWA 1R6PA 2LE9B 4PE7A 1QX2A 2KFHA 3EKJA 1LA3A 2WCFA 2B1UA 1K9PA 1L2OB 2Y4QA 1NWDA 5HLOA 1G8IA 4MEWA 2GKTI 2CBLA 2PASA 2L51A 4MRXA 2KI6D 4PE0A 1WDCC 3PN7B 4QJ4B 3E3RA 2FCEA 1FI5A 1FF1A 1LKJA 4PE1A 2ZNEA 2K2FA 2N52A 3SGBI 1A4PA 3I5FC 1UUCA 1DGUA 4OCIA 4WQ2A 1SRAA 4E68A 1HDLA 1OMRA 1NUBA 3GOFA 1CLMA 3BUWB 3OHMB 3WXAA 2JZMA 1SGNI 2MRDA 1AVSA 1UURA 2MLFC 1CDPA 4ZCUA 2COLB 2LVJA 3DVEA 3SIBA 2OTGB 1K95A 4WRIA 1N0YA 1NCZA 3TS5B 1IW4A 1CFCA 3CTNA 4YRUA 1ZOTB 1J1EA 1S6JA 3PALA 1BG1A 5JHWC 2L98A 1XFUO 3AKAA 4GGFC 3PSRA 2LM5A 4GNKB 1DTLA 1OMVA 2M1KB 3VROA 3KEVA 5JJGA 1OZSA 1OOJA 2SGEI 4GAOA 2JYYA 2F3ZA 2MJWB 3BOWB 3SG3A 4MZJA 1F71A 1B9AA 1TRFA 5I8NA 2KHNA 2LUXA 3D10A 1CT0I 1R0RI 1H8BA 1XFYO 1BMOA 2V53A 2ZNDA 3I5GC 3PATA 1OVOA 1B8CA 3TDZA 1OE9B 4YGEB 1CHOI 2DOQA 2BE4A 3VRQA 5I2OA 4CFRA 4I5KA 1CKKA 4GGNA 4M2OA 1IG5A 1QLSA 1K96A 1Z7KB 5BPJA 2KQ6A 4GUKA 1XFWO 2JTZA 1KK8C 2M0RA 5IBWA 3GK2A 1F4QA 2JXLA 3CR2A 3H4SE 2K61A 3M0WA 1NX3A 4A4CA 3O4YA 5B8IB 1QLKA 1ZFSA 1W7IB 4PHMA 3A8RA 4FTGA 4NDBA 1YRUB 5CSFA 5HKYA 4DUQA 1MT1A 3I5IC 3OX5A 2WNDA 2D8NA 1BUSA 1IRJA 2L50A 2CCMA 1J55A 3IF7A 3DD4A 2LLTA 1IJ5A 4ZCVA 5I2QA 2EHBA 4U8DA 3SGQI 1XFZO 2PSRA 1J7OA 1WRKA 1GQMA 2AUCA 1K90D 2NZ0A 1XYDA 1F70A 1IJ6A 4YGBB 3LCPC 1KQVA 3CZTX 1UHHA 1DMOA 2LVVA 1B8LA 3TUYC 1J7RA 3BUNB 1UHIA 3FWBA 3NXAA 1QVIZ 1TCOB 1QJTA 2WCBA 1KWOB 1Y1CA 5F6TA 2CNPA 1Y6WA 2HQ8A 2LMTA 3BUXB 2NXQA 1LR9A 4M2PA 2EGDA 1TIZA 2I94A 1F4OA 1M39A 1ALVA 1MUXA 1YX7A 2JNFA 2PRUA 3KHEA 2QQDA 3QTLD 1XFVO 4PHNA 3TDUA 1WRLA 1XFXO 2OS8B 1CDLA 1SNLA 3RM1A 3QRXA 4XJKA 3AAKA 3I5FB 3OB2B 4YGAA 1CNPA 1K94A 3O78A 1NX1A 3BXKA 2KYFA 1PCEA 2M49B 1MF8B 2KQYA 2BCBA 5K89A 5CSNA 4IL1A 1L7ZA 2FJUB 4P5OE 3HX4A 3VGOA 1DJXA 1KSOA 1K2HA 3KO0A 3CR4X 5FYXA 1SL7A 1QATA 4MVFA 1CSOI 1MR8A 5DKNA 5JOLA 1PSRA 2PVBA 1A75A 3DF0A 1IY6A 1BU3A 1NCXA 1Y1BA 3B4VC 1U5IA 2WC8A 1QVIY 1RFJA 2A4JA 2F33A 1H0ZA 1MWNA 1Y0VH 2FCDA 2BKHB 2E30A 2KI4B 4M2QA 1JF2A 1UVFA 1CTRA 1Y1XA 1UHNA 1KSMA 1PSBA 1XA5A 2KAVA 3SG5A 2NCOA 3EKHA 1NX0A 1SK6D 4HSZA 3LK0A 2L0PA 1V1FA 4CPVA 1YVLA 3JTDB 1PALA 1DJWA 1PJUA 4GI3C 2Y1NA 1XK4A 2ISDA 1K9KA 1KFUS 2F3CI 2CT9A 1TNXA 3SG6A 4XJKB 2FOTA 2Y1MA 2M97A 2LMUA 4I5LB 1B4CA 3D0YA 1QIWA 1EG3A 5HKWA 2BL0B 1CFDA 3I5HB 4SGBI 3ZNIA 1YRTB 2JULA 1OSAA 4MSPA 3VRRA 2LP3A 1SCMC 1ZACA 3WNXB 1TNQA 5KU1A 2NU1I 3F45A 1GGWA 2JOJA 5GQQC 1BF5A 1YURA 5AEQA 1B7TZ 1NPQA 3I5IB 1M63B 4PALA 2CXJA 1YR5A 4MZLA 2HPSA 5J3XA 4QJ5B 3OVOA 3JVTC 2G9BA 2LNKA 1A75B 3DF0B 1TBRR 1DJGA 2LV7A 3AKBA 4TNCA 1PVAA 1U5IB 2R2IA 2L5XB 1Y1AA 2I7AA 1DS3I 2EC6C 1TURA 4FQOA 4YGDB 2LEOA 3PM8A 1RK9A 2N17A 1HT9A 4PCWA 1TUSA 1LA0A 2I18A 1LXFC 2M29A 3EK4A 1S36A 2JZIA 3DVMA 1UUSA 4GBAA 1L2OC 3NSIA 2Q4UA 1MXLC 4HRHA 1MQ1A 1UHJA 3SJSA 2H61C 2PMYA 3NSLA 1SW8A 1C7WA 3O2PA 3PN7C 1S6IA 1X02A 1BR1B 1M8CA 5G08A 2LCPA 1DT7B 3PFVA 2WORA 2BKIB 5ER4X 1AP4A 1SR6C 5HKZA 2NLNA 1B7TY 1CM1A 1SMGA 3D0YB 2K7DA 1R2UA 2JXCA 2JT8A 1WRZA 4A4BA 1AUIB 2JNXA 3DVKA 2KMOA 2ZFDA 4MLWA 1V1GA 4BY4A 1F8HA 2JTTA 3C1VA 3OX6A 4GGFA 4NQGA 1IKUA 1CFPA 3BQ3A 2KMQA 1Y1UA 1AN1I 1YU6C 2LHIA 3SIAA 5D7FA 1Q80A 4WQ3A 2SGFI 1K9UA 1DGVA 2JT0A 4ICBA 4I5NB 1K8UA 1G4YR 2ZN8A 3BYAA 3OP0A 2K7CA 4AQIA 1AK8A 1TNWA 1ZMZA 2BBNA 2SGDI 1C7VA 1TGSI 2BCXA 1AHRA 1EH2A 1WDCB 2VRGA 3EVVA 4C0JA 1QV0A 1A2XA 1NX2A 1NIWA 4N1GA 4USLA 2BCAA 1CB1A 3IQOA 1QV1A 1DJIA 4GFTA 4ORBB 2JC2A 1SGDI 2LAPA 5AFPA 3O6BA 1SGEI 1RJVA 1B47A 1HQVA 1M8BA 1M31A 1YX8A 3SEKC 3LL8B 1ODBA 1HPTA 4NDCA 2ZRSA 1KFUL 1SL9A 2O60A 4L9MA 1RROA 1PK0D 2KNEA 2LLUA 1KQMC 1UHKA 2K7BA 1J7QA 1CMGA 1LR8A 5DAEA 2LANA 4HREE 4DS7A 3GK4X 2LLSA 1TOPA 1SCMB 2GGZA 1JUOA 4R1EA 2ARPF 1A29A 4MZKA 4OKHA 1YTZC 4YBHB 3VRNA 2RGIA 1F54A 1SY9A 3VRPA 1CGII 4D1EA 1TBQR 1RECA 5DKRA 2E6WA 2G2BA 3CLNA 1EG4A 1FBVA 2KBMA 4OV2A 1KK7Y 1BR4B 1JWDA 2GGMA 2MAZA 3CS1A 2LMVA 1QIVA 1KFXS 5ER5A 2F8PA 2KYCA 1SGQI 1CDNA 1TNPA 2KSPA 1YUSA 2M3WA 1YTPA 1H4BA 3I5GB 1CT2I 1JSAA 2KFFA 4YI9A 1CLLA 2L4IA 2GKRI 2SGPI 2NU0I 1B1GA 5I2LA
chains in the Genus database with same CATH superfamily
3AAJA 2KOTA 3UGIA 1PTQA 5DKQA 2WCYA 2ERBA 1CLBA 1YVHA 1EJ3A 3CYZA 4XYNA 2BE6A 1PRWA 2AAOA 1SR6B 1LR7A 3S0AA 1PVBA 2JPTA 2N71A 3GK1A 2QEHA 3LLEA 5CSJA 4ORCB 1CT4I 3ZWHA 1V1HA 2KAXA 4C0KA 2X3TA 4N1FA 1CMFA 1M45A 2M7NA 5FUYA 1FW4A 5AERA 2B0UC 3ICBA 2H2KA 2QQCA 2KMPA 3JTDC 3TJQA 4JWQA 2M5XA 3HCMA 3OB1B 2B8TA 2F3YA 2BL0C 3TS5C 2Q91A 2ERWA 1DS2I 2K2AA 4INXA 5HL1A 1BT6A 4OR9B 3PLFB 4OVOA 1CFFA 3TO7A 3SG2A 1MHOA 1IH0A 1DF0B 2KAYA 2WCEA 3EK8A 1TOTA 2RIJA 3LK1A 1CE3A 1DVIA 4YGCB 2JWWA 4DIRA 2LUCA 4MN0A 1S1EA 4AOMA 3FSXA 3UEYA 3IQQA 1NP8A 1LVCD 4N5XA 3FIAA 3BFBA 3BUOB 3WHUB 1E8AA 1PULA 2M9GA 2NU3I 2BUSA 1UVGA 1N65A 2JXDA 2LHLA 2QQ0A 2WCFA 2Y4QA 5HLOA 4MEWA 4QJ4B 3E3RA 2FCEA 3BJIA 4E1PA 2K2FA 1CLMA 3BUWB 2JZMA 1UURA 4ZCUA 2COLB 3UGLA 2OTGB 1NCZA 1RFHA 1CFCA 3OL0A 5JHWC 3AKAA 2P71A 3BOWB 2KLDA 3D10A 2V53A 3CXLA 4YGEB 1CHOI 4M2OA 1IG5A 2GVIA 1Z7KB 2JTZA 2DKVA 1F4QA 2JXLA 3VB1A 1QLKA 4PHMA 5HQ8A 4FTGA 5CSFA 5HKYA 2WCMA 3I5IC 2RC4A 2WNDA 3PJIA 3IF7A 3DD4A 3OXGA 1DC1A 1J7OA 1F70A 1B8LA 2ORWA 1QVIZ 1TCOB 2WCBA 2LMTA 2NXQA 1F4OA 1M39A 1ALVA 2JNFA 2QQDA 3QTLD 4PHNA 3TDUA 1XFXO 1C3ZA 1SNLA 3BFAA 3SS3A 3AAKA 1DEKA 3O78A 3BXKA 5CCMA 1PCEA 1MF8B 4P5OE 3CR4X 2WCHA 1SL7A 1QATA 4MVFA 1MR8A 5JOLA 1BU3A 1QVIY 2F33A 2V1CC 1LS8A 2E30A 4M2QA 2KAVA 2NCOA 2A20A 2KPHA 2Y1NA 2YGUA 5EX0A 3TOAA 1KFUS 1TNXA 5FI7A 4OZDA 1V1IA 2Y1MA 1TBOA 5HKWA 3TO6A 3I5HB 1WGTA 1ZACA 2JOJA 1BF5A 1M63B 2CXJA 2QEOA 3DF0B 3D00A 2I7AA 4FQOA 4YGDB 3PM8A 2N17A 2I18A 1VDDA 1UHJA 2PMYA 3O2PA 1S6IA 5G08A 2LCPA 2BKIB 5ER4X 5HKZA 1R2UA 2JNXA 2ZFDA 3UNWA 1F8HA 4GGFA 1CFPA 3OX6A 1AN1I 1P28A 3UOEA 2LHIA 1DGVA 2WGCA 1K8UA 3BYAA 2ZN8A 2K7CA 1AK8A 1C7VA 1TGSI 1AHRA 1QV0A 4USLA 3EG5B 3QWPA 3IQOA 5AFPA 1SGEI 1RJVA 1M31A 3FE9A 4L9MA 3UEJA 3R5AA 2LLUA 2K7BA 1CMGA 1LR8A 1SCMB 2DB6A 4MZKA 4OKHA 4YBHB 2RGIA 1F54A 3VRPA 1RECA 5DKRA 1EG4A 1FBVA 2KBMA 2GGMA 2LMVA 1QIVA 2F8PA 2KSPA 1H4BA 3I5GB 3D76A 1B1GA 1SPYA 2UZ3A 5KSZA 1S3PA 1TCFA 2Y5IA 1QTXA 2F2OA 2BBMA 1YUUA 1OOGA 2TN4A 3V2LA 1OYVI 1XX6A 5AXIA 4HGUA 2KMRA 1CM4A 1OZOA 1XO5A 1SGRI 2CWGA 2K60A 2KBIA 3SS5A 3EVRA 1MJ9A 1IQ5A 1ULKA 3RZSA 1BLQA 2JRFA 3BUMB 1YUTA 3MSEB 4PE4A 2KGRA 5HLVA 3R1PA 1KQMB 3I5HC 2GV5A 2M8UA 4GPLB 3R1OA 2JQ6A 1EXRA 1A03A 3CR5X 1N13A 2K0JA 5AANA 2N1AB 1XA6A 3CDNA 1KFXL 4HRGA 1Y8FA 1GJYA 3D78A 2H61A 3RLZA 2GKVA 1KCYA 1B8RA 1SGYI 1TIHA 1QX7A 1W7JB 4YI8A 1XK4C 3FWCA 2IS9A 5EX3A 4CIDA 1SBJA 2LUYA 2J87A 2LP2A 2PQ8A 5E3PA 4OVNF 2M1UA 2OVOA 1WLZA 2ZRTA 2ZKMX 3WHTB 2EC6B 1NYAA 4DRWA 1UWOA 1GM0A 1QX2A 1LA3A 2VRWB 2GKTI 2CBLA 2PASA 2L51A 4MRXA 2KI6D 2PYQA 3I5FC 4OCIA 4WQ2A 1OMRA 1NUBA 3GOFA 1AVSA 3OXLA 3RU0A 2LVJA 3SIBA 1K95A 3N7HA 1N0YA 1IW4A 3CTNA 1ZOTB 1J1EA 3PALA 1BG1A 2L98A 2LM5A 4GNKB 1OMVA 3VROA 3KEVA 1OZSA 1OOJA 4GAOA 3FC3A 3SG3A 4A24A 1B9AA 1R0RI 2ZNDA 3I5GC 3TDZA 2DOQA 2BE4A 3VRQA 4CFRA 4I5KA 4GGNA 1K96A 3CZ1A 5IBWA 3GK2A 3H4SE 2K61A 3M0WA 1IIOA 5B8IB 1OOIX 1HEVA 3A8RA 1KBEA 5HI7A 1W3SA 4DUQA 1K7TA 3FE8A 3OX5A 2D8NA 1J55A 3D77A 2LLTA 1IJ5A 2EHBA 1XFZO 2NZ0A 1KQVA 1UHHA 3BUNB 3FWBA 3NXAA 1KWOB 1Y6WA 1LR9A 4M2PA 3R5CA 2I94A 1MUXA 2PRUA 4MPIA 2OS8B 1X4SA 3RM1A 3QRXA 3OB2B 1K94A 2KYFA 2M49B 2KQYA 5K89A 1L7ZA 2Y0MA 1DJXA 1KSOA 9WGAA 3KO0A 1QWVA 1NXUA 1A75A 1IY6A 1Y1BA 3B4VC 1U5IA 2WC8A 1H0ZA 2L2CA 2FCDA 1JF2A 3EKHA 4HSZA 3LK0A 2L0PA 4CPVA 3QMEA 5FI6A 1K9KA 3DZTA 2F3CI 2LMUA 1B4CA 3D0YA 1EG3A 4KYNA 2JULA 2W0TA 3PM2A 3WNXB 5KU1A 2NU1I 3F45A 5AEQA 4MZLA 2HPSA 4QJ5B 5I94A 2CJSC 2G9BA 2LNKA 2CWHA 3AKBA 2LV7A 1FY7A 2R2IA 2L5XB 1Y1AA 1DS3I 2EC6C 1TUSA 2M29A 3EK4A 2JPOA 3DVMA 4HRHA 3SJSA 1MXLC 1MQ1A 1SW8A 1SR6C 2NLNA 1SMGA 2JT8A 3DVKA 2KMOA 3C1VA 3BQ3A 1Y1UA 3SIAA 5D7FA 4WQ3A 2SGFI 2JT0A 2BBNA 2BCXA 1EH2A 1WDCB 2VRGA 1NIWA 4N1GA 1Z4HA 2BCAA 1W4RA 2UVOA 1QV1A 1DJIA 2WC5A 1SGDI 2L8EA 4NDCA 1PK0D 1MJBA 2J9RA 1UHKA 1J7QA 5DAEA 4HREE 2LLSA 3PDNA 1JUOA 1C3YA 1A29A 1W9ZA 1YTZC 1SY9A 1CGII 4D1EA 1KK7Y 1JWDA 3CS1A 1KFXS 5ER5A 2KYCA 1CT2I 4YI9A 2WOSA 2MBXA 2LB7A 1FI6A 3L4AA 1KWOC 1P9ZA 1Q9BA 1FYBA 1KK8B 1SGPI 2KDHA 1TTXA 2OS8C 2ZN9A 1J7PA 1S5GZ 1M46A 3B6XA 5TNCA 1RTP1 2FJYA 3TZ1A 4UPGA 1JC2A 1OQPA 1WLMA 2PALA 1LINA 3TDIA 1FPWA 3TUYB 1ALWA 1XVJA 4F0ZB 2MHHA 4FKDA 3EVUA 4PDZA 1SYMA 1NCYA 1N2DA 3R1VA 2K8MB 1K7UA 1S5GY 1GGZA 3CWGA 2JW6A 4AQJA 1CDMA 2L2EA 1ORGA 5CSIA 2OTGC 1S6CA 2QEBA 2NU4I 1K93D 1AJ5A 5CPVA 2L5YA 2SGQI 2AMIA 2L4HA 4I5JA 3NSOA 4QJ3B 3OGNA 5D3OA 1CGJI 1WY9A 3TOBA 1JF0A 3CGAA 4AMLA 1D1OA 2FNFX 1PPFI 2YQPA 1VRKA 1QX5B 2CTNA 4DCKA 3EK7A 3A4UB 2F2PA 4Q04A 1OOFA 4CLNA 5D69A 2BECA 4ETOA 1QXPA 4PHKA 2KFGA 2WC6A 2P6AC 2KGBC 1FAQA 2MLEC 4DNCA 1EL4A 1AJ4A 1JFKA 1R6PA 3EKJA 1KBFA 1L2OB 1NWDA 1G8IA 1WDCC 1FF1A 1LKJA 2ZNEA 1UUCA 1DGUA 1HDLA 3BFHA 3WXAA 2MRDA 3E59A 3DVEA 3S0BA 3TS5B 4WRIA 4YRUA 1S6JA 4GGFC 1DTLA 3SS4A 2M1KB 1WKXA 2JYYA 4MZJA 1F71A 5I8NA 2LUXA 1CT0I 1XFYO 5I2OA 1KK8C 3O4XA 2M0RA 3CR2A 1NX3A 4A4CA 1W7IB 1YRUB 3VDUA 2CCMA 1P9GA 3CABA 1GQMA 1K90D 1XYDA 4JD9A 2LVVA 3B7AA 3TUYC 4UXIA 2CNPA 2HQ8A 2EGDA 7WGAA 1WRLA 1CDLA 4XJKA 1CNPA 1NX1A 1S20A 3OXFA 2BCBA 3R5BA 4IL1A 3HX4A 1K2HA 5FYXA 2ROWA 3NHIA 2ELIA 1TUJA 5DKNA 1FARA 2WVJA 1PSRA 2GIVA 1RFJA 1OOHA 1MWNA 2BKHB 2KI4B 1CTRA 1KSMA 1PSBA 1XA5A 3SG5A 2E5RA 1PJUA 4GI3C 1MJAA 3L47A 2FOTA 1ULNA 4I5LB 1CFDA 4SGBI 3L4LA 3ZNIA 3UGDA 4MSPA 2LP3A 1SCMC 1TNQA 5GQQC 3I5IB 3UO9A 5J3XA 3OVOA 5FUWA 1A75B 1DJGA 1U5IB 1TURA 2ENZA 1XFRA 1HT9A 2K9HA 2ENNA 1S36A 1UUSA 1UHAA 1L2OC 2H61C 3NSLA 1DT7B 1AP4A 3D0YB 5CCLA 2JXCA 1WRZA 1AUIB 1V1GA 2JTTA 1IKUA 2KMQA 1YU6C 1DELA 1Q80A 1G4YR 3OP0A 1ZMZA 2SGDI 1U5KA 4C0JA 4F7FA 4GFTA 2JC2A 2LAPA 1M8BA 3SEKC 3LL8B 1ODBA 1HPTA 2ZRSA 3S0EA 1SL9A 2O60A 1RROA 2KNEA 1KQMC 4UXJA 3S0GA 2ARPF 3VRNA 1TBQR 2QEVA 3CLNA 4OV2A 1TNPA 1YUSA 3DYEA 1WGCA 2KFFA 1CLLA 2GKRI 2SGPI 3IVTA 1BJFA 3R72A 2LVIA 5E3QA 1QASA 1SL8A 1IY5A 1DJHA 2KCXA 4FQTA 1SKTA 2P70A 2QACA 1BODA 3GOXA 2E73A 1G33A 3DY9A 4JQ0D 1DJZA 1MXEA 2QPTA 1K7VA 1NSHA 1ZUZA 3SG4A 2LC5A 3KF9A 3D75A 1F55A 2V1CA 1JBAA 1DJYA 5HYDA 3B87A 1J1DA 2WCJA 2JT3A 3R5DA 4UXHA 3DVJA 4IJ7A 2O5GA 2I2RE 2OU2A 1OMDA 1DF0A 2KI4C 5E3RA 3HH2C 4BY5A 1JFJA 1PTRA 3FE6A 2NU2I 2M7LA 2OD1A 2HQWA 2OZUA 2OPOA 1OMTA 3FS7A 2JU0A 5J8CA 1R79A 2JA1A 2K7OA 1C07A 3KPXA 3SG7A 2HETA 2BAPA 2KI6C 1KK7Z 2XRCA 4ORAB 4PHJA 2SCPA 2X52A 4C0LA 2SASA 3K21A 1X74A 5PALA 1S26D 2ODDA 1BOCA 3TO9A 2QQEA 4MBEA 5FI2A 1SCVA 4P2YB 5KTYA 2WCKA 1QS7A 1TN4A 2KLEA 2HF5A 5FUXA 4MRYA 2LVKA 4B6DA 4NDDA 2MA2A 1IQ3A 3OBVA 1IGVA 1OMUA 3S0DA 3D73A 3NSKA 3JVTB 2P6BB 1HJAI 3D74A 1UP5A 1RWYA 1IWQA 5FUVA 1KMAA 4JPZB 1ULMA 2NCPA 4CFQA 3BOWA 2LE9B 4PE7A 2KFHA 2B1UA 1K9PA 4PE0A 3DXLA 3PN7B 1FI5A 5J8FA 4PE1A 3VDPA 2QPOA 2N52A 3SGBI 1A4PA 4E68A 1SRAA 3K1EA 3OHMB 1SGNI 2MLFC 1CDPA 2H8VA 1TWOA 2YUUA 1XFUO 3PSRA 1T14A 5JJGA 2SGEI 2F3ZA 2MJWB 1TRFA 1WTJA 2KHNA 1H8BA 1BMOA 3PATA 4E1RA 2BNXA 1OVOA 1B8CA 1OE9B 1CKKA 1QLSA 5BPJA 2KQ6A 4GUKA 1XFWO 2WCLA 3O4YA 1ZFSA 3QAHA 5EL2A 4NDBA 4INWA 1MT1A 3S0FA 1BUSA 1IRJA 2L50A 4ZCVA 5I2QA 4U8DA 3SGQI 2PSRA 2PQLA 1Z2CB 3FSYA 1WRKA 2AUCA 1IJ6A 4YGBB 3LCPC 3CZTX 1DMOA 1J7RA 1UHIA 1QJTA 1Y1CA 5F6TA 3BUXB 1TIZA 1YX7A 3KHEA 1XFVO 1DQEA 4YGAA 3I5FB 2QDIA 2CWFA 5CSNA 2FJUB 3VGOA 3NHTA 1CSOI 1TUZA 2PVBA 3DF0A 1NCXA 2A4JA 1Y0VH 1UVFA 1Y1XA 1UHNA 1NX0A 1SK6D 1V1FA 1YVLA 3JTDB 1PALA 1DJWA 1XK4A 2ISDA 2CT9A 3SG6A 4XJKB 2M97A 1QIWA 3NGVA 2BL0B 3Q8IA 1YRTB 1OSAA 3B86A 3VRRA 1GGWA 1YURA 1B7TZ 1NPQA 3E2IA 3MEKA 4PALA 1YR5A 2ORVA 4JCVE 3JVTC 3BJHA 1TBRR 4TNCA 1PVAA 3UFFA 2LEOA 1RK9A 4PCWA 1LA0A 1LXFC 2JZIA 4GBAA 3NSIA 2Q4UA 1C7WA 3PN7C 1X02A 1BR1B 1M8CA 3CZ0A 3PFVA 2WORA 4PT1A 5DICA 1B7TY 1CM1A 2L7XA 2K7DA 4A4BA 4MLWA 4BY4A 4NQGA 3B88A 1Z2IA 1K9UA 4ICBA 4I5NB 4AQIA 3KY9A 1TNWA 2GTEA 3EVVA 1A2XA 1NX2A 1CB1A 4ORBB 3O6BA 1B47A 1HQVA 1YX8A 1XBTA 1KFUL 3VE5A 2LANA 4DS7A 3GK4X 4WP4A 1TOPA 2GGZA 1TBNA 4R1EA 4JKTA 2E6WA 2G2BA 1BR4B 1OW4A 1SSEB 2MAZA 1SGQI 2DIPA 1CDNA 2M3WA 1YTPA 3CZ2A 1JSAA 2L4IA 2NU0I 5I2LA
chains in the Genus database with same CATH topology
2WOSA 1SPYA 3AAJA 2MBXA 1BJFA 2KOTA 2LVIA 3UGIA 1PTQA 5DKQA 2UZ3A 2WCYA 1CLBA 1QASA 1YVHA 1FI6A 1EJ3A 1KWOC 1FYBA 4XYNA 1SL8A 2BE6A 5KSZA 1KK8B 1IY5A 1S3PA 1DJHA 1SGPI 1TCFA 2KCXA 2Y5IA 2KDHA 1SKTA 2QACA 1BODA 1QTXA 3GOXA 2E73A 1G33A 1TTXA 2F2OA 2BBMA 1YUUA 4JQ0D 1PRWA 2OS8C 2AAOA 1DJZA 1MXEA 2QPTA 1SR6B 2ZN9A 1NSHA 1J7PA 2TN4A 1S5GZ 1LR7A 1M46A 1PVBA 1ZUZA 2JPTA 2N71A 3GK1A 1RTP1 5TNCA 3SG4A 3TZ1A 2LC5A 1OYVI 4UPGA 3KF9A 1F55A 1JC2A 1OQPA 1WLMA 2V1CA 3LLEA 2PALA 1LINA 1XX6A 5CSJA 3TDIA 1JBAA 1DJYA 4ORCB 5AXIA 1CT4I 5HYDA 3ZWHA 1FPWA 1CM4A 3TUYB 1OZOA 1XO5A 1ALWA 1XVJA 4F0ZB 1SGRI 1V1HA 4HGUA 2MHHA 2KAXA 1J1DA 4FKDA 4C0KA 2JT3A 4N1FA 2KBIA 1CMFA 4UXHA 3DVJA 3EVUA 2O5GA 4PDZA 3EVRA 2I2RE 1M45A 2M7NA 1OMDA 1DF0A 1SYMA 2KI4C 5FUYA 1FW4A 5AERA 1IQ5A 2B0UC 1BLQA 3ICBA 2H2KA 2JRFA 3BUMB 1NCYA 1N2DA 1YUTA 2QQCA 3HH2C 2KMPA 4BY5A 1JFJA 1PTRA 2K8MB 3JTDC 3MSEB 4PE4A 2NU2I 2M7LA 2OD1A 2KGRA 2HQWA 5HLVA 1S5GY 3TJQA 2OPOA 1GGZA 4JWQA 1OMTA 1KQMB 3CWGA 2JW6A 2M5XA 3FS7A 2JU0A 3HCMA 4AQJA 1CDMA 2L2EA 3OB1B 2B8TA 5CSIA 2F3YA 2BL0C 3I5HC 1R79A 2OTGC 3TS5C 2Q91A 2GV5A 2M8UA 1S6CA 2ERWA 4GPLB 2K7OA 2JA1A 1C07A 3KPXA 3SG7A 2NU4I 1K93D 1DS2I 1AJ5A 2JQ6A 2K2AA 5CPVA 1EXRA 2HETA 1BT6A 2KI6C 1KK7Z 1A03A 2SGQI 2AMIA 2L4HA 3CR5X 4I5JA 3PLFB 4OR9B 2XRCA 3NSOA 1CFFA 4OVOA 4ORAB 4PHJA 4QJ3B 1N13A 2SCPA 2K0JA 5AANA 3SG2A 1CGJI 1WY9A 2N1AB 1JF0A 4C0LA 1XA6A 1MHOA 2SASA 1KFXL 3K21A 3CGAA 4HRGA 1X74A 1Y8FA 1IH0A 1GJYA 1D1OA 2FNFX 5PALA 1PPFI 1S26D 1DF0B 2KAYA 1VRKA 1BOCA 2ODDA 2YQPA 1QX5B 2QQEA 2WCEA 3EK8A 1TOTA 2CTNA 2H61A 3RLZA 4DCKA 4MBEA 3EK7A 1SCVA 2GKVA 3LK1A 3A4UB 4P2YB 2F2PA 5KTYA 1B8RA 4Q04A 1KCYA 1SGYI 1QS7A 1TN4A 1TIHA 1CE3A 1QX7A 1DVIA 1W7JB 2HF5A 4YI8A 4MRYA 4YGCB 5FUXA 1XK4C 2JWWA 2LVKA 3FWCA 4B6DA 4NDDA 2MA2A 4DIRA 1IQ3A 2IS9A 5EX3A 2LUCA 4CIDA 4CLNA 4MN0A 1S1EA 1SBJA 4AOMA 5D69A 2LUYA 2J87A 2BECA 3UEYA 2LP2A 4ETOA 3IQQA 1NP8A 1QXPA 1LVCD 4N5XA 1IGVA 3FIAA 4PHKA 1OMUA 2KFGA 3BUOB 2P6AC 3NSKA 3WHUB 3JVTB 4OVNF 1E8AA 2KGBC 2P6BB 1PULA 2M1UA 2OVOA 1FAQA 1WLZA 2ZRTA 2MLEC 1HJAI 1EL4A 2ZKMX 3WHTB 1UP5A 2M9GA 1AJ4A 2EC6B 2NU3I 1RWYA 1IWQA 2BUSA 1UVGA 5FUVA 1NYAA 4DRWA 1UWOA 1KMAA 1N65A 1JFKA 4JPZB 2JXDA 2LHLA 2NCPA 4CFQA 3BOWA 1R6PA 2LE9B 4PE7A 1QX2A 2KFHA 2QQ0A 3EKJA 1LA3A 2WCFA 2B1UA 1KBFA 1K9PA 1L2OB 2Y4QA 1NWDA 5HLOA 1G8IA 2VRWB 4MEWA 2GKTI 2CBLA 2PASA 2L51A 4MRXA 2KMRA 2KI6D 4PE0A 1WDCC 3PN7B 4QJ4B 3E3RA 2FCEA 3BJIA 1FI5A 1FF1A 1LKJA 4PE1A 3VDPA 2ZNEA 2QPOA 4E1PA 2K2FA 2N52A 3SGBI 1A4PA 3I5FC 1UUCA 1DGUA 4OCIA 4WQ2A 1SRAA 4E68A 1HDLA 1OMRA 1NUBA 3GOFA 1CLMA 3BUWB 3OHMB 3WXAA 2JZMA 1SGNI 2MRDA 1AVSA 3OXLA 3RU0A 1UURA 2MLFC 1CDPA 4ZCUA 3E59A 2COLB 2LVJA 3DVEA 3UGLA 3SIBA 2OTGB 1K95A 4WRIA 1N0YA 1NCZA 3TS5B 1RFHA 1IW4A 1CFCA 3OL0A 3CTNA 4YRUA 2YUUA 1ZOTB 1J1EA 1S6JA 3PALA 1BG1A 5JHWC 2L98A 1XFUO 3AKAA 4GGFC 3PSRA 2LM5A 4GNKB 1DTLA 1OMVA 2M1KB 3VROA 3KEVA 5JJGA 1OZSA 1OOJA 2SGEI 4GAOA 2JYYA 2F3ZA 3FC3A 2MJWB 3BOWB 3SG3A 4MZJA 4A24A 1F71A 1B9AA 1TRFA 5I8NA 2KHNA 2LUXA 3D10A 1CT0I 1R0RI 1H8BA 1XFYO 1BMOA 2V53A 2ZNDA 3I5GC 3PATA 4E1RA 1OVOA 3CXLA 1B8CA 3TDZA 1OE9B 4YGEB 1CHOI 2DOQA 2BE4A 3VRQA 5I2OA 4CFRA 4I5KA 1CKKA 4GGNA 4M2OA 1IG5A 2GVIA 1QLSA 1K96A 1Z7KB 5BPJA 2KQ6A 4GUKA 1XFWO 2JTZA 1KK8C 2M0RA 5IBWA 3GK2A 1F4QA 2JXLA 3CR2A 3H4SE 2K61A 3M0WA 1NX3A 4A4CA 3O4YA 5B8IB 1QLKA 1ZFSA 1W7IB 4PHMA 5HQ8A 3A8RA 4FTGA 1KBEA 4NDBA 1YRUB 5CSFA 5HKYA 4DUQA 1MT1A 1W3SA 3I5IC 5HI7A 3OX5A 2WNDA 2D8NA 3VDUA 1BUSA 1IRJA 2L50A 2CCMA 1J55A 3IF7A 3DD4A 2LLTA 1IJ5A 4ZCVA 5I2QA 2EHBA 4U8DA 3SGQI 1XFZO 2PSRA 3OXGA 1J7OA 1WRKA 1GQMA 2AUCA 1K90D 2NZ0A 1XYDA 1F70A 1IJ6A 4YGBB 3LCPC 1KQVA 3CZTX 1UHHA 1DMOA 2LVVA 1B8LA 3TUYC 1J7RA 3BUNB 1UHIA 3FWBA 2ORWA 3NXAA 4UXIA 1QVIZ 1TCOB 1QJTA 2WCBA 1KWOB 1Y1CA 5F6TA 2CNPA 1Y6WA 2HQ8A 2LMTA 3BUXB 2NXQA 1LR9A 4M2PA 2EGDA 1TIZA 2I94A 1F4OA 1M39A 1ALVA 1MUXA 1YX7A 2JNFA 2PRUA 3KHEA 2QQDA 3QTLD 1XFVO 4PHNA 3TDUA 1WRLA 1XFXO 2OS8B 1CDLA 1X4SA 1SNLA 3RM1A 3QRXA 4XJKA 3AAKA 3I5FB 3OB2B 4YGAA 1CNPA 1K94A 3O78A 1NX1A 3BXKA 5CCMA 2KYFA 1PCEA 2M49B 3OXFA 1MF8B 2KQYA 2BCBA 5K89A 5CSNA 4IL1A 1L7ZA 2FJUB 4P5OE 3HX4A 3VGOA 1DJXA 1KSOA 1K2HA 3KO0A 3CR4X 5FYXA 2ROWA 2ELIA 1SL7A 1QATA 4MVFA 1CSOI 1MR8A 5DKNA 1FARA 2WVJA 5JOLA 1PSRA 2PVBA 1A75A 3DF0A 1IY6A 1BU3A 1NCXA 1Y1BA 3B4VC 1U5IA 2WC8A 1QVIY 1RFJA 2A4JA 2F33A 2V1CC 1H0ZA 1MWNA 1Y0VH 2FCDA 2BKHB 2E30A 2KI4B 4M2QA 1JF2A 1UVFA 1CTRA 1Y1XA 1UHNA 1KSMA 1PSBA 1XA5A 2KAVA 3SG5A 2NCOA 2A20A 3EKHA 1NX0A 2E5RA 1SK6D 4HSZA 3LK0A 2L0PA 1V1FA 4CPVA 1YVLA 3JTDB 1PALA 1DJWA 1PJUA 4GI3C 2Y1NA 5EX0A 1XK4A 2ISDA 1K9KA 1KFUS 2F3CI 2CT9A 1TNXA 3SG6A 1V1IA 4XJKB 2FOTA 2Y1MA 2M97A 2LMUA 4I5LB 1B4CA 3D0YA 1QIWA 1EG3A 1TBOA 5HKWA 2BL0B 1CFDA 3I5HB 4SGBI 3ZNIA 3UGDA 1YRTB 2JULA 1OSAA 4MSPA 2W0TA 3VRRA 2LP3A 1SCMC 1ZACA 3WNXB 1TNQA 5KU1A 2NU1I 3F45A 1GGWA 2JOJA 5GQQC 1BF5A 1YURA 5AEQA 1B7TZ 1NPQA 3I5IB 1M63B 3E2IA 3MEKA 4PALA 2CXJA 1YR5A 4MZLA 2ORVA 2HPSA 5J3XA 4QJ5B 3OVOA 4JCVE 2CJSC 3JVTC 2G9BA 2LNKA 5FUWA 1A75B 3DF0B 1TBRR 1DJGA 2LV7A 3AKBA 4TNCA 1PVAA 3D00A 1U5IB 2R2IA 2L5XB 1Y1AA 2I7AA 1DS3I 2EC6C 1TURA 3UFFA 4FQOA 4YGDB 2ENZA 2LEOA 3PM8A 1RK9A 2N17A 1HT9A 4PCWA 1TUSA 1LA0A 2K9HA 2I18A 2ENNA 1LXFC 2M29A 3EK4A 1S36A 2JZIA 1VDDA 3DVMA 1UUSA 4GBAA 1L2OC 3NSIA 2Q4UA 1MXLC 4HRHA 1MQ1A 1UHJA 3SJSA 2H61C 2PMYA 3NSLA 1SW8A 1C7WA 3O2PA 3PN7C 1S6IA 1X02A 1BR1B 1M8CA 5G08A 2LCPA 1DT7B 3PFVA 2WORA 2BKIB 5ER4X 1AP4A 1SR6C 5HKZA 2NLNA 1B7TY 1CM1A 1SMGA 3D0YB 5CCLA 2L7XA 2K7DA 1R2UA 2JXCA 2JT8A 1WRZA 4A4BA 1AUIB 2JNXA 3DVKA 2KMOA 2ZFDA 4MLWA 1V1GA 4BY4A 1F8HA 2JTTA 3C1VA 3OX6A 4GGFA 4NQGA 1IKUA 1CFPA 3BQ3A 2KMQA 1Y1UA 1AN1I 1YU6C 2LHIA 3SIAA 5D7FA 1Q80A 4WQ3A 2SGFI 1K9UA 1DGVA 2JT0A 4ICBA 4I5NB 1K8UA 1G4YR 2ZN8A 3BYAA 3OP0A 2K7CA 4AQIA 1AK8A 1TNWA 1ZMZA 3KY9A 2BBNA 2SGDI 1C7VA 1TGSI 2BCXA 1AHRA 1U5KA 1EH2A 1WDCB 2VRGA 3EVVA 4C0JA 1QV0A 1A2XA 1NX2A 1NIWA 4N1GA 4USLA 2BCAA 1CB1A 1W4RA 3QWPA 3IQOA 1QV1A 1DJIA 4GFTA 4ORBB 2JC2A 1SGDI 2LAPA 5AFPA 3O6BA 1SGEI 2L8EA 1RJVA 1B47A 1HQVA 1M8BA 1M31A 1YX8A 3SEKC 3LL8B 1ODBA 1HPTA 4NDCA 1XBTA 2ZRSA 1KFUL 3VE5A 1SL9A 2O60A 4L9MA 1RROA 3UEJA 1PK0D 2KNEA 2LLUA 2J9RA 1KQMC 1UHKA 2K7BA 1J7QA 1CMGA 1LR8A 5DAEA 2LANA 4HREE 4DS7A 3GK4X 2LLSA 3PDNA 4UXJA 1TOPA 1SCMB 2GGZA 1TBNA 1JUOA 4R1EA 2ARPF 1A29A 4MZKA 4OKHA 2DB6A 1YTZC 4YBHB 3VRNA 2RGIA 1F54A 1SY9A 3VRPA 1CGII 4D1EA 1TBQR 1RECA 5DKRA 2E6WA 2G2BA 3CLNA 1EG4A 1FBVA 2KBMA 4OV2A 1KK7Y 1BR4B 1JWDA 2GGMA 2MAZA 3CS1A 2LMVA 1QIVA 1KFXS 5ER5A 2F8PA 2KYCA 1SGQI 2DIPA 1CDNA 1TNPA 2KSPA 1YUSA 2M3WA 1YTPA 1H4BA 3I5GB 1CT2I 1JSAA 2KFFA 4YI9A 1CLLA 2L4IA 2GKRI 2SGPI 2NU0I 1B1GA 5I2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WOS A;  1SPY A;  3AAJ A;  2MBX A;  1BJF A;  2KOT A;  2LVI A;  5DKQ A;  2WCY A;  1CLB A;  1QAS A;  1YVH A;  1FI6 A;  1EJ3 A;  1KWO C;  1FYB A;  4XYN A;  1SL8 A;  2BE6 A;  5KSZ A;  1KK8 B;  1IY5 A;  1S3P A;  1DJH A;  1SGP I;  1TCF A;  2KCX A;  2Y5I A;  2KDH A;  1SKT A;  2QAC A;  1BOD A;  1QTX A;  1G33 A;  1TTX A;  2F2O A;  2BBM A;  1YUU A;  4JQ0 D;  1PRW A;  2OS8 C;  2AAO A;  1DJZ A;  1MXE A;  2QPT A;  1SR6 B;  2ZN9 A;  1NSH A;  1J7P A;  2TN4 A;  1S5G Z;  1LR7 A;  1M46 A;  1PVB A;  1ZUZ A;  2JPT A;  2N71 A;  3GK1 A;  1RTP 1;  5TNC A;  3SG4 A;  3TZ1 A;  2LC5 A;  1OYV I;  4UPG A;  3KF9 A;  1F55 A;  1JC2 A;  1OQP A;  1WLM A;  3LLE A;  2PAL A;  1LIN A;  5CSJ A;  3TDI A;  1JBA A;  1DJY A;  4ORC B;  5AXI A;  1CT4 I;  5HYD A;  3ZWH A;  1FPW A;  1CM4 A;  3TUY B;  1OZO A;  1XO5 A;  1ALW A;  1XVJ A;  4F0Z B;  1SGR I;  2KMR A;  4HGU A;  2MHH A;  2KAX A;  1J1D A;  4C0K A;  2JT3 A;  4N1F A;  2KBI A;  1CMF A;  3DVJ A;  3EVU A;  2O5G A;  4PDZ A;  3EVR A;  2I2R E;  1M45 A;  2M7N A;  1OMD A;  1DF0 A;  1SYM A;  2KI4 C;  1FW4 A;  5AER A;  1IQ5 A;  2B0U C;  1BLQ A;  3ICB A;  2H2K A;  2JRF A;  3BUM B;  1NCY A;  1N2D A;  1YUT A;  2QQC A;  3HH2 C;  2KMP A;  4BY5 A;  1JFJ A;  2K8M B;  3JTD C;  3MSE B;  4PE4 A;  2NU2 I;  2M7L A;  2KGR A;  2HQW A;  5HLV A;  1S5G Y;  3TJQ A;  2OPO A;  1GGZ A;  4JWQ A;  1OMT A;  1KQM B;  3CWG A;  2M5X A;  3FS7 A;  2JU0 A;  3HCM A;  4AQJ A;  1CDM A;  2L2E A;  3OB1 B;  5CSI A;  2F3Y A;  2BL0 C;  3I5H C;  2OTG C;  3TS5 C;  2Q91 A;  2GV5 A;  2M8U A;  1S6C A;  2ERW A;  4GPL B;  2K7O A;  1C07 A;  3KPX A;  3SG7 A;  2NU4 I;  1K93 D;  1DS2 I;  1AJ5 A;  2JQ6 A;  2K2A A;  5CPV A;  1EXR A;  2HET A;  1BT6 A;  2KI6 C;  1KK7 Z;  1A03 A;  2SGQ I;  2AMI A;  2L4H A;  3CR5 X;  4I5J A;  3PLF B;  4OR9 B;  2XRC A;  3NSO A;  1CFF A;  4OVO A;  4ORA B;  4PHJ A;  4QJ3 B;  1N13 A;  2SCP A;  2K0J A;  5AAN A;  3SG2 A;  1CGJ I;  1WY9 A;  1JF0 A;  4C0L A;  1MHO A;  2SAS A;  1KFX L;  3K21 A;  3CGA A;  4HRG A;  1IH0 A;  1GJY A;  1D1O A;  5PAL A;  1PPF I;  1S26 D;  1DF0 B;  2KAY A;  1VRK A;  1BOC A;  1QX5 B;  2WCE A;  3EK8 A;  2CTN A;  2H61 A;  3RLZ A;  4DCK A;  4MBE A;  3EK7 A;  1SCV A;  2GKV A;  3LK1 A;  3A4U B;  4P2Y B;  2F2P A;  5KTY A;  1B8R A;  4Q04 A;  1KCY A;  1SGY I;  1QS7 A;  1TN4 A;  1TIH A;  1CE3 A;  1QX7 A;  1DVI A;  1W7J B;  2HF5 A;  4YI8 A;  4MRY A;  4YGC B;  1XK4 C;  2JWW A;  2LVK A;  3FWC A;  4NDD A;  2MA2 A;  4DIR A;  1IQ3 A;  2IS9 A;  2LUC A;  4CID A;  4CLN A;  4MN0 A;  1S1E A;  1SBJ A;  4AOM A;  5D69 A;  2BEC A;  2LP2 A;  4ETO A;  3IQQ A;  1NP8 A;  1QXP A;  1LVC D;  4N5X A;  1IGV A;  3FIA A;  4PHK A;  1OMU A;  2KFG A;  3BUO B;  2P6A C;  3NSK A;  3WHU B;  3JVT B;  4OVN F;  1E8A A;  2KGB C;  2P6B B;  1PUL A;  2M1U A;  2OVO A;  1WLZ A;  2ZRT A;  2MLE C;  1HJA I;  1EL4 A;  2ZKM X;  3WHT B;  1UP5 A;  2M9G A;  1AJ4 A;  2EC6 B;  2NU3 I;  1RWY A;  1IWQ A;  2BUS A;  1UVG A;  1KMA A;  1NYA A;  4DRW A;  1UWO A;  1N65 A;  1JFK A;  4JPZ B;  2JXD A;  2LHL A;  2NCP A;  4CFQ A;  3BOW A;  1R6P A;  2LE9 B;  4PE7 A;  1QX2 A;  2KFH A;  3EKJ A;  1LA3 A;  2WCF A;  2B1U A;  1K9P A;  1L2O B;  2Y4Q A;  1NWD A;  5HLO A;  1G8I A;  4MEW A;  2GKT I;  2CBL A;  2PAS A;  2L51 A;  4MRX A;  2KI6 D;  4PE0 A;  1WDC C;  3PN7 B;  4QJ4 B;  3E3R A;  2FCE A;  1FI5 A;  1FF1 A;  1LKJ A;  4PE1 A;  2ZNE A;  2K2F A;  2N52 A;  3SGB I;  1A4P A;  3I5F C;  1UUC A;  1DGU A;  4OCI A;  4WQ2 A;  1SRA A;  4E68 A;  1HDL A;  1OMR A;  1NUB A;  3GOF A;  1CLM A;  3BUW B;  3OHM B;  3WXA A;  2JZM A;  1SGN I;  2MRD A;  1AVS A;  1UUR A;  2MLF C;  1CDP A;  4ZCU A;  2COL B;  2LVJ A;  3DVE A;  3SIB A;  2OTG B;  1K95 A;  4WRI A;  1N0Y A;  1NCZ A;  3TS5 B;  1IW4 A;  1CFC A;  3CTN A;  4YRU A;  1ZOT B;  1J1E A;  1S6J A;  3PAL A;  1BG1 A;  5JHW C;  2L98 A;  1XFU O;  3AKA A;  4GGF C;  3PSR A;  2LM5 A;  4GNK B;  1DTL A;  1OMV A;  2M1K B;  3VRO A;  3KEV A;  5JJG A;  1OZS A;  1OOJ A;  2SGE I;  4GAO A;  2JYY A;  2F3Z A;  2MJW B;  3BOW B;  3SG3 A;  4MZJ A;  1F71 A;  1B9A A;  1TRF A;  5I8N A;  2KHN A;  2LUX A;  3D10 A;  1CT0 I;  1R0R I;  1H8B A;  1XFY O;  1BMO A;  2V53 A;  2ZND A;  3I5G C;  3PAT A;  1OVO A;  1B8C A;  3TDZ A;  1OE9 B;  4YGE B;  1CHO I;  2DOQ A;  2BE4 A;  3VRQ A;  5I2O A;  4CFR A;  4I5K A;  1CKK A;  4GGN A;  4M2O A;  1IG5 A;  1QLS A;  1K96 A;  1Z7K B;  5BPJ A;  2KQ6 A;  4GUK A;  1XFW O;  2JTZ A;  1KK8 C;  2M0R A;  5IBW A;  3GK2 A;  1F4Q A;  2JXL A;  3CR2 A;  3H4S E;  2K61 A;  3M0W A;  1NX3 A;  4A4C A;  3O4Y A;  5B8I B;  1QLK A;  1ZFS A;  1W7I B;  4PHM A;  3A8R A;  4FTG A;  4NDB A;  1YRU B;  5CSF A;  5HKY A;  4DUQ A;  1MT1 A;  3I5I C;  3OX5 A;  2WND A;  2D8N A;  1BUS A;  1IRJ A;  2L50 A;  2CCM A;  1J55 A;  3IF7 A;  3DD4 A;  2LLT A;  1IJ5 A;  4ZCV A;  5I2Q A;  2EHB A;  4U8D A;  3SGQ I;  1XFZ O;  2PSR A;  1J7O A;  1WRK A;  1GQM A;  2AUC A;  1K90 D;  2NZ0 A;  1XYD A;  1F70 A;  1IJ6 A;  4YGB B;  3LCP C;  1KQV A;  3CZT X;  1UHH A;  1DMO A;  2LVV A;  1B8L A;  3TUY C;  1J7R A;  3BUN B;  1UHI A;  3FWB A;  3NXA A;  1QVI Z;  1TCO B;  1QJT A;  2WCB A;  1KWO B;  1Y1C A;  5F6T A;  2CNP A;  1Y6W A;  2HQ8 A;  2LMT A;  3BUX B;  2NXQ A;  1LR9 A;  4M2P A;  2EGD A;  1TIZ A;  2I94 A;  1F4O A;  1M39 A;  1ALV A;  1MUX A;  1YX7 A;  2JNF A;  2PRU A;  3KHE A;  2QQD A;  3QTL D;  1XFV O;  4PHN A;  3TDU A;  1WRL A;  1XFX O;  2OS8 B;  1CDL A;  1SNL A;  3RM1 A;  3QRX A;  4XJK A;  3AAK A;  3I5F B;  3OB2 B;  4YGA A;  1CNP A;  1K94 A;  3O78 A;  1NX1 A;  3BXK A;  2KYF A;  1PCE A;  2M49 B;  1MF8 B;  2KQY A;  2BCB A;  5K89 A;  5CSN A;  4IL1 A;  1L7Z A;  2FJU B;  4P5O E;  3HX4 A;  3VGO A;  1DJX A;  1KSO A;  1K2H A;  3KO0 A;  3CR4 X;  5FYX A;  1SL7 A;  1QAT A;  4MVF A;  1CSO I;  1MR8 A;  5DKN A;  5JOL A;  1PSR A;  2PVB A;  1A75 A;  3DF0 A;  1IY6 A;  1BU3 A;  1NCX A;  1Y1B A;  3B4V C;  1U5I A;  2WC8 A;  1QVI Y;  1RFJ A;  2A4J A;  2F33 A;  1H0Z A;  1MWN A;  1Y0V H;  2FCD A;  2BKH B;  2E30 A;  2KI4 B;  4M2Q A;  1JF2 A;  1UVF A;  1CTR A;  1Y1X A;  1UHN A;  1KSM A;  1PSB A;  1XA5 A;  2KAV A;  3SG5 A;  2NCO A;  3EKH A;  1NX0 A;  1SK6 D;  4HSZ A;  3LK0 A;  2L0P A;  1V1F A;  4CPV A;  1YVL A;  3JTD B;  1PAL A;  1DJW A;  1PJU A;  4GI3 C;  2Y1N A;  1XK4 A;  2ISD A;  1K9K A;  1KFU S;  2F3C I;  2CT9 A;  1TNX A;  3SG6 A;  4XJK B;  2FOT A;  2Y1M A;  2M97 A;  2LMU A;  4I5L B;  1B4C A;  3D0Y A;  1QIW A;  1EG3 A;  5HKW A;  2BL0 B;  1CFD A;  3I5H B;  4SGB I;  3ZNI A;  1YRT B;  2JUL A;  1OSA A;  4MSP A;  3VRR A;  2LP3 A;  1SCM C;  1ZAC A;  3WNX B;  1TNQ A;  5KU1 A;  2NU1 I;  3F45 A;  1GGW A;  2JOJ A;  5GQQ C;  1BF5 A;  1YUR A;  5AEQ A;  1B7T Z;  1NPQ A;  3I5I B;  1M63 B;  4PAL A;  2CXJ A;  1YR5 A;  4MZL A;  2HPS A;  5J3X A;  4QJ5 B;  3OVO A;  3JVT C;  2G9B A;  2LNK A;  1A75 B;  3DF0 B;  1TBR R;  1DJG A;  2LV7 A;  3AKB A;  4TNC A;  1PVA A;  1U5I B;  2R2I A;  2L5X B;  1Y1A A;  2I7A A;  1DS3 I;  2EC6 C;  1TUR A;  4FQO A;  4YGD B;  2LEO A;  3PM8 A;  1RK9 A;  2N17 A;  1HT9 A;  4PCW A;  1TUS A;  1LA0 A;  2I18 A;  1LXF C;  2M29 A;  3EK4 A;  1S36 A;  2JZI A;  3DVM A;  1UUS A;  4GBA A;  1L2O C;  3NSI A;  2Q4U A;  1MXL C;  4HRH A;  1MQ1 A;  1UHJ A;  3SJS A;  2H61 C;  2PMY A;  3NSL A;  1SW8 A;  1C7W A;  3O2P A;  3PN7 C;  1S6I A;  1X02 A;  1BR1 B;  1M8C A;  5G08 A;  2LCP A;  1DT7 B;  3PFV A;  2WOR A;  2BKI B;  5ER4 X;  1AP4 A;  1SR6 C;  5HKZ A;  2NLN A;  1B7T Y;  1CM1 A;  1SMG A;  3D0Y B;  2K7D A;  1R2U A;  2JXC A;  2JT8 A;  1WRZ A;  4A4B A;  1AUI B;  2JNX A;  3DVK A;  2KMO A;  2ZFD A;  4MLW A;  1V1G A;  4BY4 A;  1F8H A;  2JTT A;  3C1V A;  3OX6 A;  4GGF A;  4NQG A;  1IKU A;  1CFP A;  3BQ3 A;  2KMQ A;  1Y1U A;  1AN1 I;  1YU6 C;  2LHI A;  3SIA A;  5D7F A;  1Q80 A;  4WQ3 A;  2SGF I;  1K9U A;  1DGV A;  2JT0 A;  4ICB A;  4I5N B;  1K8U A;  1G4Y R;  2ZN8 A;  3BYA A;  3OP0 A;  2K7C A;  4AQI A;  1AK8 A;  1TNW A;  1ZMZ A;  2BBN A;  2SGD I;  1C7V A;  1TGS I;  2BCX A;  1AHR A;  1EH2 A;  1WDC B;  2VRG A;  3EVV A;  4C0J A;  1QV0 A;  1A2X A;  1NX2 A;  1NIW A;  4N1G A;  4USL A;  2BCA A;  1CB1 A;  3IQO A;  1QV1 A;  1DJI A;  4GFT A;  4ORB B;  2JC2 A;  1SGD I;  2LAP A;  5AFP A;  3O6B A;  1SGE I;  1RJV A;  1B47 A;  1HQV A;  1M8B A;  1M31 A;  1YX8 A;  3SEK C;  3LL8 B;  1ODB A;  1HPT A;  4NDC A;  2ZRS A;  1KFU L;  1SL9 A;  2O60 A;  4L9M A;  1RRO A;  1PK0 D;  2KNE A;  2LLU A;  1KQM C;  1UHK A;  2K7B A;  1J7Q A;  1CMG A;  1LR8 A;  5DAE A;  2LAN A;  4HRE E;  4DS7 A;  3GK4 X;  2LLS A;  1TOP A;  1SCM B;  2GGZ A;  1JUO A;  4R1E A;  2ARP F;  1A29 A;  4MZK A;  4OKH A;  1YTZ C;  4YBH B;  3VRN A;  2RGI A;  1F54 A;  1SY9 A;  3VRP A;  1CGI I;  4D1E A;  1TBQ R;  1REC A;  5DKR A;  2E6W A;  2G2B A;  3CLN A;  1EG4 A;  1FBV A;  2KBM A;  4OV2 A;  1KK7 Y;  1BR4 B;  1JWD A;  2GGM A;  2MAZ A;  3CS1 A;  2LMV A;  1QIV A;  1KFX S;  5ER5 A;  2F8P A;  2KYC A;  1SGQ I;  1CDN A;  1TNP A;  2KSP A;  1YUS A;  2M3W A;  1YTP A;  1H4B A;  3I5G B;  1CT2 I;  1JSA A;  2KFF A;  4YI9 A;  1CLL A;  2L4I A;  2GKR I;  2SGP I;  2NU0 I;  1B1G A;  5I2L A; 
#chains in the Genus database with same CATH topology
 3AAJ A;  2KOT A;  3UGI A;  1PTQ A;  5DKQ A;  2WCY A;  2ERB A;  1CLB A;  1YVH A;  1EJ3 A;  3CYZ A;  4XYN A;  2BE6 A;  1PRW A;  2AAO A;  1SR6 B;  1LR7 A;  3S0A A;  1PVB A;  2JPT A;  2N71 A;  3GK1 A;  2QEH A;  3LLE A;  5CSJ A;  4ORC B;  1CT4 I;  3ZWH A;  1V1H A;  2KAX A;  4C0K A;  2X3T A;  4N1F A;  1CMF A;  1M45 A;  2M7N A;  5FUY A;  1FW4 A;  5AER A;  2B0U C;  3ICB A;  2H2K A;  2QQC A;  2KMP A;  3JTD C;  3TJQ A;  4JWQ A;  2M5X A;  3HCM A;  3OB1 B;  2B8T A;  2F3Y A;  2BL0 C;  3TS5 C;  2Q91 A;  2ERW A;  1DS2 I;  2K2A A;  4INX A;  5HL1 A;  1BT6 A;  4OR9 B;  3PLF B;  4OVO A;  1CFF A;  3TO7 A;  3SG2 A;  1MHO A;  1IH0 A;  1DF0 B;  2KAY A;  2WCE A;  3EK8 A;  1TOT A;  2RIJ A;  3LK1 A;  1CE3 A;  1DVI A;  4YGC B;  2JWW A;  4DIR A;  2LUC A;  4MN0 A;  1S1E A;  4AOM A;  3FSX A;  3UEY A;  3IQQ A;  1NP8 A;  1LVC D;  4N5X A;  3FIA A;  3BFB A;  3BUO B;  3WHU B;  1E8A A;  1PUL A;  2M9G A;  2NU3 I;  2BUS A;  1UVG A;  1N65 A;  2JXD A;  2LHL A;  2QQ0 A;  2WCF A;  2Y4Q A;  5HLO A;  4MEW A;  4QJ4 B;  3E3R A;  2FCE A;  3BJI A;  4E1P A;  2K2F A;  1CLM A;  3BUW B;  2JZM A;  1UUR A;  4ZCU A;  2COL B;  3UGL A;  2OTG B;  1NCZ A;  1RFH A;  1CFC A;  3OL0 A;  5JHW C;  3AKA A;  2P71 A;  3BOW B;  2KLD A;  3D10 A;  2V53 A;  3CXL A;  4YGE B;  1CHO I;  4M2O A;  1IG5 A;  2GVI A;  1Z7K B;  2JTZ A;  2DKV A;  1F4Q A;  2JXL A;  3VB1 A;  1QLK A;  4PHM A;  5HQ8 A;  4FTG A;  5CSF A;  5HKY A;  2WCM A;  3I5I C;  2RC4 A;  2WND A;  3PJI A;  3IF7 A;  3DD4 A;  3OXG A;  1DC1 A;  1J7O A;  1F70 A;  1B8L A;  2ORW A;  1QVI Z;  1TCO B;  2WCB A;  2LMT A;  2NXQ A;  1F4O A;  1M39 A;  1ALV A;  2JNF A;  2QQD A;  3QTL D;  4PHN A;  3TDU A;  1XFX O;  1C3Z A;  1SNL A;  3BFA A;  3SS3 A;  3AAK A;  1DEK A;  3O78 A;  3BXK A;  5CCM A;  1PCE A;  1MF8 B;  4P5O E;  3CR4 X;  2WCH A;  1SL7 A;  1QAT A;  4MVF A;  1MR8 A;  5JOL A;  1BU3 A;  1QVI Y;  2F33 A;  2V1C C;  1LS8 A;  2E30 A;  4M2Q A;  2KAV A;  2NCO A;  2A20 A;  2KPH A;  2Y1N A;  2YGU A;  5EX0 A;  3TOA A;  1KFU S;  1TNX A;  5FI7 A;  4OZD A;  1V1I A;  2Y1M A;  1TBO A;  5HKW A;  3TO6 A;  3I5H B;  1WGT A;  1ZAC A;  2JOJ A;  1BF5 A;  1M63 B;  2CXJ A;  2QEO A;  3DF0 B;  3D00 A;  2I7A A;  4FQO A;  4YGD B;  3PM8 A;  2N17 A;  2I18 A;  1VDD A;  1UHJ A;  2PMY A;  3O2P A;  1S6I A;  5G08 A;  2LCP A;  2BKI B;  5ER4 X;  5HKZ A;  1R2U A;  2JNX A;  2ZFD A;  3UNW A;  1F8H A;  4GGF A;  1CFP A;  3OX6 A;  1AN1 I;  1P28 A;  3UOE A;  2LHI A;  1DGV A;  2WGC A;  1K8U A;  3BYA A;  2ZN8 A;  2K7C A;  1AK8 A;  1C7V A;  1TGS I;  1AHR A;  1QV0 A;  4USL A;  3EG5 B;  3QWP A;  3IQO A;  5AFP A;  1SGE I;  1RJV A;  1M31 A;  3FE9 A;  4L9M A;  3UEJ A;  3R5A A;  2LLU A;  2K7B A;  1CMG A;  1LR8 A;  1SCM B;  2DB6 A;  4MZK A;  4OKH A;  4YBH B;  2RGI A;  1F54 A;  3VRP A;  1REC A;  5DKR A;  1EG4 A;  1FBV A;  2KBM A;  2GGM A;  2LMV A;  1QIV A;  2F8P A;  2KSP A;  1H4B A;  3I5G B;  3D76 A;  1B1G A;  1SPY A;  2UZ3 A;  5KSZ A;  1S3P A;  1TCF A;  2Y5I A;  1QTX A;  2F2O A;  2BBM A;  1YUU A;  1OOG A;  2TN4 A;  3V2L A;  1OYV I;  1XX6 A;  5AXI A;  4HGU A;  2KMR A;  1CM4 A;  1OZO A;  1XO5 A;  1SGR I;  2CWG A;  2K60 A;  2KBI A;  3SS5 A;  3EVR A;  1MJ9 A;  1IQ5 A;  1ULK A;  3RZS A;  1BLQ A;  2JRF A;  3BUM B;  1YUT A;  3MSE B;  4PE4 A;  2KGR A;  5HLV A;  3R1P A;  1KQM B;  3I5H C;  2GV5 A;  2M8U A;  4GPL B;  3R1O A;  2JQ6 A;  1EXR A;  1A03 A;  3CR5 X;  1N13 A;  2K0J A;  5AAN A;  2N1A B;  1XA6 A;  3CDN A;  1KFX L;  4HRG A;  1Y8F A;  1GJY A;  3D78 A;  2H61 A;  3RLZ A;  2GKV A;  1KCY A;  1B8R A;  1SGY I;  1TIH A;  1QX7 A;  1W7J B;  4YI8 A;  1XK4 C;  3FWC A;  2IS9 A;  5EX3 A;  4CID A;  1SBJ A;  2LUY A;  2J87 A;  2LP2 A;  2PQ8 A;  5E3P A;  4OVN F;  2M1U A;  2OVO A;  1WLZ A;  2ZRT A;  2ZKM X;  3WHT B;  2EC6 B;  1NYA A;  4DRW A;  1UWO A;  1GM0 A;  1QX2 A;  1LA3 A;  2VRW B;  2GKT I;  2CBL A;  2PAS A;  2L51 A;  4MRX A;  2KI6 D;  2PYQ A;  3I5F C;  4OCI A;  4WQ2 A;  1OMR A;  1NUB A;  3GOF A;  1AVS A;  3OXL A;  3RU0 A;  2LVJ A;  3SIB A;  1K95 A;  3N7H A;  1N0Y A;  1IW4 A;  3CTN A;  1ZOT B;  1J1E A;  3PAL A;  1BG1 A;  2L98 A;  2LM5 A;  4GNK B;  1OMV A;  3VRO A;  3KEV A;  1OZS A;  1OOJ A;  4GAO A;  3FC3 A;  3SG3 A;  4A24 A;  1B9A A;  1R0R I;  2ZND A;  3I5G C;  3TDZ A;  2DOQ A;  2BE4 A;  3VRQ A;  4CFR A;  4I5K A;  4GGN A;  1K96 A;  3CZ1 A;  5IBW A;  3GK2 A;  3H4S E;  2K61 A;  3M0W A;  1IIO A;  5B8I B;  1OOI X;  1HEV A;  3A8R A;  1KBE A;  5HI7 A;  1W3S A;  4DUQ A;  1K7T A;  3FE8 A;  3OX5 A;  2D8N A;  1J55 A;  3D77 A;  2LLT A;  1IJ5 A;  2EHB A;  1XFZ O;  2NZ0 A;  1KQV A;  1UHH A;  3BUN B;  3FWB A;  3NXA A;  1KWO B;  1Y6W A;  1LR9 A;  4M2P A;  3R5C A;  2I94 A;  1MUX A;  2PRU A;  4MPI A;  2OS8 B;  1X4S A;  3RM1 A;  3QRX A;  3OB2 B;  1K94 A;  2KYF A;  2M49 B;  2KQY A;  5K89 A;  1L7Z A;  2Y0M A;  1DJX A;  1KSO A;  9WGA A;  3KO0 A;  1QWV A;  1NXU A;  1A75 A;  1IY6 A;  1Y1B A;  3B4V C;  1U5I A;  2WC8 A;  1H0Z A;  2L2C A;  2FCD A;  1JF2 A;  3EKH A;  4HSZ A;  3LK0 A;  2L0P A;  4CPV A;  3QME A;  5FI6 A;  1K9K A;  3DZT A;  2F3C I;  2LMU A;  1B4C A;  3D0Y A;  1EG3 A;  4KYN A;  2JUL A;  2W0T A;  3PM2 A;  3WNX B;  5KU1 A;  2NU1 I;  3F45 A;  5AEQ A;  4MZL A;  2HPS A;  4QJ5 B;  5I94 A;  2CJS C;  2G9B A;  2LNK A;  2CWH A;  3AKB A;  2LV7 A;  1FY7 A;  2R2I A;  2L5X B;  1Y1A A;  1DS3 I;  2EC6 C;  1TUS A;  2M29 A;  3EK4 A;  2JPO A;  3DVM A;  4HRH A;  3SJS A;  1MXL C;  1MQ1 A;  1SW8 A;  1SR6 C;  2NLN A;  1SMG A;  2JT8 A;  3DVK A;  2KMO A;  3C1V A;  3BQ3 A;  1Y1U A;  3SIA A;  5D7F A;  4WQ3 A;  2SGF I;  2JT0 A;  2BBN A;  2BCX A;  1EH2 A;  1WDC B;  2VRG A;  1NIW A;  4N1G A;  1Z4H A;  2BCA A;  1W4R A;  2UVO A;  1QV1 A;  1DJI A;  2WC5 A;  1SGD I;  2L8E A;  4NDC A;  1PK0 D;  1MJB A;  2J9R A;  1UHK A;  1J7Q A;  5DAE A;  4HRE E;  2LLS A;  3PDN A;  1JUO A;  1C3Y A;  1A29 A;  1W9Z A;  1YTZ C;  1SY9 A;  1CGI I;  4D1E A;  1KK7 Y;  1JWD A;  3CS1 A;  1KFX S;  5ER5 A;  2KYC A;  1CT2 I;  4YI9 A;  2WOS A;  2MBX A;  2LB7 A;  1FI6 A;  3L4A A;  1KWO C;  1P9Z A;  1Q9B A;  1FYB A;  1KK8 B;  1SGP I;  2KDH A;  1TTX A;  2OS8 C;  2ZN9 A;  1J7P A;  1S5G Z;  1M46 A;  3B6X A;  5TNC A;  1RTP 1;  2FJY A;  3TZ1 A;  4UPG A;  1JC2 A;  1OQP A;  1WLM A;  2PAL A;  1LIN A;  3TDI A;  1FPW A;  3TUY B;  1ALW A;  1XVJ A;  4F0Z B;  2MHH A;  4FKD A;  3EVU A;  4PDZ A;  1SYM A;  1NCY A;  1N2D A;  3R1V A;  2K8M B;  1K7U A;  1S5G Y;  1GGZ A;  3CWG A;  2JW6 A;  4AQJ A;  1CDM A;  2L2E A;  1ORG A;  5CSI A;  2OTG C;  1S6C A;  2QEB A;  2NU4 I;  1K93 D;  1AJ5 A;  5CPV A;  2L5Y A;  2SGQ I;  2AMI A;  2L4H A;  4I5J A;  3NSO A;  4QJ3 B;  3OGN A;  5D3O A;  1CGJ I;  1WY9 A;  3TOB A;  1JF0 A;  3CGA A;  4AML A;  1D1O A;  2FNF X;  1PPF I;  2YQP A;  1VRK A;  1QX5 B;  2CTN A;  4DCK A;  3EK7 A;  3A4U B;  2F2P A;  4Q04 A;  1OOF A;  4CLN A;  5D69 A;  2BEC A;  4ETO A;  1QXP A;  4PHK A;  2KFG A;  2WC6 A;  2P6A C;  2KGB C;  1FAQ A;  2MLE C;  4DNC A;  1EL4 A;  1AJ4 A;  1JFK A;  1R6P A;  3EKJ A;  1KBF A;  1L2O B;  1NWD A;  1G8I A;  1WDC C;  1FF1 A;  1LKJ A;  2ZNE A;  1UUC A;  1DGU A;  1HDL A;  3BFH A;  3WXA A;  2MRD A;  3E59 A;  3DVE A;  3S0B A;  3TS5 B;  4WRI A;  4YRU A;  1S6J A;  4GGF C;  1DTL A;  3SS4 A;  2M1K B;  1WKX A;  2JYY A;  4MZJ A;  1F71 A;  5I8N A;  2LUX A;  1CT0 I;  1XFY O;  5I2O A;  1KK8 C;  3O4X A;  2M0R A;  3CR2 A;  1NX3 A;  4A4C A;  1W7I B;  1YRU B;  3VDU A;  2CCM A;  1P9G A;  3CAB A;  1GQM A;  1K90 D;  1XYD A;  4JD9 A;  2LVV A;  3B7A A;  3TUY C;  4UXI A;  2CNP A;  2HQ8 A;  2EGD A;  7WGA A;  1WRL A;  1CDL A;  4XJK A;  1CNP A;  1NX1 A;  1S20 A;  3OXF A;  2BCB A;  3R5B A;  4IL1 A;  3HX4 A;  1K2H A;  5FYX A;  2ROW A;  3NHI A;  2ELI A;  1TUJ A;  5DKN A;  1FAR A;  2WVJ A;  1PSR A;  2GIV A;  1RFJ A;  1OOH A;  1MWN A;  2BKH B;  2KI4 B;  1CTR A;  1KSM A;  1PSB A;  1XA5 A;  3SG5 A;  2E5R A;  1PJU A;  4GI3 C;  1MJA A;  3L47 A;  2FOT A;  1ULN A;  4I5L B;  1CFD A;  4SGB I;  3L4L A;  3ZNI A;  3UGD A;  4MSP A;  2LP3 A;  1SCM C;  1TNQ A;  5GQQ C;  3I5I B;  3UO9 A;  5J3X A;  3OVO A;  5FUW A;  1A75 B;  1DJG A;  1U5I B;  1TUR A;  2ENZ A;  1XFR A;  1HT9 A;  2K9H A;  2ENN A;  1S36 A;  1UUS A;  1UHA A;  1L2O C;  2H61 C;  3NSL A;  1DT7 B;  1AP4 A;  3D0Y B;  5CCL A;  2JXC A;  1WRZ A;  1AUI B;  1V1G A;  2JTT A;  1IKU A;  2KMQ A;  1YU6 C;  1DEL A;  1Q80 A;  1G4Y R;  3OP0 A;  1ZMZ A;  2SGD I;  1U5K A;  4C0J A;  4F7F A;  4GFT A;  2JC2 A;  2LAP A;  1M8B A;  3SEK C;  3LL8 B;  1ODB A;  1HPT A;  2ZRS A;  3S0E A;  1SL9 A;  2O60 A;  1RRO A;  2KNE A;  1KQM C;  4UXJ A;  3S0G A;  2ARP F;  3VRN A;  1TBQ R;  2QEV A;  3CLN A;  4OV2 A;  1TNP A;  1YUS A;  3DYE A;  1WGC A;  2KFF A;  1CLL A;  2GKR I;  2SGP I;  3IVT A;  1BJF A;  3R72 A;  2LVI A;  5E3Q A;  1QAS A;  1SL8 A;  1IY5 A;  1DJH A;  2KCX A;  4FQT A;  1SKT A;  2P70 A;  2QAC A;  1BOD A;  3GOX A;  2E73 A;  1G33 A;  3DY9 A;  4JQ0 D;  1DJZ A;  1MXE A;  2QPT A;  1K7V A;  1NSH A;  1ZUZ A;  3SG4 A;  2LC5 A;  3KF9 A;  3D75 A;  1F55 A;  2V1C A;  1JBA A;  1DJY A;  5HYD A;  3B87 A;  1J1D A;  2WCJ A;  2JT3 A;  3R5D A;  4UXH A;  3DVJ A;  4IJ7 A;  2O5G A;  2I2R E;  2OU2 A;  1OMD A;  1DF0 A;  2KI4 C;  5E3R A;  3HH2 C;  4BY5 A;  1JFJ A;  1PTR A;  3FE6 A;  2NU2 I;  2M7L A;  2OD1 A;  2HQW A;  2OZU A;  2OPO A;  1OMT A;  3FS7 A;  2JU0 A;  5J8C A;  1R79 A;  2JA1 A;  2K7O A;  1C07 A;  3KPX A;  3SG7 A;  2HET A;  2BAP A;  2KI6 C;  1KK7 Z;  2XRC A;  4ORA B;  4PHJ A;  2SCP A;  2X52 A;  4C0L A;  2SAS A;  3K21 A;  1X74 A;  5PAL A;  1S26 D;  2ODD A;  1BOC A;  3TO9 A;  2QQE A;  4MBE A;  5FI2 A;  1SCV A;  4P2Y B;  5KTY A;  2WCK A;  1QS7 A;  1TN4 A;  2KLE A;  2HF5 A;  5FUX A;  4MRY A;  2LVK A;  4B6D A;  4NDD A;  2MA2 A;  1IQ3 A;  3OBV A;  1IGV A;  1OMU A;  3S0D A;  3D73 A;  3NSK A;  3JVT B;  2P6B B;  1HJA I;  3D74 A;  1UP5 A;  1RWY A;  1IWQ A;  5FUV A;  1KMA A;  4JPZ B;  1ULM A;  2NCP A;  4CFQ A;  3BOW A;  2LE9 B;  4PE7 A;  2KFH A;  2B1U A;  1K9P A;  4PE0 A;  3DXL A;  3PN7 B;  1FI5 A;  5J8F A;  4PE1 A;  3VDP A;  2QPO A;  2N52 A;  3SGB I;  1A4P A;  4E68 A;  1SRA A;  3K1E A;  3OHM B;  1SGN I;  2MLF C;  1CDP A;  2H8V A;  1TWO A;  2YUU A;  1XFU O;  3PSR A;  1T14 A;  5JJG A;  2SGE I;  2F3Z A;  2MJW B;  1TRF A;  1WTJ A;  2KHN A;  1H8B A;  1BMO A;  3PAT A;  4E1R A;  2BNX A;  1OVO A;  1B8C A;  1OE9 B;  1CKK A;  1QLS A;  5BPJ A;  2KQ6 A;  4GUK A;  1XFW O;  2WCL A;  3O4Y A;  1ZFS A;  3QAH A;  5EL2 A;  4NDB A;  4INW A;  1MT1 A;  3S0F A;  1BUS A;  1IRJ A;  2L50 A;  4ZCV A;  5I2Q A;  4U8D A;  3SGQ I;  2PSR A;  2PQL A;  1Z2C B;  3FSY A;  1WRK A;  2AUC A;  1IJ6 A;  4YGB B;  3LCP C;  3CZT X;  1DMO A;  1J7R A;  1UHI A;  1QJT A;  1Y1C A;  5F6T A;  3BUX B;  1TIZ A;  1YX7 A;  3KHE A;  1XFV O;  1DQE A;  4YGA A;  3I5F B;  2QDI A;  2CWF A;  5CSN A;  2FJU B;  3VGO A;  3NHT A;  1CSO I;  1TUZ A;  2PVB A;  3DF0 A;  1NCX A;  2A4J A;  1Y0V H;  1UVF A;  1Y1X A;  1UHN A;  1NX0 A;  1SK6 D;  1V1F A;  1YVL A;  3JTD B;  1PAL A;  1DJW A;  1XK4 A;  2ISD A;  2CT9 A;  3SG6 A;  4XJK B;  2M97 A;  1QIW A;  3NGV A;  2BL0 B;  3Q8I A;  1YRT B;  1OSA A;  3B86 A;  3VRR A;  1GGW A;  1YUR A;  1B7T Z;  1NPQ A;  3E2I A;  3MEK A;  4PAL A;  1YR5 A;  2ORV A;  4JCV E;  3JVT C;  3BJH A;  1TBR R;  4TNC A;  1PVA A;  3UFF A;  2LEO A;  1RK9 A;  4PCW A;  1LA0 A;  1LXF C;  2JZI A;  4GBA A;  3NSI A;  2Q4U A;  1C7W A;  3PN7 C;  1X02 A;  1BR1 B;  1M8C A;  3CZ0 A;  3PFV A;  2WOR A;  4PT1 A;  5DIC A;  1B7T Y;  1CM1 A;  2L7X A;  2K7D A;  4A4B A;  4MLW A;  4BY4 A;  4NQG A;  3B88 A;  1Z2I A;  1K9U A;  4ICB A;  4I5N B;  4AQI A;  3KY9 A;  1TNW A;  2GTE A;  3EVV A;  1A2X A;  1NX2 A;  1CB1 A;  4ORB B;  3O6B A;  1B47 A;  1HQV A;  1YX8 A;  1XBT A;  1KFU L;  3VE5 A;  2LAN A;  4DS7 A;  3GK4 X;  4WP4 A;  1TOP A;  2GGZ A;  1TBN A;  4R1E A;  4JKT A;  2E6W A;  2G2B A;  1BR4 B;  1OW4 A;  1SSE B;  2MAZ A;  1SGQ I;  2DIP A;  1CDN A;  2M3W A;  1YTP A;  3CZ2 A;  1JSA A;  2L4I A;  2NU0 I;  5I2L A; 
#chains in the Genus database with same CATH homology
 2WOS A;  1SPY A;  3AAJ A;  2MBX A;  1BJF A;  2KOT A;  2LVI A;  3UGI A;  1PTQ A;  5DKQ A;  2UZ3 A;  2WCY A;  1CLB A;  1QAS A;  1YVH A;  1FI6 A;  1EJ3 A;  1KWO C;  1FYB A;  4XYN A;  1SL8 A;  2BE6 A;  5KSZ A;  1KK8 B;  1IY5 A;  1S3P A;  1DJH A;  1SGP I;  1TCF A;  2KCX A;  2Y5I A;  2KDH A;  1SKT A;  2QAC A;  1BOD A;  1QTX A;  3GOX A;  2E73 A;  1G33 A;  1TTX A;  2F2O A;  2BBM A;  1YUU A;  4JQ0 D;  1PRW A;  2OS8 C;  2AAO A;  1DJZ A;  1MXE A;  2QPT A;  1SR6 B;  2ZN9 A;  1NSH A;  1J7P A;  2TN4 A;  1S5G Z;  1LR7 A;  1M46 A;  1PVB A;  1ZUZ A;  2JPT A;  2N71 A;  3GK1 A;  1RTP 1;  5TNC A;  3SG4 A;  3TZ1 A;  2LC5 A;  1OYV I;  4UPG A;  3KF9 A;  1F55 A;  1JC2 A;  1OQP A;  1WLM A;  2V1C A;  3LLE A;  2PAL A;  1LIN A;  1XX6 A;  5CSJ A;  3TDI A;  1JBA A;  1DJY A;  4ORC B;  5AXI A;  1CT4 I;  5HYD A;  3ZWH A;  1FPW A;  1CM4 A;  3TUY B;  1OZO A;  1XO5 A;  1ALW A;  1XVJ A;  4F0Z B;  1SGR I;  1V1H A;  4HGU A;  2MHH A;  2KAX A;  1J1D A;  4FKD A;  4C0K A;  2JT3 A;  4N1F A;  2KBI A;  1CMF A;  4UXH A;  3DVJ A;  3EVU A;  2O5G A;  4PDZ A;  3EVR A;  2I2R E;  1M45 A;  2M7N A;  1OMD A;  1DF0 A;  1SYM A;  2KI4 C;  5FUY A;  1FW4 A;  5AER A;  1IQ5 A;  2B0U C;  1BLQ A;  3ICB A;  2H2K A;  2JRF A;  3BUM B;  1NCY A;  1N2D A;  1YUT A;  2QQC A;  3HH2 C;  2KMP A;  4BY5 A;  1JFJ A;  1PTR A;  2K8M B;  3JTD C;  3MSE B;  4PE4 A;  2NU2 I;  2M7L A;  2OD1 A;  2KGR A;  2HQW A;  5HLV A;  1S5G Y;  3TJQ A;  2OPO A;  1GGZ A;  4JWQ A;  1OMT A;  1KQM B;  3CWG A;  2JW6 A;  2M5X A;  3FS7 A;  2JU0 A;  3HCM A;  4AQJ A;  1CDM A;  2L2E A;  3OB1 B;  2B8T A;  5CSI A;  2F3Y A;  2BL0 C;  3I5H C;  1R79 A;  2OTG C;  3TS5 C;  2Q91 A;  2GV5 A;  2M8U A;  1S6C A;  2ERW A;  4GPL B;  2K7O A;  2JA1 A;  1C07 A;  3KPX A;  3SG7 A;  2NU4 I;  1K93 D;  1DS2 I;  1AJ5 A;  2JQ6 A;  2K2A A;  5CPV A;  1EXR A;  2HET A;  1BT6 A;  2KI6 C;  1KK7 Z;  1A03 A;  2SGQ I;  2AMI A;  2L4H A;  3CR5 X;  4I5J A;  3PLF B;  4OR9 B;  2XRC A;  3NSO A;  1CFF A;  4OVO A;  4ORA B;  4PHJ A;  4QJ3 B;  1N13 A;  2SCP A;  2K0J A;  5AAN A;  3SG2 A;  1CGJ I;  1WY9 A;  2N1A B;  1JF0 A;  4C0L A;  1XA6 A;  1MHO A;  2SAS A;  1KFX L;  3K21 A;  3CGA A;  4HRG A;  1X74 A;  1Y8F A;  1IH0 A;  1GJY A;  1D1O A;  2FNF X;  5PAL A;  1PPF I;  1S26 D;  1DF0 B;  2KAY A;  1VRK A;  1BOC A;  2ODD A;  2YQP A;  1QX5 B;  2QQE A;  2WCE A;  3EK8 A;  1TOT A;  2CTN A;  2H61 A;  3RLZ A;  4DCK A;  4MBE A;  3EK7 A;  1SCV A;  2GKV A;  3LK1 A;  3A4U B;  4P2Y B;  2F2P A;  5KTY A;  1B8R A;  4Q04 A;  1KCY A;  1SGY I;  1QS7 A;  1TN4 A;  1TIH A;  1CE3 A;  1QX7 A;  1DVI A;  1W7J B;  2HF5 A;  4YI8 A;  4MRY A;  4YGC B;  5FUX A;  1XK4 C;  2JWW A;  2LVK A;  3FWC A;  4B6D A;  4NDD A;  2MA2 A;  4DIR A;  1IQ3 A;  2IS9 A;  5EX3 A;  2LUC A;  4CID A;  4CLN A;  4MN0 A;  1S1E A;  1SBJ A;  4AOM A;  5D69 A;  2LUY A;  2J87 A;  2BEC A;  3UEY A;  2LP2 A;  4ETO A;  3IQQ A;  1NP8 A;  1QXP A;  1LVC D;  4N5X A;  1IGV A;  3FIA A;  4PHK A;  1OMU A;  2KFG A;  3BUO B;  2P6A C;  3NSK A;  3WHU B;  3JVT B;  4OVN F;  1E8A A;  2KGB C;  2P6B B;  1PUL A;  2M1U A;  2OVO A;  1FAQ A;  1WLZ A;  2ZRT A;  2MLE C;  1HJA I;  1EL4 A;  2ZKM X;  3WHT B;  1UP5 A;  2M9G A;  1AJ4 A;  2EC6 B;  2NU3 I;  1RWY A;  1IWQ A;  2BUS A;  1UVG A;  5FUV A;  1NYA A;  4DRW A;  1UWO A;  1KMA A;  1N65 A;  1JFK A;  4JPZ B;  2JXD A;  2LHL A;  2NCP A;  4CFQ A;  3BOW A;  1R6P A;  2LE9 B;  4PE7 A;  1QX2 A;  2KFH A;  2QQ0 A;  3EKJ A;  1LA3 A;  2WCF A;  2B1U A;  1KBF A;  1K9P A;  1L2O B;  2Y4Q A;  1NWD A;  5HLO A;  1G8I A;  2VRW B;  4MEW A;  2GKT I;  2CBL A;  2PAS A;  2L51 A;  4MRX A;  2KMR A;  2KI6 D;  4PE0 A;  1WDC C;  3PN7 B;  4QJ4 B;  3E3R A;  2FCE A;  3BJI A;  1FI5 A;  1FF1 A;  1LKJ A;  4PE1 A;  3VDP A;  2ZNE A;  2QPO A;  4E1P A;  2K2F A;  2N52 A;  3SGB I;  1A4P A;  3I5F C;  1UUC A;  1DGU A;  4OCI A;  4WQ2 A;  1SRA A;  4E68 A;  1HDL A;  1OMR A;  1NUB A;  3GOF A;  1CLM A;  3BUW B;  3OHM B;  3WXA A;  2JZM A;  1SGN I;  2MRD A;  1AVS A;  3OXL A;  3RU0 A;  1UUR A;  2MLF C;  1CDP A;  4ZCU A;  3E59 A;  2COL B;  2LVJ A;  3DVE A;  3UGL A;  3SIB A;  2OTG B;  1K95 A;  4WRI A;  1N0Y A;  1NCZ A;  3TS5 B;  1RFH A;  1IW4 A;  1CFC A;  3OL0 A;  3CTN A;  4YRU A;  2YUU A;  1ZOT B;  1J1E A;  1S6J A;  3PAL A;  1BG1 A;  5JHW C;  2L98 A;  1XFU O;  3AKA A;  4GGF C;  3PSR A;  2LM5 A;  4GNK B;  1DTL A;  1OMV A;  2M1K B;  3VRO A;  3KEV A;  5JJG A;  1OZS A;  1OOJ A;  2SGE I;  4GAO A;  2JYY A;  2F3Z A;  3FC3 A;  2MJW B;  3BOW B;  3SG3 A;  4MZJ A;  4A24 A;  1F71 A;  1B9A A;  1TRF A;  5I8N A;  2KHN A;  2LUX A;  3D10 A;  1CT0 I;  1R0R I;  1H8B A;  1XFY O;  1BMO A;  2V53 A;  2ZND A;  3I5G C;  3PAT A;  4E1R A;  1OVO A;  3CXL A;  1B8C A;  3TDZ A;  1OE9 B;  4YGE B;  1CHO I;  2DOQ A;  2BE4 A;  3VRQ A;  5I2O A;  4CFR A;  4I5K A;  1CKK A;  4GGN A;  4M2O A;  1IG5 A;  2GVI A;  1QLS A;  1K96 A;  1Z7K B;  5BPJ A;  2KQ6 A;  4GUK A;  1XFW O;  2JTZ A;  1KK8 C;  2M0R A;  5IBW A;  3GK2 A;  1F4Q A;  2JXL A;  3CR2 A;  3H4S E;  2K61 A;  3M0W A;  1NX3 A;  4A4C A;  3O4Y A;  5B8I B;  1QLK A;  1ZFS A;  1W7I B;  4PHM A;  5HQ8 A;  3A8R A;  4FTG A;  1KBE A;  4NDB A;  1YRU B;  5CSF A;  5HKY A;  4DUQ A;  1MT1 A;  1W3S A;  3I5I C;  5HI7 A;  3OX5 A;  2WND A;  2D8N A;  3VDU A;  1BUS A;  1IRJ A;  2L50 A;  2CCM A;  1J55 A;  3IF7 A;  3DD4 A;  2LLT A;  1IJ5 A;  4ZCV A;  5I2Q A;  2EHB A;  4U8D A;  3SGQ I;  1XFZ O;  2PSR A;  3OXG A;  1J7O A;  1WRK A;  1GQM A;  2AUC A;  1K90 D;  2NZ0 A;  1XYD A;  1F70 A;  1IJ6 A;  4YGB B;  3LCP C;  1KQV A;  3CZT X;  1UHH A;  1DMO A;  2LVV A;  1B8L A;  3TUY C;  1J7R A;  3BUN B;  1UHI A;  3FWB A;  2ORW A;  3NXA A;  4UXI A;  1QVI Z;  1TCO B;  1QJT A;  2WCB A;  1KWO B;  1Y1C A;  5F6T A;  2CNP A;  1Y6W A;  2HQ8 A;  2LMT A;  3BUX B;  2NXQ A;  1LR9 A;  4M2P A;  2EGD A;  1TIZ A;  2I94 A;  1F4O A;  1M39 A;  1ALV A;  1MUX A;  1YX7 A;  2JNF A;  2PRU A;  3KHE A;  2QQD A;  3QTL D;  1XFV O;  4PHN A;  3TDU A;  1WRL A;  1XFX O;  2OS8 B;  1CDL A;  1X4S A;  1SNL A;  3RM1 A;  3QRX A;  4XJK A;  3AAK A;  3I5F B;  3OB2 B;  4YGA A;  1CNP A;  1K94 A;  3O78 A;  1NX1 A;  3BXK A;  5CCM A;  2KYF A;  1PCE A;  2M49 B;  3OXF A;  1MF8 B;  2KQY A;  2BCB A;  5K89 A;  5CSN A;  4IL1 A;  1L7Z A;  2FJU B;  4P5O E;  3HX4 A;  3VGO A;  1DJX A;  1KSO A;  1K2H A;  3KO0 A;  3CR4 X;  5FYX A;  2ROW A;  2ELI A;  1SL7 A;  1QAT A;  4MVF A;  1CSO I;  1MR8 A;  5DKN A;  1FAR A;  2WVJ A;  5JOL A;  1PSR A;  2PVB A;  1A75 A;  3DF0 A;  1IY6 A;  1BU3 A;  1NCX A;  1Y1B A;  3B4V C;  1U5I A;  2WC8 A;  1QVI Y;  1RFJ A;  2A4J A;  2F33 A;  2V1C C;  1H0Z A;  1MWN A;  1Y0V H;  2FCD A;  2BKH B;  2E30 A;  2KI4 B;  4M2Q A;  1JF2 A;  1UVF A;  1CTR A;  1Y1X A;  1UHN A;  1KSM A;  1PSB A;  1XA5 A;  2KAV A;  3SG5 A;  2NCO A;  2A20 A;  3EKH A;  1NX0 A;  2E5R A;  1SK6 D;  4HSZ A;  3LK0 A;  2L0P A;  1V1F A;  4CPV A;  1YVL A;  3JTD B;  1PAL A;  1DJW A;  1PJU A;  4GI3 C;  2Y1N A;  5EX0 A;  1XK4 A;  2ISD A;  1K9K A;  1KFU S;  2F3C I;  2CT9 A;  1TNX A;  3SG6 A;  1V1I A;  4XJK B;  2FOT A;  2Y1M A;  2M97 A;  2LMU A;  4I5L B;  1B4C A;  3D0Y A;  1QIW A;  1EG3 A;  1TBO A;  5HKW A;  2BL0 B;  1CFD A;  3I5H B;  4SGB I;  3ZNI A;  3UGD A;  1YRT B;  2JUL A;  1OSA A;  4MSP A;  2W0T A;  3VRR A;  2LP3 A;  1SCM C;  1ZAC A;  3WNX B;  1TNQ A;  5KU1 A;  2NU1 I;  3F45 A;  1GGW A;  2JOJ A;  5GQQ C;  1BF5 A;  1YUR A;  5AEQ A;  1B7T Z;  1NPQ A;  3I5I B;  1M63 B;  3E2I A;  3MEK A;  4PAL A;  2CXJ A;  1YR5 A;  4MZL A;  2ORV A;  2HPS A;  5J3X A;  4QJ5 B;  3OVO A;  4JCV E;  2CJS C;  3JVT C;  2G9B A;  2LNK A;  5FUW A;  1A75 B;  3DF0 B;  1TBR R;  1DJG A;  2LV7 A;  3AKB A;  4TNC A;  1PVA A;  3D00 A;  1U5I B;  2R2I A;  2L5X B;  1Y1A A;  2I7A A;  1DS3 I;  2EC6 C;  1TUR A;  3UFF A;  4FQO A;  4YGD B;  2ENZ A;  2LEO A;  3PM8 A;  1RK9 A;  2N17 A;  1HT9 A;  4PCW A;  1TUS A;  1LA0 A;  2K9H A;  2I18 A;  2ENN A;  1LXF C;  2M29 A;  3EK4 A;  1S36 A;  2JZI A;  1VDD A;  3DVM A;  1UUS A;  4GBA A;  1L2O C;  3NSI A;  2Q4U A;  1MXL C;  4HRH A;  1MQ1 A;  1UHJ A;  3SJS A;  2H61 C;  2PMY A;  3NSL A;  1SW8 A;  1C7W A;  3O2P A;  3PN7 C;  1S6I A;  1X02 A;  1BR1 B;  1M8C A;  5G08 A;  2LCP A;  1DT7 B;  3PFV A;  2WOR A;  2BKI B;  5ER4 X;  1AP4 A;  1SR6 C;  5HKZ A;  2NLN A;  1B7T Y;  1CM1 A;  1SMG A;  3D0Y B;  5CCL A;  2L7X A;  2K7D A;  1R2U A;  2JXC A;  2JT8 A;  1WRZ A;  4A4B A;  1AUI B;  2JNX A;  3DVK A;  2KMO A;  2ZFD A;  4MLW A;  1V1G A;  4BY4 A;  1F8H A;  2JTT A;  3C1V A;  3OX6 A;  4GGF A;  4NQG A;  1IKU A;  1CFP A;  3BQ3 A;  2KMQ A;  1Y1U A;  1AN1 I;  1YU6 C;  2LHI A;  3SIA A;  5D7F A;  1Q80 A;  4WQ3 A;  2SGF I;  1K9U A;  1DGV A;  2JT0 A;  4ICB A;  4I5N B;  1K8U A;  1G4Y R;  2ZN8 A;  3BYA A;  3OP0 A;  2K7C A;  4AQI A;  1AK8 A;  1TNW A;  1ZMZ A;  3KY9 A;  2BBN A;  2SGD I;  1C7V A;  1TGS I;  2BCX A;  1AHR A;  1U5K A;  1EH2 A;  1WDC B;  2VRG A;  3EVV A;  4C0J A;  1QV0 A;  1A2X A;  1NX2 A;  1NIW A;  4N1G A;  4USL A;  2BCA A;  1CB1 A;  1W4R A;  3QWP A;  3IQO A;  1QV1 A;  1DJI A;  4GFT A;  4ORB B;  2JC2 A;  1SGD I;  2LAP A;  5AFP A;  3O6B A;  1SGE I;  2L8E A;  1RJV A;  1B47 A;  1HQV A;  1M8B A;  1M31 A;  1YX8 A;  3SEK C;  3LL8 B;  1ODB A;  1HPT A;  4NDC A;  1XBT A;  2ZRS A;  1KFU L;  3VE5 A;  1SL9 A;  2O60 A;  4L9M A;  1RRO A;  3UEJ A;  1PK0 D;  2KNE A;  2LLU A;  2J9R A;  1KQM C;  1UHK A;  2K7B A;  1J7Q A;  1CMG A;  1LR8 A;  5DAE A;  2LAN A;  4HRE E;  4DS7 A;  3GK4 X;  2LLS A;  3PDN A;  4UXJ A;  1TOP A;  1SCM B;  2GGZ A;  1TBN A;  1JUO A;  4R1E A;  2ARP F;  1A29 A;  4MZK A;  4OKH A;  2DB6 A;  1YTZ C;  4YBH B;  3VRN A;  2RGI A;  1F54 A;  1SY9 A;  3VRP A;  1CGI I;  4D1E A;  1TBQ R;  1REC A;  5DKR A;  2E6W A;  2G2B A;  3CLN A;  1EG4 A;  1FBV A;  2KBM A;  4OV2 A;  1KK7 Y;  1BR4 B;  1JWD A;  2GGM A;  2MAZ A;  3CS1 A;  2LMV A;  1QIV A;  1KFX S;  5ER5 A;  2F8P A;  2KYC A;  1SGQ I;  2DIP A;  1CDN A;  1TNP A;  2KSP A;  1YUS A;  2M3W A;  1YTP A;  1H4B A;  3I5G B;  1CT2 I;  1JSA A;  2KFF A;  4YI9 A;  1CLL A;  2L4I A;  2GKR I;  2SGP I;  2NU0 I;  1B1G A;  5I2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...