1NUBA

Helix c deletion mutant of bm-40 fs-ec domain pair
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
226
structure length
226
Chain Sequence
APCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Extracellular module
molecule keywords BASEMENT MEMBRANE PROTEIN BM-40
publication title Crystal structure and mapping by site-directed mutagenesis of the collagen-binding epitope of an activated form of BM-40/SPARC/osteonectin.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
A PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nubA02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1nubA01
1V1FA 3BYAA 4JQ0D 1ALVA 3BUWB 3CZTX 2O5GA 2MRDA 2WCBA 3CR5X 1YUTA 2F3YA 2F3CI 1CE3A 1A4PA 1XK4C 3QRXA 1C07A 4YGBB 1SR6C 1B8LA 3NSOA 1N13A 1S6JA 2MLEC 2PVBA 1DJIA 1OQPA 2CTNA 4QJ5B 1R6PA 1EJ3A 5GQQC 1J7PA 1F4OA 5IBWA 1DF0B 4PE4A 1S1EA 2JXLA 1NYAA 2BL0C 3HH2C 2HF5A 1EXRA 4I5KA 2KFFA 1IJ6A 2LMUA 1OMDA 1K94A 2SGPI 4GAOA 1CFFA 1Z7KB 4PHNA 3KEVA 2H2KA 1M39A 2JRFA 2WORA 1QV0A 4I5NB 3DD4A 1YU6C 2I94A 2I2RE 1MHOA 2HETA 2EC6C 2GKRI 4CFRA 2NU3I 1UHNA 1SMGA 1TCFA 4L9MA 4GUKA 1PSRA 5ER5A 1DS3I 1QLKA 3ZWHA 5I2QA 1NIWA 2Y4QA 4FQOA 2I7AA 3LL8B 3SEKC 1N65A 1IY6A 1NWDA 1M8CA 3GK2A 2KNEA 2LM5A 2KDHA 1C7VA 2B0UC 1YTPA 1YUSA 4C0LA 1CLBA 1EL4A 3PALA 1FW4A 1XA5A 1YR5A 1UHJA 4PALA 2JYYA 3H4SE 1XFVO 4GNKB 1QLSA 1W7JB 1UUCA 2JQ6A 3K21A 4XJKB 4YGAA 1TNQA 3NXAA 1AJ4A 2O60A 1B7TY 3VROA 2MJWB 2LVKA 2G2BA 3GK1A 1K2HA 1G33A 1QVIZ 2KQ6A 2LANA 1AVSA 1UURA 2WOSA 3DVMA 1L7ZA 2MBXA 1OMVA 4YGDB 2FJUB 1CM4A 3AKBA 4OVNF 3OB1B 3VRRA 2JNXA 3CTNA 3LCPC 2EHBA 2JXDA 1BF5A 2WNDA 2Y1NA 3A8RA 3FS7A 1SBJA 3SGQI 3RM1A 1DTLA 1CGII 4HRGA 1K95A 1SGRI 5FYXA 2L5XB 1YTZC 2HQ8A 3OVOA 5I8NA 2AAOA 3BOWB 2KI6C 1H8BA 1PPFI 1TIHA 1OVOA 1BR4B 4JWQA 1CFDA 1EG3A 5D69A 4AQIA 1FF1A 2ZNDA 2JU0A 2Y1MA 1BU3A 2PRUA 4OV2A 1WLZA 1X02A 2K7OA 2JZIA 2MAZA 1IGVA 2BUSA 2M7NA 1KK7Z 2CT9A 2ERWA 3GOFA 1HPTA 2ZRSA 1A29A 2M1UA 1TN4A 1RFJA 4USLA 1F4QA 1KFUL 2QPTA 4MLWA 1L2OB 3NSKA 2NLNA 1B8CA 3PLFB 1K8UA 3TUYB 1HJAI 5HYDA 4C0KA 1TCOB 4MEWA 4YBHB 3VRPA 1CDPA 1BLQA 1MXEA 2K0JA 3AAKA 1TGSI 1IRJA 3RLZA 1KCYA 1OMUA 1IJ5A 1B8RA 1OZOA 1DT7B 1MUXA 2OVOA 2AUCA 1TURA 1U5IA 3AKAA 1CNPA 1EH2A 1OMRA 3I5IB 3OB2B 2M3WA 3M0WA 1QX2A 1JF0A 1UP5A 2WC8A 1A75A 1QXPA 1AUIB 2OTGB 2QQDA 1CT0I 2IS9A 4N1FA 1PULA 4FTGA 2JULA 3BUXB 4MRXA 2KAVA 1NCXA 2BE6A 2KGRA 1SGQI 1A2XA 2FCDA 4GPLB 1IKUA 1QX7A 2COLB 1CFPA 3HCMA 3DF0A 1DVIA 5AXIA 2HPSA 2MHHA 1W7IB 2E30A 2KMOA 3KPXA 1EG4A 1LINA 3C1VA 2SGFI 1CTRA 1N0YA 2LVJA 4MN0A 2WCEA 1S3PA 1UVFA 1QASA 3EK8A 3FIAA 5CPVA 4GFTA 1CDMA 2LHLA 1L2OC 3TUYC 2L50A 3IF7A 5JOLA 4D1EA 3SGBI 2ZFDA 1J1DA 1XYDA 2M8UA 5KU1A 1M8BA 1ZMZA 4HSZA 2M5XA 2SGEI 1AN1I 2ZRTA 1DMOA 3I5IC 2K7BA 2KYCA 1M45A 4NDCA 1NX2A 4MBEA 4ZCVA 1K90D 2K7DA 1ZACA 2OTGC 5BPJA 1YVHA 1NCZA 1Y0VH 2R2IA 1BJFA 1ZUZA 5HKZA 1TIZA 4TNCA 1YX7A 1MR8A 2LE9B 4N5XA 1CHOI 2EGDA 4IL1A 4BY5A 2BE4A 2LCPA 3TDUA 1OZSA 4DCKA 1G8IA 2LMTA 1CMFA 1CM1A 2CBLA 1JWDA 1SGYI 4WQ2A 1BUSA 1DJXA 1JUOA 1M46A 3LK0A 3SIBA 1XVJA 2LLTA 1DGVA 1E8AA 1S26D 3CGAA 1FI6A 4GGFC 2KMRA 2I18A 2SASA 3BXKA 2NU1I 2H61C 4CFQA 1PRWA 1SY9A 1NCYA 2KFGA 3SJSA 4YGCB 4C0JA 4XYNA 4YGEB 1CLLA 1MQ1A 3OX6A 2CNPA 1F70A 1BG1A 2Y5IA 4YI8A 2MLFC 1QIWA 1LKJA 2Q4UA 4ICBA 2JC2A 5F6TA 2LV7A 2LHIA 4R1EA 5D7FA 5HLVA 4SGBI 1Y1BA 1PK0D 2KBIA 3CWGA 1IQ3A 1FYBA 1KFUS 2KQYA 1CDNA 2NCPA 5CSIA 2GKVA 3JTDB 1K96A 3TZ1A 2SGQI 1CT4I 4M2OA 2OPOA 4DS7A 1SNLA 1XK4A 2KMPA 2KFHA 2PMYA 1YVLA 3DVEA 2M29A 2F2PA 2KOTA 3TDIA 4HRHA 2NCOA 2N71A 1NX0A 2LUXA 1KMAA 1CKKA 3BQ3A 4GI3C 2OS8B 1CB1A 1KK8B 4GBAA 3IQQA 1RWYA 1B7TZ 1J7QA 5TNCA 2G9BA 4YRUA 1DGUA 3OX5A 1YRTB 2V53A 1KK7Y 2JNFA 1SCVA 4MZKA 4DRWA 2JZMA 4PDZA 4DIRA 2JT8A 1PVAA 1R2UA 2LMVA 1SGDI 3NSLA 1SRAA 1UVGA 3KHEA 4AOMA 1JFKA 1PVBA 1XFYO 2M7LA 3TDZA 1K9PA 4QJ4B 2L98A 3DVKA 1NSHA 2FOTA 1OYVI 3SG7A 2JT3A 1BOCA 1NX3A 1TRFA 5G08A 2LP2A 1F54A 1QX5B 5JHWC 1JFJA 4HREE 2NU0I 3PATA 3O78A 1CMGA 1J7RA 2HQWA 1J1EA 3D0YA 1S5GY 1TTXA 3KO0A 3JTDC 5AFPA 2KSPA 2ARPF 1OSAA 1LA3A 1ZOTB 2KAYA 2P6BB 4P5OE 1OOJA 1PALA 2LUCA 1NPQA 1FBVA 3TS5B 3HX4A 3JVTB 1CLMA 1C7WA 2BCBA 2OS8C 1TUSA 1S36A 1AJ5A 1S6IA 1H4BA 1KK8C 5PALA 1K9UA 2F2OA 1MWNA 3GK4X 1RK9A 1WY9A 2GKTI 4ORAB 3FWCA 1DF0A 1XO5A 1JBAA 1SCMB 2FCEA 4MZJA 2CXJA 2SCPA 3EKHA 5ER4X 2K2AA 2F3ZA 3EK4A 4M2QA 1R0RI 3TJQA 1WRZA 1OMTA 4OVOA 1DJZA 1GGWA 4MSPA 1RJVA 1HDLA 4ETOA 1QTXA 2D8NA 4HGUA 2BKHB 2BECA 1FPWA 4CLNA 4MVFA 1UHHA 3LK1A 5KSZA 5HKWA 5I2OA 4PHKA 1FI5A 2PASA 1G4YR 3ZNIA 4I5LB 4WRIA 1K9KA 1QV1A 1PSBA 2M1KB 1J7OA 5KTYA 5J3XA 1UHKA 4Q04A 1IWQA 1KQMB 1XFXO 3WHUB 1ZFSA 1U5IB 2A4JA 2LVIA 4MZLA 2N52A 2B1UA 1Y6WA 1D1OA 1DJHA 1KQVA 1SGPI 1B9AA 3PFVA 3JVTC 3TS5C 1A75B 1XFWO 1B1GA 3IQOA 4NQGA 2QQCA 1ODBA 1V1GA 2KBMA 2JT0A 3SG6A 2JXCA 1YX8A 2KAXA 1TBRR 2WCFA 3VRQA 1JF2A 5DKRA 4I5JA 2KI6D 3PM8A 3PN7B 2ZKMX 1MXLC 1SCMC 3EVUA 1SL7A 1WLMA 1Y1AA 4OCIA 4OR9B 4XJKA 1BODA 1JSAA 1QIVA 3DF0B 2QACA 4PCWA 3FWBA 4CIDA 2KHNA 2NZ0A 1IY5A 2ZN8A 1H0ZA 2NXQA 4F0ZB 5JJGA 1KFXS 2GV5A 2KGBC 3SIAA 3I5GB 1NP8A 2BBMA 3AAJA 3O6BA 1QVIY 1IH0A 1LR8A 3BUNB 1IW4A 4PHMA 1KSOA 2ZN9A 5I2LA 1TBQR 1RTP1 4U8DA 1QJTA 1S6CA 2K2FA 2BCXA 2PALA 4PE0A 3SG2A 2BCAA 2E6WA 4QJ3B 1B4CA 4NDDA 5AEQA 1QS7A 1SK6D 1KQMC 2L51A 2LNKA 3A4UB 2M97A 3NSIA 3PSRA 2WCYA 5B8IB 5AERA 2KI4B 1OE9B 4ORBB 3WXAA 1F8HA 2JOJA 4AQJA 2NU4I 2KYFA 5AANA 3EVVA 1CSOI 4ORCB 2JTTA 2RGIA 3KF9A 3EVRA 3LLEA 4N1GA 4DUQA 1AP4A 1LR7A 2N17A 1SYMA 4PHJA 1F71A 2L4IA 2L2EA 1B47A 3BOWA 3DVJA 1CFCA 2F33A 4E68A 1WDCB 3PN7C 2LP3A 3B4VC 2K7CA 1GJYA 1KFXL 2BBNA 3BUMB 3I5HB 1UWOA 2SGDI 2F8PA 2LC5A 2JPTA 3WHTB 1YUUA 3I5FB 2LEOA 1M31A 1DJYA 3I5GC 1AK8A 5HLOA 1SGEI 1GGZA 1BR1B 1LXFC 1SGNI 2NU2I 1PCEA 1YURA 2L4HA 2MA2A 1UHIA 1MT1A 1N2DA 1IG5A 3CR2A 1DS2I 2LVVA 3F45A 1KWOB 2TN4A 1RECA 4YI9A 3CR4X 1IQ5A 5HKYA 4MRYA 5CSJA 2KI4C 2ISDA 2GGMA 3E3RA 4A4BA 5CSFA 4UPGA 3SG4A 3BUOB 1ALWA 3SG3A 4BY4A 1LA0A 1HQVA 2LLUA 1SPYA 1WRKA 2KCXA 2KMQA 1Y1XA 3MSEB 3O4YA 1XFZO 2M9GA 1A03A 3CLNA 1BT6A 2M0RA 2XRCA 1SL8A 1WDCC 1DJGA 2BKIB 1JC2A 3QTLD 1Y1CA 3OHMB 1Y1UA 4M2PA 1WRLA 1BMOA 2K61A 3I5HC 1SR6B 3VRNA 2CCMA 1TNXA 2LAPA 3SG5A 2GGZA 1SKTA 3I5FC 5DKQA 1TNWA 3EK7A 1KSMA 2LLSA 1DJWA 2AMIA 1VRKA 1Q80A 3ICBA 1UUSA 4PE7A 1M63B 1HT9A 1K93D 1MF8B 3WNXB 1NX1A 2BL0B 1NUBA 2JWWA 4GGFA 1LR9A 5CSNA 1CDLA 2K8MB 3O2PA 2H61A 3OP0A 2L0PA 2ZNEA 1TOPA 4GGNA 1CGJI 4P2YB 1CT2I 1PJUA 2M49B 1SW8A 3VGOA 3CS1A 1KWOC 1LVCD 2JTZA 2VRGA 3D10A 4WQ3A 5DKNA 1QATA 4A4CA 4ZCUA 5DAEA 4CPVA 2P6AC 1GQMA 4PE1A 2EC6B 1AHRA 4OKHA 1J55A 1RROA 3EKJA 1S5GZ 1XFUO 1SL9A 1YRUB 2PSRA 2Q91A 5K89A 4NDBA 1F55A 3D0YB 1TNPA 4JPZB 2DOQA
chains in the Genus database with same CATH superfamily
3O4XA 3BYAA 1CE3A 2Y0MA 4YGBB 2L8EA 1EJ3A 1F4OA 1PTRA 2JXLA 1NYAA 3EG5B 3HH2C 1K94A 1Z7KB 3KEVA 2H2KA 1YU6C 4GUKA 5ER5A 1NIWA 1FAQA 2I7AA 3BJHA 1N65A 1NWDA 2ODDA 4F7FA 2LM5A 1C7VA 1CLBA 3PALA 3GOXA 2JYYA 3H4SE 5E3RA 1DC1A 1W7JB 1UUCA 4YGAA 2O60A 3VROA 2MJWB 2LVKA 2A20A 1K2HA 2X3TA 2KQ6A 3CXLA 3PM2A 3AKBA 4OVNF 3FC3A 3VRRA 1BF5A 2Y1NA 2PQ8A 1W3SA 3RM1A 1DTLA 3R5AA 1PPFI 1OVOA 1BR4B 4AQIA 1FF1A 2JU0A 2PRUA 2JZIA 4INWA 2BUSA 2M7NA 1KK7Z 2ERWA 3GOFA 1TN4A 1RFJA 4USLA 3TUYB 1TCOB 2YQPA 1TGSI 1OMUA 1B8RA 1DT7B 2AUCA 3AKAA 1OMRA 2M3WA 3M0WA 2ORVA 2OTGB 1GM0A 4FTGA 4MRXA 2WVJA 4GPLB 4IJ7A 2KMOA 1LINA 2SGFI 2DIPA 1N0YA 1OOHA 1QASA 5CPVA 4GFTA 1L2OC 1UHAA 4JCVE 3S0AA 2ZFDA 1XYDA 4HSZA 2M5XA 4ZCVA 1K90D 3R5CA 3PDNA 1SSEB 1ZUZA 1PTQA 4TNCA 5EL2A 4DCKA 1G8IA 3TO9A 1CM1A 1XFRA 3R5DA 1K7VA 4WQ2A 1BUSA 3SIBA 3D76A 2LLTA 2KMRA 2KLEA 3BXKA 1TWOA 2NU1I 2H61C 3SJSA 4XYNA 4YGEB 1MQ1A 2Y5IA 1LKJA 4ICBA 2LV7A 2LHIA 4SGBI 1Y1BA 1FYBA 2KBIA 1IQ3A 5FI6A 2GKVA 2KPHA 5CSIA 3JTDB 1K96A 1CT4I 1FY7A 4DS7A 1SNLA 2KFHA 2J87A 3DVEA 2NCOA 1NX0A 1KMAA 2OS8B 1CB1A 1TBNA 1J7QA 5TNCA 5CCMA 2G9BA 4YRUA 3OX5A 2V53A 1VDDA 2JNFA 4MZKA 2JZMA 1SGDI 1UVGA 3KHEA 7WGAA 1XFYO 1K9PA 3DVKA 1NSHA 2JT3A 3QAHA 1F54A 1CMGA 1J7RA 3D0YA 5J8CA 1LA3A 2KAYA 1FBVA 3HX4A 1AJ5A 1KK8C 5PALA 3GK4X 1RK9A 4MZJA 2FCEA 2SCPA 3EK4A 4M2QA 4MSPA 3R1VA 1UHHA 5KSZA 5FI7A 3UOEA 1K7TA 1PSBA 5J3XA 1UHKA 1XFXO 3WHUB 2A4JA 2N52A 1ORGA 1YX8A 2KAXA 1TBRR 2WCFA 4I5JA 3PM8A 1SCMC 4XJKA 1WLMA 4OR9B 3DYEA 4PCWA 2NZ0A 4FKDA 1IY5A 4F0ZB 5JJGA 2KGBC 2PQLA 2BBMA 3AAJA 1LR8A 5I2LA 2ERBA 4PT1A 4U8DA 2K2FA 4PE0A 2PALA 2E6WA 5DICA 1SK6D 2L51A 3A4UB 2WCYA 2KI4B 2NU4I 2KYFA 3EVVA 1CSOI 2JTTA 3LLEA 3VB1A 1SYMA 4PHJA 1GJYA 3I5HB 3N7HA 1RFHA 3I5FB 3I5GC 1GGZA 2FJYA 2L4HA 1MT1A 3CR2A 2BNXA 2TN4A 1RECA 3CR4X 5HKYA 2QPOA 2GGMA 3SG4A 3CABA 2KCXA 1A03A 2CWFA 1DJGA 2K9HA 1WRLA 3VRNA 2CCMA 2GGZA 1SKTA 1TNWA 2LLSA 2X52A 1DJWA 2CWHA 1Q80A 3ICBA 4KYNA 1M63B 1NUBA 3OXFA 2K8MB 2WC6A 3O2PA 3TOBA 2ORWA 2B8TA 2M49B 1SW8A 3VGOA 3CS1A 2JTZA 4WQ3A 1TOTA 4ZCUA 1GQMA 1AHRA 1RROA 3R1PA 1SL9A 4NDBA 1F55A 3D0YB 4OVOA 1V1FA 2F3CI 1XK4C 1SR6C 3UFFA 1P9GA 2MLEC 2PVBA 4QJ5B 5GQQC 4PE4A 1S1EA 1Z2CB 2BL0C 3D77A 1IJ6A 1OMDA 4GAOA 4PHNA 3SS5A 1QV0A 3DD4A 1MHOA 2HETA 1TCFA 4L9MA 1W9ZA 3ZWHA 2QEBA 5I2QA 3OL0A 3LL8B 2KDHA 1EL4A 4PALA 3L4AA 1XBTA 4GNKB 4XJKB 1AJ4A 2LANA 5D3OA 2WOSA 2FJUB 1DEKA 3LCPC 1KBEA 3A8RA 1K95A 1SGRI 2L5XB 1YTZC 2HQ8A 3DXLA 2AAOA 3DY9A 1TIHA 3BFAA 4JWQA 2UVOA 1WLZA 1X02A 1ULNA 1HPTA 2M1UA 1F4QA 1KFUL 4MLWA 3NSKA 3PLFB 1HJAI 3B87A 5HYDA 4C0KA 2QDIA 1IJ5A 2OVOA 1TURA 1CNPA 1EH2A 3I5IB 3OB2B 2RIJA 1JF0A 3UNWA 1A75A 1QXPA 2WC5A 1CT0I 1P9ZA 4N1FA 1SGQI 1A2XA 1IKUA 2WCMA 2E30A 3KPXA 1EG4A 2WGCA 3UEJA 2LVJA 3TO6A 2L50A 3IF7A 5JOLA 2E73A 1LS8A 2M8UA 2JA1A 1ZMZA 4FQTA 2KYCA 4A24A 5BPJA 1NCZA 2R2IA 1BJFA 5HKZA 4OZDA 1MJBA 2LE9B 2EGDA 2BE4A 2LCPA 3TDUA 2CBLA 1JWDA 1JUOA 3D73A 1S26D 4GGFC 2I18A 2SASA 3B86A 2LUYA 1PRWA 1SY9A 3S0BA 1NCYA 2KFGA 4C0JA 4UXHA 3CZ0A 2MLFC 3S0GA 2JC2A 2QEOA 4R1EA 5HLVA 1TBOA 1PK0D 3CWGA 5HQ8A 1CDNA 2OPOA 2PMYA 2M29A 1CKKA 1P28A 2LB7A 1SCVA 4DRWA 4PDZA 4DIRA 2LMVA 1SRAA 4QJ4B 1BOCA 2K60A 1QX5B 1JFJA 2DB6A 1J1EA 3NHIA 3CYZA 4E1RA 1R79A 2KSPA 4P5OE 3TS5B 3JVTB 1S36A 4B6DA 1H4BA 1WY9A 4ORAB 1K7UA 2QEVA 1JBAA 2K2AA 2V1CC 1WRZA 1OMTA 1DJZA 1RJVA 1QTXA 3FE6A 1FPWA 4CLNA 2PASA 3S0DA 4I5LB 1K9KA 2LVIA 4MZLA 1Y6WA 1A75B 1B1GA 3IQOA 2KBMA 3UO9A 3VRQA 1JF2A 5DKRA 1MXLC 1WKXA 3NGVA 2GV5A 3B7AA 1NP8A 1IH0A 5HI7A 3UEYA 2WCHA 4PHMA 1KSOA 2ZN9A 1IIOA 1TBQR 1RTP1 4NDDA 5AEQA 1KQMC 2OZUA 3PSRA 5AERA 1OE9B 4ORBB 5AANA 3D00A 2PYQA 2RGIA 3EVRA 4DUQA 1AP4A 1B47A 3BOWA 2F33A 4E68A 3BFHA 3PN7C 3MEKA 3B4VC 2K7CA 1UWOA 2SGDI 2F8PA 2JPTA 1YUUA 1M31A 1AK8A 5HLOA 1SGEI 1BR1B 3UGIA 2MA2A 1IG5A 2LVVA 2L2CA 5FI2A 3BUOB 3SG3A 3PJIA 2KMQA 2M9GA 1SL8A 1WDCC 1JC2A 3QTLD 3OHMB 5J8FA 1KSMA 2AMIA 1MF8B 1LR9A 5CSNA 2H61A 3FE9A 2ZNEA 1PJUA 3RZSA 4GGNA 1CGJI 4P2YB 1CT2I 1KWOC 1LVCD 1DELA 5DKNA 2J9RA 4A4CA 4CPVA 1TNPA 2Q91A 5K89A 4JPZB 3V2LA 4JQ0D 3CZTX 2O5GA 2WCBA 3CR5X 1YUTA 2F3YA 1A4PA 4JKTA 1B8LA 3NSOA 1S6JA 1OQPA 2CTNA 1R6PA 4INXA 1J7PA 5IBWA 3SS4A 4I5KA 2ELIA 2SGPI 1CFFA 2RC4A 1M39A 2WORA 4I5NB 3BFBA 2EC6C 4CFRA 2NU3I 1SMGA 1Z4HA 2Y4QA 3SEKC 1IY6A 1M8CA 3GK2A 2KNEA 2ENZA 4C0LA 1FW4A 1XA5A 1YR5A 1UHJA 1ULMA 1XFVO 2GIVA 3VDPA 3K21A 1TNQA 1WGCA 3GK1A 1G33A 1UURA 3DVMA 2MBXA 4YGDB 3OB1B 1SBJA 1XX6A 4HRGA 3OVOA 5I8NA 3BOWB 1H8BA 2KI6C 4UXJA 1EG3A 2Y1MA 1S20A 4OV2A 2K7OA 1T14A 1IGVA 3CZ2A 2CT9A 2ZRSA 1A29A 2QPTA 1L2OB 2NLNA 3QMEA 4MEWA 4YBHB 3VRPA 1BLQA 1MXEA 3D74A 1U5IA 1AUIB 2QQDA 2IS9A 1V1HA 1PULA 3QWPA 3BUXB 2KAVA 2KGRA 1QX7A 1CFPA 3HCMA 3DF0A 1DVIA 5AXIA 2MHHA 1W7IB 3C1VA 4WP4A 1CTRA 4MN0A 2WCEA 1S3PA 1XA6A 3EK8A 3FIAA 2LHLA 3TUYC 1J1DA 5KU1A 2GVIA 2SGEI 3OXGA 1AN1I 4MPIA 2ZRTA 1TUJA 1DMOA 1Q9BA 1M45A 4NDCA 4MBEA 2K7DA 2OTGC 1YVHA 1Y0VH 3OGNA 1YX7A 1MR8A 4N5XA 4IL1A 3L47A 1OZSA 2LMTA 3D78A 1SGYI 3LK0A 2N1AB 1DGVA 1FI6A 4CFQA 4YGCB 3OBVA 1CLLA 2CNPA 1BG1A 4YI8A 2Q4UA 5D7FA 3CZ1A 1KFUS 2SGQI 2OD1A 1XK4A 2L5YA 2F2PA 4HRHA 2LUXA 1KK8B 4GBAA 3IQQA 1RWYA 1DGUA 1KK7Y 4DNCA 2JT8A 1PVAA 3NSLA 4AOMA 1PVBA 2L98A 1OW4A 1OYVI 1NX3A 5G08A 5JHWC 4HREE 3VDUA 2NU0I 3PATA 1TTXA 3KO0A 3JTDC 5AFPA 1OSAA 2UZ3A 1OOJA 2KLDA 2VRWB 1PALA 2LUCA 1CLMA 1C7WA 2OS8C 1K9UA 1MWNA 3FWCA 1DF0A 1SCMB 3EKHA 1DQEA 5FUWA 1HDLA 4ETOA 2D8NA 2WCLA 5I2OA 5FUXA 4PHKA 1FI5A 5E3PA 2M1KB 3IVTA 3BJIA 1IWQA 1ZFSA 1U5IB 4JD9A 2B1UA 1DJHA 1KQVA 1B9AA 3PFVA 1XFWO 2QQCA 1ODBA 1V1GA 3SG6A 2JXCA 2E5RA 3DZTA 3R1OA 2ZKMX 1SL7A 1Y1AA 1JSAA 4UXIA 3DF0B 4CIDA 3FWBA 1HEVA 5EX3A 2KHNA 5FUYA 1KFXS 3I5GB 1QVIY 1X74A 2OU2A 2BCXA 2M97A 5B8IB 2P71A 3WXAA 1F8HA 4ORCB 3KF9A 4N1GA 2N17A 3E2IA 2L2EA 3BUMB 1KFXL 3WHTB 2LEOA 1DJYA 1V1IA 1LXFC 1SGNI 1Y8FA 2H8VA 1N2DA 2DKVA 1DS2I 3F45A 4YI9A 1IQ5A 3R5BA 2KI4C 2QQ0A 2ISDA 4UPGA 3E3RA 5CSFA 1U5KA 1ALWA 1OOGA 4BY4A 1LA0A 1HQVA 2ENNA 3Q8IA 1SPYA 1Y1XA 3O4YA 1XFZO 2QQEA 3CLNA 2BKIB 1BMOA 2K61A 3I5HC 1SR6B 2LAPA 3SG5A 5DKQA 3I5FC 3EK7A 1UUSA 4PE7A 1HT9A 1K93D 3WNXB 2BL0B 2JWWA 4GGFA 3OP0A 2L0PA 1TOPA 2VRGA 1QATA 4PE1A 4OKHA 1J55A 3EKJA 1YRUB 2PSRA 4FQOA 2DOQA 1ALVA 3BUWB 2MRDA 3QRXA 1C07A 2W0TA 1N13A 4AMLA 1DJIA 5I94A 1DF0B 1MJ9A 1WGTA 2WCKA 2HF5A 1EXRA 2YUUA 2KFFA 2LMUA 2JRFA 2GKRI 1OOFA 2I94A 2I2RE 1UHNA 1DS3I 1PSRA 2YGUA 1QLKA 2B0UC 1YTPA 1YUSA 1QLSA 2JQ6A 3B6XA 5E3QA 3NXAA 1B7TY 2G2BA 1QVIZ 1AVSA 2V1CA 1MJAA 1L7ZA 1OMVA 1C3YA 2FNFX 1CM4A 2CWGA 2JW6A 3KY9A 2JNXA 3CTNA 2EHBA 2JXDA 2WNDA 3FS7A 3SGQI 1CGII 1FARA 5FYXA 3L4LA 3E59A 3TOAA 1CFDA 5D69A 3CDNA 2ZNDA 1BU3A 1KBFA 2MAZA 1B8CA 1K8UA 2P70A 1CDPA 2K0JA 3AAKA 1IRJA 3RLZA 1KCYA 1OZOA 1MUXA 3TO7A 3FSXA 1QX2A 1UP5A 2WC8A 9WGAA 2GTEA 2JULA 1NCXA 2BE6A 2FCDA 2COLB 3UGDA 2HPSA 1CDMA 4D1EA 3SGBI 2L7XA 1ULKA 1M8BA 3I5IC 2K7BA 1NX2A 1ZACA 1TIZA 2JPOA 1CHOI 4BY5A 1CMFA 1DJXA 1M46A 1XVJA 1E8AA 3CGAA 5HL1A 3OX6A 1F70A 5FUVA 1QIWA 3S0FA 5F6TA 2KQYA 2NCPA 3TZ1A 4M2OA 1Z2IA 2KMPA 1YVLA 3TDIA 2KOTA 2N71A 3BQ3A 4GI3C 1B7TZ 1YRTB 1R2UA 1C3ZA 1JFKA 3TDZA 2M7LA 2FOTA 3SG7A 1TRFA 2LP2A 3O78A 3D75A 2HQWA 1S5GY 2ARPF 1ZOTB 2P6BB 1NPQA 3RU0A 3FE8A 1OOIX 2BCBA 1TUSA 1S6IA 3NHTA 2F2OA 5EX0A 2GKTI 1XO5A 2CXJA 5ER4X 2F3ZA 1R0RI 3TJQA 2WCJA 1GGWA 4HGUA 2BKHB 2BECA 4MVFA 3LK1A 5HKWA 1G4YR 3ZNIA 4WRIA 1QV1A 1J7OA 5KTYA 4Q04A 1KQMB 3S0EA 1D1OA 1SGPI 3TS5C 3JVTC 1W4RA 4NQGA 2JT0A 1WTJA 2KI6D 3PN7B 2CJSC 3EVUA 3OXLA 4OCIA 1BODA 3UGLA 1QIVA 2QACA 2ZN8A 4E1PA 1H0ZA 2NXQA 3SIAA 1QWVA 3R72A 3O6BA 3BUNB 1IW4A 3B88A 1QJTA 1S6CA 3SG2A 2BCAA 1B4CA 4QJ3B 1QS7A 2LNKA 3NSIA 2QEHA 2JOJA 4AQJA 1LR7A 1TUZA 1F71A 2L4IA 1NXUA 3DVJA 1CFCA 1WDCB 5CCLA 2LP3A 2BBNA 2LC5A 2NU2I 1PCEA 1YURA 1UHIA 1KWOB 3K1EA 4MRYA 5CSJA 4A4BA 2LLUA 1WRKA 2BAPA 3MSEB 2ROWA 1BT6A 2M0RA 2XRCA 3VE5A 1Y1CA 1Y1UA 4M2PA 1TNXA 1VRKA 1NX1A 1CDLA 1X4SA 3D10A 3FSYA 3SS3A 5DAEA 2P6AC 2EC6B 1S5GZ 1XFUO 1UVFA
chains in the Genus database with same CATH topology
1V1FA 3BYAA 4JQ0D 1ALVA 3BUWB 3CZTX 2O5GA 2MRDA 2WCBA 3CR5X 1YUTA 2F3YA 2F3CI 1CE3A 1A4PA 1XK4C 3QRXA 1C07A 4YGBB 2W0TA 1SR6C 1B8LA 3NSOA 1N13A 1S6JA 3UFFA 1FYBA 2MLEC 2PVBA 1DJIA 1OQPA 2CTNA 4QJ5B 2L8EA 1R6PA 1EJ3A 5GQQC 1J7PA 1F4OA 5IBWA 1DF0B 4PE4A 1S1EA 1PTRA 2JXLA 1NYAA 3OXLA 2BL0C 3HH2C 2HF5A 1EXRA 4I5KA 2YUUA 2KFFA 2ELIA 1IJ6A 2LMUA 1OMDA 1K94A 2SGPI 4GAOA 1CFFA 1Z7KB 4PHNA 3KEVA 2H2KA 1M39A 2JRFA 2WORA 1QV0A 4I5NB 3DD4A 1YU6C 2I94A 2I2RE 1MHOA 2HETA 2EC6C 2GKRI 4CFRA 2NU3I 1UHNA 1SMGA 1TCFA 4L9MA 4GUKA 1PSRA 5ER5A 1DS3I 1QLKA 3ZWHA 5I2QA 3OL0A 1NIWA 2Y4QA 1FAQA 4FQOA 2I7AA 3LL8B 2B8TA 3SEKC 1N65A 1IY6A 1NWDA 2ODDA 1M8CA 3GK2A 2KNEA 2LM5A 2KDHA 2ENZA 1C7VA 2B0UC 1YTPA 1YUSA 4C0LA 1CLBA 1EL4A 3PALA 1FW4A 3GOXA 1XA5A 1YR5A 1UHJA 4PALA 2JYYA 3H4SE 1XBTA 1XFVO 4GNKB 1QLSA 3VDPA 1W7JB 1UUCA 2JQ6A 3K21A 4XJKB 4YGAA 1TNQA 3NXAA 1AJ4A 2O60A 1B7TY 3VROA 2MJWB 2LVKA 2A20A 2G2BA 3GK1A 1K2HA 1G33A 1QVIZ 2KQ6A 2LANA 3CXLA 1AVSA 2V1CA 1UURA 2WOSA 3DVMA 1L7ZA 2MBXA 1OMVA 2FNFX 4YGDB 2FJUB 1CM4A 3AKBA 4OVNF 3FC3A 3OB1B 2JW6A 3KY9A 3VRRA 2JNXA 3CTNA 3LCPC 2EHBA 2JXDA 1KBEA 1BF5A 2WNDA 2Y1NA 3A8RA 3FS7A 1SBJA 3SGQI 1W3SA 3RM1A 1DTLA 1CGII 1FARA 4HRGA 1XX6A 1K95A 1SGRI 5FYXA 2L5XB 1YTZC 2HQ8A 3OVOA 5I8NA 2AAOA 3BOWB 2KI6C 1H8BA 1PPFI 3E59A 1TIHA 1OVOA 1BR4B 4JWQA 1CFDA 4UXJA 1EG3A 5D69A 4AQIA 1FF1A 2ZNDA 2JU0A 2Y1MA 1BU3A 2PRUA 4OV2A 1WLZA 1X02A 2K7OA 2JZIA 1KBFA 2MAZA 1IGVA 2BUSA 2M7NA 1KK7Z 2CT9A 2ERWA 3GOFA 1HPTA 2ZRSA 1A29A 2M1UA 1TN4A 1RFJA 4USLA 1F4QA 1KFUL 2QPTA 4MLWA 1L2OB 3NSKA 2NLNA 1B8CA 3PLFB 1K8UA 3TUYB 1HJAI 5HYDA 4C0KA 1TCOB 4MEWA 4YBHB 3VRPA 2YQPA 1CDPA 1BLQA 1MXEA 2K0JA 3AAKA 1TGSI 1IRJA 3RLZA 1KCYA 1OMUA 1IJ5A 1B8RA 1OZOA 1DT7B 1MUXA 2OVOA 2AUCA 1TURA 1U5IA 3AKAA 1CNPA 1EH2A 1OMRA 3I5IB 3OB2B 2M3WA 3M0WA 1QX2A 1JF0A 1UP5A 2WC8A 1A75A 1QXPA 2ORVA 1AUIB 2OTGB 2QQDA 1CT0I 2IS9A 4N1FA 1V1HA 1PULA 4FTGA 3QWPA 2JULA 3BUXB 4MRXA 2KAVA 1NCXA 2BE6A 2KGRA 1SGQI 1A2XA 2WVJA 2FCDA 4GPLB 1IKUA 1QX7A 2COLB 1CFPA 3HCMA 3DF0A 1DVIA 5AXIA 2HPSA 2MHHA 1W7IB 2E30A 2KMOA 3UGDA 3KPXA 1EG4A 1LINA 3C1VA 2DIPA 2SGFI 3UEJA 1CTRA 1N0YA 2LVJA 4MN0A 2WCEA 1S3PA 1UVFA 1XA6A 1QASA 3EK8A 3FIAA 5CPVA 4GFTA 1CDMA 2LHLA 1L2OC 3TUYC 2L50A 3IF7A 5JOLA 4D1EA 4JCVE 2ZFDA 2L7XA 1J1DA 3SGBI 2E73A 1XYDA 2M8UA 5KU1A 1M8BA 2GVIA 2JA1A 1ZMZA 4HSZA 2M5XA 2SGEI 3OXGA 1AN1I 2ZRTA 1DMOA 3I5IC 2K7BA 2KYCA 1M45A 4NDCA 1NX2A 4MBEA 4ZCVA 1K90D 2K7DA 4A24A 1ZACA 2OTGC 5BPJA 1YVHA 1NCZA 3PDNA 1Y0VH 2R2IA 1BJFA 1ZUZA 5HKZA 1TIZA 1PTQA 4TNCA 1YX7A 1MR8A 2LE9B 4N5XA 1CHOI 2EGDA 4IL1A 4BY5A 2BE4A 2LCPA 3TDUA 1OZSA 4DCKA 1G8IA 2LMTA 1CMFA 1CM1A 2CBLA 1JWDA 1SGYI 4WQ2A 1BUSA 1DJXA 1JUOA 1M46A 3LK0A 3SIBA 2N1AB 1XVJA 2LLTA 1DGVA 1E8AA 1S26D 3CGAA 1FI6A 4GGFC 2KMRA 2I18A 2SASA 3BXKA 2LUYA 2NU1I 2H61C 4CFQA 1PRWA 1SY9A 1NCYA 2KFGA 3SJSA 4YGCB 4C0JA 2ORWA 4UXHA 4XYNA 4YGEB 1CLLA 1MQ1A 3OX6A 2CNPA 1F70A 1BG1A 2Y5IA 4YI8A 2MLFC 5FUVA 1QIWA 1LKJA 2Q4UA 4ICBA 2JC2A 5F6TA 2LV7A 2LHIA 4R1EA 5D7FA 5HLVA 1TBOA 4SGBI 1Y1BA 1PK0D 2KBIA 3CWGA 1IQ3A 5HQ8A 1KFUS 2KQYA 1CDNA 2NCPA 5CSIA 2GKVA 3JTDB 1K96A 3TZ1A 2SGQI 2OD1A 1CT4I 4M2OA 2OPOA 4DS7A 1SNLA 1XK4A 2KMPA 2KFHA 2PMYA 2J87A 1YVLA 3DVEA 2M29A 2F2PA 2KOTA 3TDIA 4HRHA 2NCOA 2N71A 1NX0A 2LUXA 1KMAA 1CKKA 3BQ3A 4GI3C 2OS8B 1CB1A 1TBNA 1KK8B 4GBAA 3IQQA 1RWYA 1B7TZ 1J7QA 5TNCA 5CCMA 2G9BA 4YRUA 1DGUA 3OX5A 1YRTB 2V53A 1VDDA 1KK7Y 2JNFA 1SCVA 4MZKA 4DRWA 2JZMA 4PDZA 4DIRA 2JT8A 1PVAA 1R2UA 2LMVA 1SGDI 3NSLA 1SRAA 1UVGA 3KHEA 4AOMA 1JFKA 1PVBA 1XFYO 2M7LA 3TDZA 1K9PA 4QJ4B 2L98A 3DVKA 1NSHA 2FOTA 1OYVI 3SG7A 2JT3A 1BOCA 1NX3A 1TRFA 5G08A 2LP2A 1F54A 1QX5B 5JHWC 1JFJA 2DB6A 4HREE 3VDUA 2NU0I 3PATA 3O78A 1CMGA 1J7RA 2HQWA 1J1EA 3D0YA 1S5GY 1TTXA 3KO0A 4E1RA 1R79A 3JTDC 5AFPA 2KSPA 2ARPF 1OSAA 1LA3A 1ZOTB 2KAYA 2P6BB 4P5OE 2UZ3A 1OOJA 2VRWB 1PALA 2LUCA 1NPQA 1FBVA 3RU0A 3TS5B 3HX4A 3JVTB 1CLMA 1C7WA 2BCBA 2OS8C 1TUSA 1S36A 4B6DA 1AJ5A 1S6IA 1H4BA 1KK8C 5PALA 1K9UA 2F2OA 1MWNA 3GK4X 1RK9A 1WY9A 5EX0A 2GKTI 4ORAB 3FWCA 1DF0A 1XO5A 1JBAA 1SCMB 2FCEA 4MZJA 2CXJA 2SCPA 3EKHA 5ER4X 2K2AA 2F3ZA 3EK4A 4M2QA 1R0RI 2V1CC 3TJQA 1WRZA 1OMTA 4OVOA 1DJZA 1GGWA 4MSPA 5FUWA 1RJVA 1HDLA 4ETOA 1QTXA 2D8NA 4HGUA 2BKHB 2BECA 1FPWA 4CLNA 4MVFA 1UHHA 3LK1A 5KSZA 5HKWA 5I2OA 5FUXA 4PHKA 1FI5A 2PASA 1G4YR 3ZNIA 4I5LB 4WRIA 1K9KA 1QV1A 1PSBA 2M1KB 1J7OA 3BJIA 5KTYA 5J3XA 1UHKA 4Q04A 1IWQA 1KQMB 1XFXO 3WHUB 1ZFSA 1U5IB 2A4JA 2LVIA 4MZLA 2N52A 2B1UA 1Y6WA 1D1OA 1DJHA 1KQVA 1SGPI 1B9AA 3PFVA 3JVTC 3TS5C 1A75B 1W4RA 1XFWO 1B1GA 3IQOA 4NQGA 2QQCA 1ODBA 1V1GA 2KBMA 2JT0A 3SG6A 2JXCA 1YX8A 2KAXA 1TBRR 2WCFA 3VRQA 1JF2A 5DKRA 4I5JA 2E5RA 2KI6D 3PM8A 3PN7B 2ZKMX 2CJSC 1MXLC 1SCMC 3EVUA 1SL7A 1WLMA 1Y1AA 4OCIA 4OR9B 4XJKA 1BODA 1JSAA 4UXIA 3UGLA 1QIVA 3DF0B 2QACA 4PCWA 3FWBA 4CIDA 5EX3A 2KHNA 2NZ0A 4FKDA 2ZN8A 4E1PA 1IY5A 1H0ZA 5FUYA 2NXQA 4F0ZB 5JJGA 1KFXS 2GV5A 2KGBC 3SIAA 3I5GB 1NP8A 2BBMA 3AAJA 3O6BA 1QVIY 1IH0A 5HI7A 3UEYA 1LR8A 3BUNB 1IW4A 1X74A 4PHMA 1KSOA 2ZN9A 5I2LA 1TBQR 1RTP1 4U8DA 1QJTA 1S6CA 2K2FA 2BCXA 2PALA 4PE0A 3SG2A 2BCAA 2E6WA 4QJ3B 1B4CA 4NDDA 5AEQA 1QS7A 1SK6D 1KQMC 2L51A 2LNKA 3A4UB 2M97A 3NSIA 3PSRA 2WCYA 5B8IB 5AERA 2KI4B 1OE9B 4ORBB 3WXAA 1F8HA 2JOJA 4AQJA 2NU4I 2KYFA 5AANA 3EVVA 1CSOI 4ORCB 3D00A 2JTTA 2RGIA 3KF9A 3EVRA 3LLEA 4N1GA 4DUQA 1AP4A 1LR7A 2N17A 1SYMA 4PHJA 3E2IA 1F71A 2L4IA 2L2EA 1B47A 3BOWA 3DVJA 1CFCA 2F33A 4E68A 1WDCB 3PN7C 3MEKA 2LP3A 3B4VC 5CCLA 2K7CA 1GJYA 1KFXL 2BBNA 3BUMB 3I5HB 1UWOA 2SGDI 2F8PA 2LC5A 2JPTA 1RFHA 3WHTB 1YUUA 3I5FB 2LEOA 1M31A 1DJYA 3I5GC 1AK8A 5HLOA 1SGEI 1GGZA 1BR1B 1V1IA 1LXFC 1SGNI 1Y8FA 2NU2I 1PCEA 1YURA 2L4HA 3UGIA 2MA2A 1UHIA 1MT1A 1N2DA 1IG5A 3CR2A 1DS2I 2LVVA 3F45A 1KWOB 2TN4A 1RECA 4YI9A 3CR4X 1IQ5A 5HKYA 4MRYA 5CSJA 2QPOA 2KI4C 2QQ0A 2ISDA 2GGMA 3E3RA 4A4BA 5CSFA 4UPGA 3SG4A 3BUOB 1U5KA 1ALWA 3SG3A 4BY4A 1LA0A 1HQVA 2LLUA 2ENNA 1SPYA 1WRKA 2KCXA 2KMQA 1Y1XA 3MSEB 3O4YA 1XFZO 2M9GA 1A03A 3CLNA 2QQEA 2ROWA 1BT6A 2M0RA 2XRCA 1SL8A 1WDCC 1DJGA 2BKIB 1JC2A 2K9HA 3QTLD 3VE5A 1Y1CA 3OHMB 1Y1UA 4M2PA 1WRLA 1BMOA 2K61A 3I5HC 1SR6B 3VRNA 2CCMA 1TNXA 2LAPA 3SG5A 2GGZA 1SKTA 3I5FC 5DKQA 1TNWA 3EK7A 1KSMA 2LLSA 1DJWA 2AMIA 1VRKA 1Q80A 3ICBA 1UUSA 4PE7A 1M63B 1HT9A 1K93D 1MF8B 3WNXB 1NX1A 2BL0B 1NUBA 2JWWA 4GGFA 1LR9A 5CSNA 3OXFA 1CDLA 2K8MB 3O2PA 2H61A 3OP0A 2L0PA 2ZNEA 1TOPA 4GGNA 1CGJI 4P2YB 1CT2I 1PJUA 2M49B 1SW8A 3VGOA 1X4SA 3CS1A 1KWOC 1LVCD 2JTZA 2VRGA 3D10A 4WQ3A 1TOTA 5DKNA 2J9RA 1QATA 4A4CA 4ZCUA 5DAEA 4CPVA 2P6AC 1GQMA 4PE1A 2EC6B 1AHRA 4OKHA 1J55A 1RROA 3EKJA 1S5GZ 1XFUO 1SL9A 1YRUB 2PSRA 2Q91A 5K89A 4NDBA 1F55A 3D0YB 1TNPA 4JPZB 2DOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1F A;  3BYA A;  4JQ0 D;  1ALV A;  3BUW B;  3CZT X;  2O5G A;  2MRD A;  2WCB A;  3CR5 X;  1YUT A;  2F3Y A;  2F3C I;  1CE3 A;  1A4P A;  1XK4 C;  3QRX A;  1C07 A;  4YGB B;  1SR6 C;  1B8L A;  3NSO A;  1N13 A;  1S6J A;  2MLE C;  2PVB A;  1DJI A;  1OQP A;  2CTN A;  4QJ5 B;  1R6P A;  1EJ3 A;  5GQQ C;  1J7P A;  1F4O A;  5IBW A;  1DF0 B;  4PE4 A;  1S1E A;  2JXL A;  1NYA A;  2BL0 C;  3HH2 C;  2HF5 A;  1EXR A;  4I5K A;  2KFF A;  1IJ6 A;  2LMU A;  1OMD A;  1K94 A;  2SGP I;  4GAO A;  1CFF A;  1Z7K B;  4PHN A;  3KEV A;  2H2K A;  1M39 A;  2JRF A;  2WOR A;  1QV0 A;  4I5N B;  3DD4 A;  1YU6 C;  2I94 A;  2I2R E;  1MHO A;  2HET A;  2EC6 C;  2GKR I;  4CFR A;  2NU3 I;  1UHN A;  1SMG A;  1TCF A;  4L9M A;  4GUK A;  1PSR A;  5ER5 A;  1DS3 I;  1QLK A;  3ZWH A;  5I2Q A;  1NIW A;  2Y4Q A;  4FQO A;  2I7A A;  3LL8 B;  3SEK C;  1N65 A;  1IY6 A;  1NWD A;  1M8C A;  3GK2 A;  2KNE A;  2LM5 A;  2KDH A;  1C7V A;  2B0U C;  1YTP A;  1YUS A;  4C0L A;  1CLB A;  1EL4 A;  3PAL A;  1FW4 A;  1XA5 A;  1YR5 A;  1UHJ A;  4PAL A;  2JYY A;  3H4S E;  1XFV O;  4GNK B;  1QLS A;  1W7J B;  1UUC A;  2JQ6 A;  3K21 A;  4XJK B;  4YGA A;  1TNQ A;  3NXA A;  1AJ4 A;  2O60 A;  1B7T Y;  3VRO A;  2MJW B;  2LVK A;  2G2B A;  3GK1 A;  1K2H A;  1G33 A;  1QVI Z;  2KQ6 A;  2LAN A;  1AVS A;  1UUR A;  2WOS A;  3DVM A;  1L7Z A;  2MBX A;  1OMV A;  4YGD B;  2FJU B;  1CM4 A;  3AKB A;  4OVN F;  3OB1 B;  3VRR A;  2JNX A;  3CTN A;  3LCP C;  2EHB A;  2JXD A;  1BF5 A;  2WND A;  2Y1N A;  3A8R A;  3FS7 A;  1SBJ A;  3SGQ I;  3RM1 A;  1DTL A;  1CGI I;  4HRG A;  1K95 A;  1SGR I;  5FYX A;  2L5X B;  1YTZ C;  2HQ8 A;  3OVO A;  5I8N A;  2AAO A;  3BOW B;  2KI6 C;  1H8B A;  1PPF I;  1TIH A;  1OVO A;  1BR4 B;  4JWQ A;  1CFD A;  1EG3 A;  5D69 A;  4AQI A;  1FF1 A;  2ZND A;  2JU0 A;  2Y1M A;  1BU3 A;  2PRU A;  4OV2 A;  1WLZ A;  1X02 A;  2K7O A;  2JZI A;  2MAZ A;  1IGV A;  2BUS A;  2M7N A;  1KK7 Z;  2CT9 A;  2ERW A;  3GOF A;  1HPT A;  2ZRS A;  1A29 A;  2M1U A;  1TN4 A;  1RFJ A;  4USL A;  1F4Q A;  1KFU L;  2QPT A;  4MLW A;  1L2O B;  3NSK A;  2NLN A;  1B8C A;  3PLF B;  1K8U A;  3TUY B;  1HJA I;  5HYD A;  4C0K A;  1TCO B;  4MEW A;  4YBH B;  3VRP A;  1CDP A;  1BLQ A;  1MXE A;  2K0J A;  3AAK A;  1TGS I;  1IRJ A;  3RLZ A;  1KCY A;  1OMU A;  1IJ5 A;  1B8R A;  1OZO A;  1DT7 B;  1MUX A;  2OVO A;  2AUC A;  1TUR A;  1U5I A;  3AKA A;  1CNP A;  1EH2 A;  1OMR A;  3I5I B;  3OB2 B;  2M3W A;  3M0W A;  1QX2 A;  1JF0 A;  1UP5 A;  2WC8 A;  1A75 A;  1QXP A;  1AUI B;  2OTG B;  2QQD A;  1CT0 I;  2IS9 A;  4N1F A;  1PUL A;  4FTG A;  2JUL A;  3BUX B;  4MRX A;  2KAV A;  1NCX A;  2BE6 A;  2KGR A;  1SGQ I;  1A2X A;  2FCD A;  4GPL B;  1IKU A;  1QX7 A;  2COL B;  1CFP A;  3HCM A;  3DF0 A;  1DVI A;  5AXI A;  2HPS A;  2MHH A;  1W7I B;  2E30 A;  2KMO A;  3KPX A;  1EG4 A;  1LIN A;  3C1V A;  2SGF I;  1CTR A;  1N0Y A;  2LVJ A;  4MN0 A;  2WCE A;  1S3P A;  1UVF A;  1QAS A;  3EK8 A;  3FIA A;  5CPV A;  4GFT A;  1CDM A;  2LHL A;  1L2O C;  3TUY C;  2L50 A;  3IF7 A;  5JOL A;  4D1E A;  3SGB I;  2ZFD A;  1J1D A;  1XYD A;  2M8U A;  5KU1 A;  1M8B A;  1ZMZ A;  4HSZ A;  2M5X A;  2SGE I;  1AN1 I;  2ZRT A;  1DMO A;  3I5I C;  2K7B A;  2KYC A;  1M45 A;  4NDC A;  1NX2 A;  4MBE A;  4ZCV A;  1K90 D;  2K7D A;  1ZAC A;  2OTG C;  5BPJ A;  1YVH A;  1NCZ A;  1Y0V H;  2R2I A;  1BJF A;  1ZUZ A;  5HKZ A;  1TIZ A;  4TNC A;  1YX7 A;  1MR8 A;  2LE9 B;  4N5X A;  1CHO I;  2EGD A;  4IL1 A;  4BY5 A;  2BE4 A;  2LCP A;  3TDU A;  1OZS A;  4DCK A;  1G8I A;  2LMT A;  1CMF A;  1CM1 A;  2CBL A;  1JWD A;  1SGY I;  4WQ2 A;  1BUS A;  1DJX A;  1JUO A;  1M46 A;  3LK0 A;  3SIB A;  1XVJ A;  2LLT A;  1DGV A;  1E8A A;  1S26 D;  3CGA A;  1FI6 A;  4GGF C;  2KMR A;  2I18 A;  2SAS A;  3BXK A;  2NU1 I;  2H61 C;  4CFQ A;  1PRW A;  1SY9 A;  1NCY A;  2KFG A;  3SJS A;  4YGC B;  4C0J A;  4XYN A;  4YGE B;  1CLL A;  1MQ1 A;  3OX6 A;  2CNP A;  1F70 A;  1BG1 A;  2Y5I A;  4YI8 A;  2MLF C;  1QIW A;  1LKJ A;  2Q4U A;  4ICB A;  2JC2 A;  5F6T A;  2LV7 A;  2LHI A;  4R1E A;  5D7F A;  5HLV A;  4SGB I;  1Y1B A;  1PK0 D;  2KBI A;  3CWG A;  1IQ3 A;  1FYB A;  1KFU S;  2KQY A;  1CDN A;  2NCP A;  5CSI A;  2GKV A;  3JTD B;  1K96 A;  3TZ1 A;  2SGQ I;  1CT4 I;  4M2O A;  2OPO A;  4DS7 A;  1SNL A;  1XK4 A;  2KMP A;  2KFH A;  2PMY A;  1YVL A;  3DVE A;  2M29 A;  2F2P A;  2KOT A;  3TDI A;  4HRH A;  2NCO A;  2N71 A;  1NX0 A;  2LUX A;  1KMA A;  1CKK A;  3BQ3 A;  4GI3 C;  2OS8 B;  1CB1 A;  1KK8 B;  4GBA A;  3IQQ A;  1RWY A;  1B7T Z;  1J7Q A;  5TNC A;  2G9B A;  4YRU A;  1DGU A;  3OX5 A;  1YRT B;  2V53 A;  1KK7 Y;  2JNF A;  1SCV A;  4MZK A;  4DRW A;  2JZM A;  4PDZ A;  4DIR A;  2JT8 A;  1PVA A;  1R2U A;  2LMV A;  1SGD I;  3NSL A;  1SRA A;  1UVG A;  3KHE A;  4AOM A;  1JFK A;  1PVB A;  1XFY O;  2M7L A;  3TDZ A;  1K9P A;  4QJ4 B;  2L98 A;  3DVK A;  1NSH A;  2FOT A;  1OYV I;  3SG7 A;  2JT3 A;  1BOC A;  1NX3 A;  1TRF A;  5G08 A;  2LP2 A;  1F54 A;  1QX5 B;  5JHW C;  1JFJ A;  4HRE E;  2NU0 I;  3PAT A;  3O78 A;  1CMG A;  1J7R A;  2HQW A;  1J1E A;  3D0Y A;  1S5G Y;  1TTX A;  3KO0 A;  3JTD C;  5AFP A;  2KSP A;  2ARP F;  1OSA A;  1LA3 A;  1ZOT B;  2KAY A;  2P6B B;  4P5O E;  1OOJ A;  1PAL A;  2LUC A;  1NPQ A;  1FBV A;  3TS5 B;  3HX4 A;  3JVT B;  1CLM A;  1C7W A;  2BCB A;  2OS8 C;  1TUS A;  1S36 A;  1AJ5 A;  1S6I A;  1H4B A;  1KK8 C;  5PAL A;  1K9U A;  2F2O A;  1MWN A;  3GK4 X;  1RK9 A;  1WY9 A;  2GKT I;  4ORA B;  3FWC A;  1DF0 A;  1XO5 A;  1JBA A;  1SCM B;  2FCE A;  4MZJ A;  2CXJ A;  2SCP A;  3EKH A;  5ER4 X;  2K2A A;  2F3Z A;  3EK4 A;  4M2Q A;  1R0R I;  3TJQ A;  1WRZ A;  1OMT A;  4OVO A;  1DJZ A;  1GGW A;  4MSP A;  1RJV A;  1HDL A;  4ETO A;  1QTX A;  2D8N A;  4HGU A;  2BKH B;  2BEC A;  1FPW A;  4CLN A;  4MVF A;  1UHH A;  3LK1 A;  5KSZ A;  5HKW A;  5I2O A;  4PHK A;  1FI5 A;  2PAS A;  1G4Y R;  3ZNI A;  4I5L B;  4WRI A;  1K9K A;  1QV1 A;  1PSB A;  2M1K B;  1J7O A;  5KTY A;  5J3X A;  1UHK A;  4Q04 A;  1IWQ A;  1KQM B;  1XFX O;  3WHU B;  1ZFS A;  1U5I B;  2A4J A;  2LVI A;  4MZL A;  2N52 A;  2B1U A;  1Y6W A;  1D1O A;  1DJH A;  1KQV A;  1SGP I;  1B9A A;  3PFV A;  3JVT C;  3TS5 C;  1A75 B;  1XFW O;  1B1G A;  3IQO A;  4NQG A;  2QQC A;  1ODB A;  1V1G A;  2KBM A;  2JT0 A;  3SG6 A;  2JXC A;  1YX8 A;  2KAX A;  1TBR R;  2WCF A;  3VRQ A;  1JF2 A;  5DKR A;  4I5J A;  2KI6 D;  3PM8 A;  3PN7 B;  2ZKM X;  1MXL C;  1SCM C;  3EVU A;  1SL7 A;  1WLM A;  1Y1A A;  4OCI A;  4OR9 B;  4XJK A;  1BOD A;  1JSA A;  1QIV A;  3DF0 B;  2QAC A;  4PCW A;  3FWB A;  4CID A;  2KHN A;  2NZ0 A;  1IY5 A;  2ZN8 A;  1H0Z A;  2NXQ A;  4F0Z B;  5JJG A;  1KFX S;  2GV5 A;  2KGB C;  3SIA A;  3I5G B;  1NP8 A;  2BBM A;  3AAJ A;  3O6B A;  1QVI Y;  1IH0 A;  1LR8 A;  3BUN B;  1IW4 A;  4PHM A;  1KSO A;  2ZN9 A;  5I2L A;  1TBQ R;  1RTP 1;  4U8D A;  1QJT A;  1S6C A;  2K2F A;  2BCX A;  2PAL A;  4PE0 A;  3SG2 A;  2BCA A;  2E6W A;  4QJ3 B;  1B4C A;  4NDD A;  5AEQ A;  1QS7 A;  1SK6 D;  1KQM C;  2L51 A;  2LNK A;  3A4U B;  2M97 A;  3NSI A;  3PSR A;  2WCY A;  5B8I B;  5AER A;  2KI4 B;  1OE9 B;  4ORB B;  3WXA A;  1F8H A;  2JOJ A;  4AQJ A;  2NU4 I;  2KYF A;  5AAN A;  3EVV A;  1CSO I;  4ORC B;  2JTT A;  2RGI A;  3KF9 A;  3EVR A;  3LLE A;  4N1G A;  4DUQ A;  1AP4 A;  1LR7 A;  2N17 A;  1SYM A;  4PHJ A;  1F71 A;  2L4I A;  2L2E A;  1B47 A;  3BOW A;  3DVJ A;  1CFC A;  2F33 A;  4E68 A;  1WDC B;  3PN7 C;  2LP3 A;  3B4V C;  2K7C A;  1GJY A;  1KFX L;  2BBN A;  3BUM B;  3I5H B;  1UWO A;  2SGD I;  2F8P A;  2LC5 A;  2JPT A;  3WHT B;  1YUU A;  3I5F B;  2LEO A;  1M31 A;  1DJY A;  3I5G C;  1AK8 A;  5HLO A;  1SGE I;  1GGZ A;  1BR1 B;  1LXF C;  1SGN I;  2NU2 I;  1PCE A;  1YUR A;  2L4H A;  2MA2 A;  1UHI A;  1MT1 A;  1N2D A;  1IG5 A;  3CR2 A;  1DS2 I;  2LVV A;  3F45 A;  1KWO B;  2TN4 A;  1REC A;  4YI9 A;  3CR4 X;  1IQ5 A;  5HKY A;  4MRY A;  5CSJ A;  2KI4 C;  2ISD A;  2GGM A;  3E3R A;  4A4B A;  5CSF A;  4UPG A;  3SG4 A;  3BUO B;  1ALW A;  3SG3 A;  4BY4 A;  1LA0 A;  1HQV A;  2LLU A;  1SPY A;  1WRK A;  2KCX A;  2KMQ A;  1Y1X A;  3MSE B;  3O4Y A;  1XFZ O;  2M9G A;  1A03 A;  3CLN A;  1BT6 A;  2M0R A;  2XRC A;  1SL8 A;  1WDC C;  1DJG A;  2BKI B;  1JC2 A;  3QTL D;  1Y1C A;  3OHM B;  1Y1U A;  4M2P A;  1WRL A;  1BMO A;  2K61 A;  3I5H C;  1SR6 B;  3VRN A;  2CCM A;  1TNX A;  2LAP A;  3SG5 A;  2GGZ A;  1SKT A;  3I5F C;  5DKQ A;  1TNW A;  3EK7 A;  1KSM A;  2LLS A;  1DJW A;  2AMI A;  1VRK A;  1Q80 A;  3ICB A;  1UUS A;  4PE7 A;  1M63 B;  1HT9 A;  1K93 D;  1MF8 B;  3WNX B;  1NX1 A;  2BL0 B;  1NUB A;  2JWW A;  4GGF A;  1LR9 A;  5CSN A;  1CDL A;  2K8M B;  3O2P A;  2H61 A;  3OP0 A;  2L0P A;  2ZNE A;  1TOP A;  4GGN A;  1CGJ I;  4P2Y B;  1CT2 I;  1PJU A;  2M49 B;  1SW8 A;  3VGO A;  3CS1 A;  1KWO C;  1LVC D;  2JTZ A;  2VRG A;  3D10 A;  4WQ3 A;  5DKN A;  1QAT A;  4A4C A;  4ZCU A;  5DAE A;  4CPV A;  2P6A C;  1GQM A;  4PE1 A;  2EC6 B;  1AHR A;  4OKH A;  1J55 A;  1RRO A;  3EKJ A;  1S5G Z;  1XFU O;  1SL9 A;  1YRU B;  2PSR A;  2Q91 A;  5K89 A;  4NDB A;  1F55 A;  3D0Y B;  1TNP A;  4JPZ B;  2DOQ A; 
#chains in the Genus database with same CATH topology
 3O4X A;  3BYA A;  1CE3 A;  2Y0M A;  4YGB B;  2L8E A;  1EJ3 A;  1F4O A;  1PTR A;  2JXL A;  1NYA A;  3EG5 B;  3HH2 C;  1K94 A;  1Z7K B;  3KEV A;  2H2K A;  1YU6 C;  4GUK A;  5ER5 A;  1NIW A;  1FAQ A;  2I7A A;  3BJH A;  1N65 A;  1NWD A;  2ODD A;  4F7F A;  2LM5 A;  1C7V A;  1CLB A;  3PAL A;  3GOX A;  2JYY A;  3H4S E;  5E3R A;  1DC1 A;  1W7J B;  1UUC A;  4YGA A;  2O60 A;  3VRO A;  2MJW B;  2LVK A;  2A20 A;  1K2H A;  2X3T A;  2KQ6 A;  3CXL A;  3PM2 A;  3AKB A;  4OVN F;  3FC3 A;  3VRR A;  1BF5 A;  2Y1N A;  2PQ8 A;  1W3S A;  3RM1 A;  1DTL A;  3R5A A;  1PPF I;  1OVO A;  1BR4 B;  4AQI A;  1FF1 A;  2JU0 A;  2PRU A;  2JZI A;  4INW A;  2BUS A;  2M7N A;  1KK7 Z;  2ERW A;  3GOF A;  1TN4 A;  1RFJ A;  4USL A;  3TUY B;  1TCO B;  2YQP A;  1TGS I;  1OMU A;  1B8R A;  1DT7 B;  2AUC A;  3AKA A;  1OMR A;  2M3W A;  3M0W A;  2ORV A;  2OTG B;  1GM0 A;  4FTG A;  4MRX A;  2WVJ A;  4GPL B;  4IJ7 A;  2KMO A;  1LIN A;  2SGF I;  2DIP A;  1N0Y A;  1OOH A;  1QAS A;  5CPV A;  4GFT A;  1L2O C;  1UHA A;  4JCV E;  3S0A A;  2ZFD A;  1XYD A;  4HSZ A;  2M5X A;  4ZCV A;  1K90 D;  3R5C A;  3PDN A;  1SSE B;  1ZUZ A;  1PTQ A;  4TNC A;  5EL2 A;  4DCK A;  1G8I A;  3TO9 A;  1CM1 A;  1XFR A;  3R5D A;  1K7V A;  4WQ2 A;  1BUS A;  3SIB A;  3D76 A;  2LLT A;  2KMR A;  2KLE A;  3BXK A;  1TWO A;  2NU1 I;  2H61 C;  3SJS A;  4XYN A;  4YGE B;  1MQ1 A;  2Y5I A;  1LKJ A;  4ICB A;  2LV7 A;  2LHI A;  4SGB I;  1Y1B A;  1FYB A;  2KBI A;  1IQ3 A;  5FI6 A;  2GKV A;  2KPH A;  5CSI A;  3JTD B;  1K96 A;  1CT4 I;  1FY7 A;  4DS7 A;  1SNL A;  2KFH A;  2J87 A;  3DVE A;  2NCO A;  1NX0 A;  1KMA A;  2OS8 B;  1CB1 A;  1TBN A;  1J7Q A;  5TNC A;  5CCM A;  2G9B A;  4YRU A;  3OX5 A;  2V53 A;  1VDD A;  2JNF A;  4MZK A;  2JZM A;  1SGD I;  1UVG A;  3KHE A;  7WGA A;  1XFY O;  1K9P A;  3DVK A;  1NSH A;  2JT3 A;  3QAH A;  1F54 A;  1CMG A;  1J7R A;  3D0Y A;  5J8C A;  1LA3 A;  2KAY A;  1FBV A;  3HX4 A;  1AJ5 A;  1KK8 C;  5PAL A;  3GK4 X;  1RK9 A;  4MZJ A;  2FCE A;  2SCP A;  3EK4 A;  4M2Q A;  4MSP A;  3R1V A;  1UHH A;  5KSZ A;  5FI7 A;  3UOE A;  1K7T A;  1PSB A;  5J3X A;  1UHK A;  1XFX O;  3WHU B;  2A4J A;  2N52 A;  1ORG A;  1YX8 A;  2KAX A;  1TBR R;  2WCF A;  4I5J A;  3PM8 A;  1SCM C;  4XJK A;  1WLM A;  4OR9 B;  3DYE A;  4PCW A;  2NZ0 A;  4FKD A;  1IY5 A;  4F0Z B;  5JJG A;  2KGB C;  2PQL A;  2BBM A;  3AAJ A;  1LR8 A;  5I2L A;  2ERB A;  4PT1 A;  4U8D A;  2K2F A;  4PE0 A;  2PAL A;  2E6W A;  5DIC A;  1SK6 D;  2L51 A;  3A4U B;  2WCY A;  2KI4 B;  2NU4 I;  2KYF A;  3EVV A;  1CSO I;  2JTT A;  3LLE A;  3VB1 A;  1SYM A;  4PHJ A;  1GJY A;  3I5H B;  3N7H A;  1RFH A;  3I5F B;  3I5G C;  1GGZ A;  2FJY A;  2L4H A;  1MT1 A;  3CR2 A;  2BNX A;  2TN4 A;  1REC A;  3CR4 X;  5HKY A;  2QPO A;  2GGM A;  3SG4 A;  3CAB A;  2KCX A;  1A03 A;  2CWF A;  1DJG A;  2K9H A;  1WRL A;  3VRN A;  2CCM A;  2GGZ A;  1SKT A;  1TNW A;  2LLS A;  2X52 A;  1DJW A;  2CWH A;  1Q80 A;  3ICB A;  4KYN A;  1M63 B;  1NUB A;  3OXF A;  2K8M B;  2WC6 A;  3O2P A;  3TOB A;  2ORW A;  2B8T A;  2M49 B;  1SW8 A;  3VGO A;  3CS1 A;  2JTZ A;  4WQ3 A;  1TOT A;  4ZCU A;  1GQM A;  1AHR A;  1RRO A;  3R1P A;  1SL9 A;  4NDB A;  1F55 A;  3D0Y B;  4OVO A;  1V1F A;  2F3C I;  1XK4 C;  1SR6 C;  3UFF A;  1P9G A;  2MLE C;  2PVB A;  4QJ5 B;  5GQQ C;  4PE4 A;  1S1E A;  1Z2C B;  2BL0 C;  3D77 A;  1IJ6 A;  1OMD A;  4GAO A;  4PHN A;  3SS5 A;  1QV0 A;  3DD4 A;  1MHO A;  2HET A;  1TCF A;  4L9M A;  1W9Z A;  3ZWH A;  2QEB A;  5I2Q A;  3OL0 A;  3LL8 B;  2KDH A;  1EL4 A;  4PAL A;  3L4A A;  1XBT A;  4GNK B;  4XJK B;  1AJ4 A;  2LAN A;  5D3O A;  2WOS A;  2FJU B;  1DEK A;  3LCP C;  1KBE A;  3A8R A;  1K95 A;  1SGR I;  2L5X B;  1YTZ C;  2HQ8 A;  3DXL A;  2AAO A;  3DY9 A;  1TIH A;  3BFA A;  4JWQ A;  2UVO A;  1WLZ A;  1X02 A;  1ULN A;  1HPT A;  2M1U A;  1F4Q A;  1KFU L;  4MLW A;  3NSK A;  3PLF B;  1HJA I;  3B87 A;  5HYD A;  4C0K A;  2QDI A;  1IJ5 A;  2OVO A;  1TUR A;  1CNP A;  1EH2 A;  3I5I B;  3OB2 B;  2RIJ A;  1JF0 A;  3UNW A;  1A75 A;  1QXP A;  2WC5 A;  1CT0 I;  1P9Z A;  4N1F A;  1SGQ I;  1A2X A;  1IKU A;  2WCM A;  2E30 A;  3KPX A;  1EG4 A;  2WGC A;  3UEJ A;  2LVJ A;  3TO6 A;  2L50 A;  3IF7 A;  5JOL A;  2E73 A;  1LS8 A;  2M8U A;  2JA1 A;  1ZMZ A;  4FQT A;  2KYC A;  4A24 A;  5BPJ A;  1NCZ A;  2R2I A;  1BJF A;  5HKZ A;  4OZD A;  1MJB A;  2LE9 B;  2EGD A;  2BE4 A;  2LCP A;  3TDU A;  2CBL A;  1JWD A;  1JUO A;  3D73 A;  1S26 D;  4GGF C;  2I18 A;  2SAS A;  3B86 A;  2LUY A;  1PRW A;  1SY9 A;  3S0B A;  1NCY A;  2KFG A;  4C0J A;  4UXH A;  3CZ0 A;  2MLF C;  3S0G A;  2JC2 A;  2QEO A;  4R1E A;  5HLV A;  1TBO A;  1PK0 D;  3CWG A;  5HQ8 A;  1CDN A;  2OPO A;  2PMY A;  2M29 A;  1CKK A;  1P28 A;  2LB7 A;  1SCV A;  4DRW A;  4PDZ A;  4DIR A;  2LMV A;  1SRA A;  4QJ4 B;  1BOC A;  2K60 A;  1QX5 B;  1JFJ A;  2DB6 A;  1J1E A;  3NHI A;  3CYZ A;  4E1R A;  1R79 A;  2KSP A;  4P5O E;  3TS5 B;  3JVT B;  1S36 A;  4B6D A;  1H4B A;  1WY9 A;  4ORA B;  1K7U A;  2QEV A;  1JBA A;  2K2A A;  2V1C C;  1WRZ A;  1OMT A;  1DJZ A;  1RJV A;  1QTX A;  3FE6 A;  1FPW A;  4CLN A;  2PAS A;  3S0D A;  4I5L B;  1K9K A;  2LVI A;  4MZL A;  1Y6W A;  1A75 B;  1B1G A;  3IQO A;  2KBM A;  3UO9 A;  3VRQ A;  1JF2 A;  5DKR A;  1MXL C;  1WKX A;  3NGV A;  2GV5 A;  3B7A A;  1NP8 A;  1IH0 A;  5HI7 A;  3UEY A;  2WCH A;  4PHM A;  1KSO A;  2ZN9 A;  1IIO A;  1TBQ R;  1RTP 1;  4NDD A;  5AEQ A;  1KQM C;  2OZU A;  3PSR A;  5AER A;  1OE9 B;  4ORB B;  5AAN A;  3D00 A;  2PYQ A;  2RGI A;  3EVR A;  4DUQ A;  1AP4 A;  1B47 A;  3BOW A;  2F33 A;  4E68 A;  3BFH A;  3PN7 C;  3MEK A;  3B4V C;  2K7C A;  1UWO A;  2SGD I;  2F8P A;  2JPT A;  1YUU A;  1M31 A;  1AK8 A;  5HLO A;  1SGE I;  1BR1 B;  3UGI A;  2MA2 A;  1IG5 A;  2LVV A;  2L2C A;  5FI2 A;  3BUO B;  3SG3 A;  3PJI A;  2KMQ A;  2M9G A;  1SL8 A;  1WDC C;  1JC2 A;  3QTL D;  3OHM B;  5J8F A;  1KSM A;  2AMI A;  1MF8 B;  1LR9 A;  5CSN A;  2H61 A;  3FE9 A;  2ZNE A;  1PJU A;  3RZS A;  4GGN A;  1CGJ I;  4P2Y B;  1CT2 I;  1KWO C;  1LVC D;  1DEL A;  5DKN A;  2J9R A;  4A4C A;  4CPV A;  1TNP A;  2Q91 A;  5K89 A;  4JPZ B;  3V2L A;  4JQ0 D;  3CZT X;  2O5G A;  2WCB A;  3CR5 X;  1YUT A;  2F3Y A;  1A4P A;  4JKT A;  1B8L A;  3NSO A;  1S6J A;  1OQP A;  2CTN A;  1R6P A;  4INX A;  1J7P A;  5IBW A;  3SS4 A;  4I5K A;  2ELI A;  2SGP I;  1CFF A;  2RC4 A;  1M39 A;  2WOR A;  4I5N B;  3BFB A;  2EC6 C;  4CFR A;  2NU3 I;  1SMG A;  1Z4H A;  2Y4Q A;  3SEK C;  1IY6 A;  1M8C A;  3GK2 A;  2KNE A;  2ENZ A;  4C0L A;  1FW4 A;  1XA5 A;  1YR5 A;  1UHJ A;  1ULM A;  1XFV O;  2GIV A;  3VDP A;  3K21 A;  1TNQ A;  1WGC A;  3GK1 A;  1G33 A;  1UUR A;  3DVM A;  2MBX A;  4YGD B;  3OB1 B;  1SBJ A;  1XX6 A;  4HRG A;  3OVO A;  5I8N A;  3BOW B;  1H8B A;  2KI6 C;  4UXJ A;  1EG3 A;  2Y1M A;  1S20 A;  4OV2 A;  2K7O A;  1T14 A;  1IGV A;  3CZ2 A;  2CT9 A;  2ZRS A;  1A29 A;  2QPT A;  1L2O B;  2NLN A;  3QME A;  4MEW A;  4YBH B;  3VRP A;  1BLQ A;  1MXE A;  3D74 A;  1U5I A;  1AUI B;  2QQD A;  2IS9 A;  1V1H A;  1PUL A;  3QWP A;  3BUX B;  2KAV A;  2KGR A;  1QX7 A;  1CFP A;  3HCM A;  3DF0 A;  1DVI A;  5AXI A;  2MHH A;  1W7I B;  3C1V A;  4WP4 A;  1CTR A;  4MN0 A;  2WCE A;  1S3P A;  1XA6 A;  3EK8 A;  3FIA A;  2LHL A;  3TUY C;  1J1D A;  5KU1 A;  2GVI A;  2SGE I;  3OXG A;  1AN1 I;  4MPI A;  2ZRT A;  1TUJ A;  1DMO A;  1Q9B A;  1M45 A;  4NDC A;  4MBE A;  2K7D A;  2OTG C;  1YVH A;  1Y0V H;  3OGN A;  1YX7 A;  1MR8 A;  4N5X A;  4IL1 A;  3L47 A;  1OZS A;  2LMT A;  3D78 A;  1SGY I;  3LK0 A;  2N1A B;  1DGV A;  1FI6 A;  4CFQ A;  4YGC B;  3OBV A;  1CLL A;  2CNP A;  1BG1 A;  4YI8 A;  2Q4U A;  5D7F A;  3CZ1 A;  1KFU S;  2SGQ I;  2OD1 A;  1XK4 A;  2L5Y A;  2F2P A;  4HRH A;  2LUX A;  1KK8 B;  4GBA A;  3IQQ A;  1RWY A;  1DGU A;  1KK7 Y;  4DNC A;  2JT8 A;  1PVA A;  3NSL A;  4AOM A;  1PVB A;  2L98 A;  1OW4 A;  1OYV I;  1NX3 A;  5G08 A;  5JHW C;  4HRE E;  3VDU A;  2NU0 I;  3PAT A;  1TTX A;  3KO0 A;  3JTD C;  5AFP A;  1OSA A;  2UZ3 A;  1OOJ A;  2KLD A;  2VRW B;  1PAL A;  2LUC A;  1CLM A;  1C7W A;  2OS8 C;  1K9U A;  1MWN A;  3FWC A;  1DF0 A;  1SCM B;  3EKH A;  1DQE A;  5FUW A;  1HDL A;  4ETO A;  2D8N A;  2WCL A;  5I2O A;  5FUX A;  4PHK A;  1FI5 A;  5E3P A;  2M1K B;  3IVT A;  3BJI A;  1IWQ A;  1ZFS A;  1U5I B;  4JD9 A;  2B1U A;  1DJH A;  1KQV A;  1B9A A;  3PFV A;  1XFW O;  2QQC A;  1ODB A;  1V1G A;  3SG6 A;  2JXC A;  2E5R A;  3DZT A;  3R1O A;  2ZKM X;  1SL7 A;  1Y1A A;  1JSA A;  4UXI A;  3DF0 B;  4CID A;  3FWB A;  1HEV A;  5EX3 A;  2KHN A;  5FUY A;  1KFX S;  3I5G B;  1QVI Y;  1X74 A;  2OU2 A;  2BCX A;  2M97 A;  5B8I B;  2P71 A;  3WXA A;  1F8H A;  4ORC B;  3KF9 A;  4N1G A;  2N17 A;  3E2I A;  2L2E A;  3BUM B;  1KFX L;  3WHT B;  2LEO A;  1DJY A;  1V1I A;  1LXF C;  1SGN I;  1Y8F A;  2H8V A;  1N2D A;  2DKV A;  1DS2 I;  3F45 A;  4YI9 A;  1IQ5 A;  3R5B A;  2KI4 C;  2QQ0 A;  2ISD A;  4UPG A;  3E3R A;  5CSF A;  1U5K A;  1ALW A;  1OOG A;  4BY4 A;  1LA0 A;  1HQV A;  2ENN A;  3Q8I A;  1SPY A;  1Y1X A;  3O4Y A;  1XFZ O;  2QQE A;  3CLN A;  2BKI B;  1BMO A;  2K61 A;  3I5H C;  1SR6 B;  2LAP A;  3SG5 A;  5DKQ A;  3I5F C;  3EK7 A;  1UUS A;  4PE7 A;  1HT9 A;  1K93 D;  3WNX B;  2BL0 B;  2JWW A;  4GGF A;  3OP0 A;  2L0P A;  1TOP A;  2VRG A;  1QAT A;  4PE1 A;  4OKH A;  1J55 A;  3EKJ A;  1YRU B;  2PSR A;  4FQO A;  2DOQ A;  1ALV A;  3BUW B;  2MRD A;  3QRX A;  1C07 A;  2W0T A;  1N13 A;  4AML A;  1DJI A;  5I94 A;  1DF0 B;  1MJ9 A;  1WGT A;  2WCK A;  2HF5 A;  1EXR A;  2YUU A;  2KFF A;  2LMU A;  2JRF A;  2GKR I;  1OOF A;  2I94 A;  2I2R E;  1UHN A;  1DS3 I;  1PSR A;  2YGU A;  1QLK A;  2B0U C;  1YTP A;  1YUS A;  1QLS A;  2JQ6 A;  3B6X A;  5E3Q A;  3NXA A;  1B7T Y;  2G2B A;  1QVI Z;  1AVS A;  2V1C A;  1MJA A;  1L7Z A;  1OMV A;  1C3Y A;  2FNF X;  1CM4 A;  2CWG A;  2JW6 A;  3KY9 A;  2JNX A;  3CTN A;  2EHB A;  2JXD A;  2WND A;  3FS7 A;  3SGQ I;  1CGI I;  1FAR A;  5FYX A;  3L4L A;  3E59 A;  3TOA A;  1CFD A;  5D69 A;  3CDN A;  2ZND A;  1BU3 A;  1KBF A;  2MAZ A;  1B8C A;  1K8U A;  2P70 A;  1CDP A;  2K0J A;  3AAK A;  1IRJ A;  3RLZ A;  1KCY A;  1OZO A;  1MUX A;  3TO7 A;  3FSX A;  1QX2 A;  1UP5 A;  2WC8 A;  9WGA A;  2GTE A;  2JUL A;  1NCX A;  2BE6 A;  2FCD A;  2COL B;  3UGD A;  2HPS A;  1CDM A;  4D1E A;  3SGB I;  2L7X A;  1ULK A;  1M8B A;  3I5I C;  2K7B A;  1NX2 A;  1ZAC A;  1TIZ A;  2JPO A;  1CHO I;  4BY5 A;  1CMF A;  1DJX A;  1M46 A;  1XVJ A;  1E8A A;  3CGA A;  5HL1 A;  3OX6 A;  1F70 A;  5FUV A;  1QIW A;  3S0F A;  5F6T A;  2KQY A;  2NCP A;  3TZ1 A;  4M2O A;  1Z2I A;  2KMP A;  1YVL A;  3TDI A;  2KOT A;  2N71 A;  3BQ3 A;  4GI3 C;  1B7T Z;  1YRT B;  1R2U A;  1C3Z A;  1JFK A;  3TDZ A;  2M7L A;  2FOT A;  3SG7 A;  1TRF A;  2LP2 A;  3O78 A;  3D75 A;  2HQW A;  1S5G Y;  2ARP F;  1ZOT B;  2P6B B;  1NPQ A;  3RU0 A;  3FE8 A;  1OOI X;  2BCB A;  1TUS A;  1S6I A;  3NHT A;  2F2O A;  5EX0 A;  2GKT I;  1XO5 A;  2CXJ A;  5ER4 X;  2F3Z A;  1R0R I;  3TJQ A;  2WCJ A;  1GGW A;  4HGU A;  2BKH B;  2BEC A;  4MVF A;  3LK1 A;  5HKW A;  1G4Y R;  3ZNI A;  4WRI A;  1QV1 A;  1J7O A;  5KTY A;  4Q04 A;  1KQM B;  3S0E A;  1D1O A;  1SGP I;  3TS5 C;  3JVT C;  1W4R A;  4NQG A;  2JT0 A;  1WTJ A;  2KI6 D;  3PN7 B;  2CJS C;  3EVU A;  3OXL A;  4OCI A;  1BOD A;  3UGL A;  1QIV A;  2QAC A;  2ZN8 A;  4E1P A;  1H0Z A;  2NXQ A;  3SIA A;  1QWV A;  3R72 A;  3O6B A;  3BUN B;  1IW4 A;  3B88 A;  1QJT A;  1S6C A;  3SG2 A;  2BCA A;  1B4C A;  4QJ3 B;  1QS7 A;  2LNK A;  3NSI A;  2QEH A;  2JOJ A;  4AQJ A;  1LR7 A;  1TUZ A;  1F71 A;  2L4I A;  1NXU A;  3DVJ A;  1CFC A;  1WDC B;  5CCL A;  2LP3 A;  2BBN A;  2LC5 A;  2NU2 I;  1PCE A;  1YUR A;  1UHI A;  1KWO B;  3K1E A;  4MRY A;  5CSJ A;  4A4B A;  2LLU A;  1WRK A;  2BAP A;  3MSE B;  2ROW A;  1BT6 A;  2M0R A;  2XRC A;  3VE5 A;  1Y1C A;  1Y1U A;  4M2P A;  1TNX A;  1VRK A;  1NX1 A;  1CDL A;  1X4S A;  3D10 A;  3FSY A;  3SS3 A;  5DAE A;  2P6A C;  2EC6 B;  1S5G Z;  1XFU O;  1UVF A; 
#chains in the Genus database with same CATH homology
 1V1F A;  3BYA A;  4JQ0 D;  1ALV A;  3BUW B;  3CZT X;  2O5G A;  2MRD A;  2WCB A;  3CR5 X;  1YUT A;  2F3Y A;  2F3C I;  1CE3 A;  1A4P A;  1XK4 C;  3QRX A;  1C07 A;  4YGB B;  2W0T A;  1SR6 C;  1B8L A;  3NSO A;  1N13 A;  1S6J A;  3UFF A;  1FYB A;  2MLE C;  2PVB A;  1DJI A;  1OQP A;  2CTN A;  4QJ5 B;  2L8E A;  1R6P A;  1EJ3 A;  5GQQ C;  1J7P A;  1F4O A;  5IBW A;  1DF0 B;  4PE4 A;  1S1E A;  1PTR A;  2JXL A;  1NYA A;  3OXL A;  2BL0 C;  3HH2 C;  2HF5 A;  1EXR A;  4I5K A;  2YUU A;  2KFF A;  2ELI A;  1IJ6 A;  2LMU A;  1OMD A;  1K94 A;  2SGP I;  4GAO A;  1CFF A;  1Z7K B;  4PHN A;  3KEV A;  2H2K A;  1M39 A;  2JRF A;  2WOR A;  1QV0 A;  4I5N B;  3DD4 A;  1YU6 C;  2I94 A;  2I2R E;  1MHO A;  2HET A;  2EC6 C;  2GKR I;  4CFR A;  2NU3 I;  1UHN A;  1SMG A;  1TCF A;  4L9M A;  4GUK A;  1PSR A;  5ER5 A;  1DS3 I;  1QLK A;  3ZWH A;  5I2Q A;  3OL0 A;  1NIW A;  2Y4Q A;  1FAQ A;  4FQO A;  2I7A A;  3LL8 B;  2B8T A;  3SEK C;  1N65 A;  1IY6 A;  1NWD A;  2ODD A;  1M8C A;  3GK2 A;  2KNE A;  2LM5 A;  2KDH A;  2ENZ A;  1C7V A;  2B0U C;  1YTP A;  1YUS A;  4C0L A;  1CLB A;  1EL4 A;  3PAL A;  1FW4 A;  3GOX A;  1XA5 A;  1YR5 A;  1UHJ A;  4PAL A;  2JYY A;  3H4S E;  1XBT A;  1XFV O;  4GNK B;  1QLS A;  3VDP A;  1W7J B;  1UUC A;  2JQ6 A;  3K21 A;  4XJK B;  4YGA A;  1TNQ A;  3NXA A;  1AJ4 A;  2O60 A;  1B7T Y;  3VRO A;  2MJW B;  2LVK A;  2A20 A;  2G2B A;  3GK1 A;  1K2H A;  1G33 A;  1QVI Z;  2KQ6 A;  2LAN A;  3CXL A;  1AVS A;  2V1C A;  1UUR A;  2WOS A;  3DVM A;  1L7Z A;  2MBX A;  1OMV A;  2FNF X;  4YGD B;  2FJU B;  1CM4 A;  3AKB A;  4OVN F;  3FC3 A;  3OB1 B;  2JW6 A;  3KY9 A;  3VRR A;  2JNX A;  3CTN A;  3LCP C;  2EHB A;  2JXD A;  1KBE A;  1BF5 A;  2WND A;  2Y1N A;  3A8R A;  3FS7 A;  1SBJ A;  3SGQ I;  1W3S A;  3RM1 A;  1DTL A;  1CGI I;  1FAR A;  4HRG A;  1XX6 A;  1K95 A;  1SGR I;  5FYX A;  2L5X B;  1YTZ C;  2HQ8 A;  3OVO A;  5I8N A;  2AAO A;  3BOW B;  2KI6 C;  1H8B A;  1PPF I;  3E59 A;  1TIH A;  1OVO A;  1BR4 B;  4JWQ A;  1CFD A;  4UXJ A;  1EG3 A;  5D69 A;  4AQI A;  1FF1 A;  2ZND A;  2JU0 A;  2Y1M A;  1BU3 A;  2PRU A;  4OV2 A;  1WLZ A;  1X02 A;  2K7O A;  2JZI A;  1KBF A;  2MAZ A;  1IGV A;  2BUS A;  2M7N A;  1KK7 Z;  2CT9 A;  2ERW A;  3GOF A;  1HPT A;  2ZRS A;  1A29 A;  2M1U A;  1TN4 A;  1RFJ A;  4USL A;  1F4Q A;  1KFU L;  2QPT A;  4MLW A;  1L2O B;  3NSK A;  2NLN A;  1B8C A;  3PLF B;  1K8U A;  3TUY B;  1HJA I;  5HYD A;  4C0K A;  1TCO B;  4MEW A;  4YBH B;  3VRP A;  2YQP A;  1CDP A;  1BLQ A;  1MXE A;  2K0J A;  3AAK A;  1TGS I;  1IRJ A;  3RLZ A;  1KCY A;  1OMU A;  1IJ5 A;  1B8R A;  1OZO A;  1DT7 B;  1MUX A;  2OVO A;  2AUC A;  1TUR A;  1U5I A;  3AKA A;  1CNP A;  1EH2 A;  1OMR A;  3I5I B;  3OB2 B;  2M3W A;  3M0W A;  1QX2 A;  1JF0 A;  1UP5 A;  2WC8 A;  1A75 A;  1QXP A;  2ORV A;  1AUI B;  2OTG B;  2QQD A;  1CT0 I;  2IS9 A;  4N1F A;  1V1H A;  1PUL A;  4FTG A;  3QWP A;  2JUL A;  3BUX B;  4MRX A;  2KAV A;  1NCX A;  2BE6 A;  2KGR A;  1SGQ I;  1A2X A;  2WVJ A;  2FCD A;  4GPL B;  1IKU A;  1QX7 A;  2COL B;  1CFP A;  3HCM A;  3DF0 A;  1DVI A;  5AXI A;  2HPS A;  2MHH A;  1W7I B;  2E30 A;  2KMO A;  3UGD A;  3KPX A;  1EG4 A;  1LIN A;  3C1V A;  2DIP A;  2SGF I;  3UEJ A;  1CTR A;  1N0Y A;  2LVJ A;  4MN0 A;  2WCE A;  1S3P A;  1UVF A;  1XA6 A;  1QAS A;  3EK8 A;  3FIA A;  5CPV A;  4GFT A;  1CDM A;  2LHL A;  1L2O C;  3TUY C;  2L50 A;  3IF7 A;  5JOL A;  4D1E A;  4JCV E;  2ZFD A;  2L7X A;  1J1D A;  3SGB I;  2E73 A;  1XYD A;  2M8U A;  5KU1 A;  1M8B A;  2GVI A;  2JA1 A;  1ZMZ A;  4HSZ A;  2M5X A;  2SGE I;  3OXG A;  1AN1 I;  2ZRT A;  1DMO A;  3I5I C;  2K7B A;  2KYC A;  1M45 A;  4NDC A;  1NX2 A;  4MBE A;  4ZCV A;  1K90 D;  2K7D A;  4A24 A;  1ZAC A;  2OTG C;  5BPJ A;  1YVH A;  1NCZ A;  3PDN A;  1Y0V H;  2R2I A;  1BJF A;  1ZUZ A;  5HKZ A;  1TIZ A;  1PTQ A;  4TNC A;  1YX7 A;  1MR8 A;  2LE9 B;  4N5X A;  1CHO I;  2EGD A;  4IL1 A;  4BY5 A;  2BE4 A;  2LCP A;  3TDU A;  1OZS A;  4DCK A;  1G8I A;  2LMT A;  1CMF A;  1CM1 A;  2CBL A;  1JWD A;  1SGY I;  4WQ2 A;  1BUS A;  1DJX A;  1JUO A;  1M46 A;  3LK0 A;  3SIB A;  2N1A B;  1XVJ A;  2LLT A;  1DGV A;  1E8A A;  1S26 D;  3CGA A;  1FI6 A;  4GGF C;  2KMR A;  2I18 A;  2SAS A;  3BXK A;  2LUY A;  2NU1 I;  2H61 C;  4CFQ A;  1PRW A;  1SY9 A;  1NCY A;  2KFG A;  3SJS A;  4YGC B;  4C0J A;  2ORW A;  4UXH A;  4XYN A;  4YGE B;  1CLL A;  1MQ1 A;  3OX6 A;  2CNP A;  1F70 A;  1BG1 A;  2Y5I A;  4YI8 A;  2MLF C;  5FUV A;  1QIW A;  1LKJ A;  2Q4U A;  4ICB A;  2JC2 A;  5F6T A;  2LV7 A;  2LHI A;  4R1E A;  5D7F A;  5HLV A;  1TBO A;  4SGB I;  1Y1B A;  1PK0 D;  2KBI A;  3CWG A;  1IQ3 A;  5HQ8 A;  1KFU S;  2KQY A;  1CDN A;  2NCP A;  5CSI A;  2GKV A;  3JTD B;  1K96 A;  3TZ1 A;  2SGQ I;  2OD1 A;  1CT4 I;  4M2O A;  2OPO A;  4DS7 A;  1SNL A;  1XK4 A;  2KMP A;  2KFH A;  2PMY A;  2J87 A;  1YVL A;  3DVE A;  2M29 A;  2F2P A;  2KOT A;  3TDI A;  4HRH A;  2NCO A;  2N71 A;  1NX0 A;  2LUX A;  1KMA A;  1CKK A;  3BQ3 A;  4GI3 C;  2OS8 B;  1CB1 A;  1TBN A;  1KK8 B;  4GBA A;  3IQQ A;  1RWY A;  1B7T Z;  1J7Q A;  5TNC A;  5CCM A;  2G9B A;  4YRU A;  1DGU A;  3OX5 A;  1YRT B;  2V53 A;  1VDD A;  1KK7 Y;  2JNF A;  1SCV A;  4MZK A;  4DRW A;  2JZM A;  4PDZ A;  4DIR A;  2JT8 A;  1PVA A;  1R2U A;  2LMV A;  1SGD I;  3NSL A;  1SRA A;  1UVG A;  3KHE A;  4AOM A;  1JFK A;  1PVB A;  1XFY O;  2M7L A;  3TDZ A;  1K9P A;  4QJ4 B;  2L98 A;  3DVK A;  1NSH A;  2FOT A;  1OYV I;  3SG7 A;  2JT3 A;  1BOC A;  1NX3 A;  1TRF A;  5G08 A;  2LP2 A;  1F54 A;  1QX5 B;  5JHW C;  1JFJ A;  2DB6 A;  4HRE E;  3VDU A;  2NU0 I;  3PAT A;  3O78 A;  1CMG A;  1J7R A;  2HQW A;  1J1E A;  3D0Y A;  1S5G Y;  1TTX A;  3KO0 A;  4E1R A;  1R79 A;  3JTD C;  5AFP A;  2KSP A;  2ARP F;  1OSA A;  1LA3 A;  1ZOT B;  2KAY A;  2P6B B;  4P5O E;  2UZ3 A;  1OOJ A;  2VRW B;  1PAL A;  2LUC A;  1NPQ A;  1FBV A;  3RU0 A;  3TS5 B;  3HX4 A;  3JVT B;  1CLM A;  1C7W A;  2BCB A;  2OS8 C;  1TUS A;  1S36 A;  4B6D A;  1AJ5 A;  1S6I A;  1H4B A;  1KK8 C;  5PAL A;  1K9U A;  2F2O A;  1MWN A;  3GK4 X;  1RK9 A;  1WY9 A;  5EX0 A;  2GKT I;  4ORA B;  3FWC A;  1DF0 A;  1XO5 A;  1JBA A;  1SCM B;  2FCE A;  4MZJ A;  2CXJ A;  2SCP A;  3EKH A;  5ER4 X;  2K2A A;  2F3Z A;  3EK4 A;  4M2Q A;  1R0R I;  2V1C C;  3TJQ A;  1WRZ A;  1OMT A;  4OVO A;  1DJZ A;  1GGW A;  4MSP A;  5FUW A;  1RJV A;  1HDL A;  4ETO A;  1QTX A;  2D8N A;  4HGU A;  2BKH B;  2BEC A;  1FPW A;  4CLN A;  4MVF A;  1UHH A;  3LK1 A;  5KSZ A;  5HKW A;  5I2O A;  5FUX A;  4PHK A;  1FI5 A;  2PAS A;  1G4Y R;  3ZNI A;  4I5L B;  4WRI A;  1K9K A;  1QV1 A;  1PSB A;  2M1K B;  1J7O A;  3BJI A;  5KTY A;  5J3X A;  1UHK A;  4Q04 A;  1IWQ A;  1KQM B;  1XFX O;  3WHU B;  1ZFS A;  1U5I B;  2A4J A;  2LVI A;  4MZL A;  2N52 A;  2B1U A;  1Y6W A;  1D1O A;  1DJH A;  1KQV A;  1SGP I;  1B9A A;  3PFV A;  3JVT C;  3TS5 C;  1A75 B;  1W4R A;  1XFW O;  1B1G A;  3IQO A;  4NQG A;  2QQC A;  1ODB A;  1V1G A;  2KBM A;  2JT0 A;  3SG6 A;  2JXC A;  1YX8 A;  2KAX A;  1TBR R;  2WCF A;  3VRQ A;  1JF2 A;  5DKR A;  4I5J A;  2E5R A;  2KI6 D;  3PM8 A;  3PN7 B;  2ZKM X;  2CJS C;  1MXL C;  1SCM C;  3EVU A;  1SL7 A;  1WLM A;  1Y1A A;  4OCI A;  4OR9 B;  4XJK A;  1BOD A;  1JSA A;  4UXI A;  3UGL A;  1QIV A;  3DF0 B;  2QAC A;  4PCW A;  3FWB A;  4CID A;  5EX3 A;  2KHN A;  2NZ0 A;  4FKD A;  2ZN8 A;  4E1P A;  1IY5 A;  1H0Z A;  5FUY A;  2NXQ A;  4F0Z B;  5JJG A;  1KFX S;  2GV5 A;  2KGB C;  3SIA A;  3I5G B;  1NP8 A;  2BBM A;  3AAJ A;  3O6B A;  1QVI Y;  1IH0 A;  5HI7 A;  3UEY A;  1LR8 A;  3BUN B;  1IW4 A;  1X74 A;  4PHM A;  1KSO A;  2ZN9 A;  5I2L A;  1TBQ R;  1RTP 1;  4U8D A;  1QJT A;  1S6C A;  2K2F A;  2BCX A;  2PAL A;  4PE0 A;  3SG2 A;  2BCA A;  2E6W A;  4QJ3 B;  1B4C A;  4NDD A;  5AEQ A;  1QS7 A;  1SK6 D;  1KQM C;  2L51 A;  2LNK A;  3A4U B;  2M97 A;  3NSI A;  3PSR A;  2WCY A;  5B8I B;  5AER A;  2KI4 B;  1OE9 B;  4ORB B;  3WXA A;  1F8H A;  2JOJ A;  4AQJ A;  2NU4 I;  2KYF A;  5AAN A;  3EVV A;  1CSO I;  4ORC B;  3D00 A;  2JTT A;  2RGI A;  3KF9 A;  3EVR A;  3LLE A;  4N1G A;  4DUQ A;  1AP4 A;  1LR7 A;  2N17 A;  1SYM A;  4PHJ A;  3E2I A;  1F71 A;  2L4I A;  2L2E A;  1B47 A;  3BOW A;  3DVJ A;  1CFC A;  2F33 A;  4E68 A;  1WDC B;  3PN7 C;  3MEK A;  2LP3 A;  3B4V C;  5CCL A;  2K7C A;  1GJY A;  1KFX L;  2BBN A;  3BUM B;  3I5H B;  1UWO A;  2SGD I;  2F8P A;  2LC5 A;  2JPT A;  1RFH A;  3WHT B;  1YUU A;  3I5F B;  2LEO A;  1M31 A;  1DJY A;  3I5G C;  1AK8 A;  5HLO A;  1SGE I;  1GGZ A;  1BR1 B;  1V1I A;  1LXF C;  1SGN I;  1Y8F A;  2NU2 I;  1PCE A;  1YUR A;  2L4H A;  3UGI A;  2MA2 A;  1UHI A;  1MT1 A;  1N2D A;  1IG5 A;  3CR2 A;  1DS2 I;  2LVV A;  3F45 A;  1KWO B;  2TN4 A;  1REC A;  4YI9 A;  3CR4 X;  1IQ5 A;  5HKY A;  4MRY A;  5CSJ A;  2QPO A;  2KI4 C;  2QQ0 A;  2ISD A;  2GGM A;  3E3R A;  4A4B A;  5CSF A;  4UPG A;  3SG4 A;  3BUO B;  1U5K A;  1ALW A;  3SG3 A;  4BY4 A;  1LA0 A;  1HQV A;  2LLU A;  2ENN A;  1SPY A;  1WRK A;  2KCX A;  2KMQ A;  1Y1X A;  3MSE B;  3O4Y A;  1XFZ O;  2M9G A;  1A03 A;  3CLN A;  2QQE A;  2ROW A;  1BT6 A;  2M0R A;  2XRC A;  1SL8 A;  1WDC C;  1DJG A;  2BKI B;  1JC2 A;  2K9H A;  3QTL D;  3VE5 A;  1Y1C A;  3OHM B;  1Y1U A;  4M2P A;  1WRL A;  1BMO A;  2K61 A;  3I5H C;  1SR6 B;  3VRN A;  2CCM A;  1TNX A;  2LAP A;  3SG5 A;  2GGZ A;  1SKT A;  3I5F C;  5DKQ A;  1TNW A;  3EK7 A;  1KSM A;  2LLS A;  1DJW A;  2AMI A;  1VRK A;  1Q80 A;  3ICB A;  1UUS A;  4PE7 A;  1M63 B;  1HT9 A;  1K93 D;  1MF8 B;  3WNX B;  1NX1 A;  2BL0 B;  1NUB A;  2JWW A;  4GGF A;  1LR9 A;  5CSN A;  3OXF A;  1CDL A;  2K8M B;  3O2P A;  2H61 A;  3OP0 A;  2L0P A;  2ZNE A;  1TOP A;  4GGN A;  1CGJ I;  4P2Y B;  1CT2 I;  1PJU A;  2M49 B;  1SW8 A;  3VGO A;  1X4S A;  3CS1 A;  1KWO C;  1LVC D;  2JTZ A;  2VRG A;  3D10 A;  4WQ3 A;  1TOT A;  5DKN A;  2J9R A;  1QAT A;  4A4C A;  4ZCU A;  5DAE A;  4CPV A;  2P6A C;  1GQM A;  4PE1 A;  2EC6 B;  1AHR A;  4OKH A;  1J55 A;  1RRO A;  3EKJ A;  1S5G Z;  1XFU O;  1SL9 A;  1YRU B;  2PSR A;  2Q91 A;  5K89 A;  4NDB A;  1F55 A;  3D0Y B;  1TNP A;  4JPZ B;  2DOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...