1NUBA

Helix c deletion mutant of bm-40 fs-ec domain pair
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
226
structure length
226
Chain Sequence
APCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BASEMENT MEMBRANE PROTEIN BM-40
publication title Crystal structure and mapping by site-directed mutagenesis of the collagen-binding epitope of an activated form of BM-40/SPARC/osteonectin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Extracellular module
total genus 71
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
A PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nubA02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1nubA01
2KGBC 4GBAA 1IQ5A 1ALWA 1QJTA 1QX7A 5JOLA 4DCKA 1YU6C 3OVOA 4A4BA 2IS9A 3PALA 1XVJA 3A4UB 2JPTA 2OVOA 5JHWC 1DJZA 2O5GA 3VGOA 2QPTA 1WRKA 1XK4C 1QTXA 1B8CA 1J7RA 1QLSA 3VRPA 1F70A 1QIWA 2JZMA 3SG4A 1IRJA 3EK7A 1J55A 1W7IB 2LCPA 5HLVA 4CFQA 2LLSA 1C07A 1IW4A 1HJAI 1RTP1 2ZNEA 1NUBA 1BU3A 5GQQC 2M29A 2LMUA 2SASA 2Q91A 1IKUA 1KFUL 1WDCC 1S26D 4MBEA 2GGMA 2COLB 1XFUO 2KFFA 2OS8B 5G08A 1SR6B 2M7LA 1HQVA 1NIWA 1CDNA 2L51A 1CM1A 2VRGA 3TDIA 1FI5A 2G9BA 1XFXO 1QASA 5K89A 3KPXA 4AQIA 1R6PA 1EL4A 3JTDC 4YGAA 3IQQA 2EHBA 3IF7A 3FWCA 2L2EA 1M39A 2K2AA 3TDZA 1KK8C 3BUXB 1BF5A 1PALA 1NP8A 3LCPC 1CFCA 4YI9A 2KI4B 2KFGA 1CTRA 2L4IA 2AMIA 4CIDA 1SGQI 1IY6A 1CMFA 2I94A 2GV5A 4WRIA 1CT2I 1UHNA 2I2RE 3HCMA 1BJFA 1RWYA 1L2OB 1DVIA 2KCXA 1IG5A 2M7NA 3DVKA 1MT1A 1OYVI 1MF8B 1QVIY 1KFUS 2CNPA 1PVBA 3VRQA 2KBMA 1CMGA 3I5HC 1UHIA 1SGDI 2N52A 1HT9A 1NYAA 2F2PA 4TNCA 1DF0B 3PN7B 2OTGC 2EC6C 3E3RA 4QJ5B 1MHOA 2FJUB 2JULA 4SGBI 1DF0A 1YTZC 2LV7A 2LLTA 1IGVA 2WOSA 3GK4X 1DGUA 1OMDA 2MAZA 1TCOB 3AKAA 3I5GC 1JBAA 3I5IB 2KFHA 4MRXA 1KK7Z 4YGBB 2KMPA 2MRDA 5AFPA 3SJSA 2JXDA 2M5XA 4MRYA 3TJQA 1EXRA 2D8NA 2BCXA 2ISDA 3PFVA 1TNXA 2AAOA 3QRXA 1G8IA 2L98A 4JWQA 2NU4I 1B9AA 1K95A 4E68A 1GJYA 1TURA 1LA3A 2BCBA 2WC8A 1JC2A 1ZOTB 1S6CA 4C0KA 2LE9B 2ZNDA 1A03A 2KGRA 1S36A 1S3PA 2KI6C 3ZWHA 1FYBA 1B8LA 2HETA 1A29A 4YI8A 1WY9A 1K9UA 1UHHA 1F4QA 1X02A 3FS7A 1F8HA 3EKHA 3O6BA 1NX0A 2JTZA 2ZRSA 4ZCVA 3VRNA 2LAPA 4DIRA 3GK2A 2NZ0A 1CDLA 1KK7Y 1YVHA 2OPOA 2L50A 1OQPA 1B47A 1S6JA 1SK6D 3BUWB 1GGZA 2ZN8A 1CGJI 2K0JA 3HX4A 1SW8A 1TOPA 1YUTA 3SG7A 1QIVA 2BE6A 1K96A 4F0ZB 1IWQA 2NCOA 2M0RA 3VROA 3QTLD 1HDLA 1B7TZ 3I5FC 5PALA 3TUYB 1IY5A 2Y1MA 1PPFI 2M97A 3SGQI 3CR2A 1SGEI 2MA2A 4OKHA 2JYYA 1M63B 4YGEB 1JFJA 2N71A 4OV2A 1FF1A 2WCBA 1JF0A 1YVLA 4MVFA 2JQ6A 2JU0A 2QQDA 1Z7KB 4ORBB 1AJ5A 4M2QA 1VRKA 4DUQA 2JNXA 1NCYA 2BKIB 1E8AA 2JT8A 2KAVA 2SGEI 1DS3I 1PVAA 2ERWA 2I18A 4HSZA 1B7TY 1SR6C 2GKVA 3F45A 1HPTA 3EK4A 1DMOA 4PALA 4PE1A 4Q04A 5DKQA 5KSZA 3VRRA 2KMOA 3B4VC 1OE9B 3KF9A 5B8IB 5KU1A 1OOJA 4C0JA 1TBRR 3C1VA 1BODA 3LLEA 4MZLA 1YUUA 1XFVO 4IL1A 2ZKMX 3CZTX 1OMUA 2WCYA 1JWDA 2WNDA 2JXCA 1KQVA 2F3YA 2ZRTA 4N5XA 2LHLA 2M8UA 3MSEB 5I2LA 1PJUA 1ZUZA 1YRUB 1ZMZA 1B1GA 3WXAA 1ALVA 1BOCA 4HREE 4NDDA 4PHMA 3RLZA 1Q80A 1J1EA 3AAKA 4OCIA 1SRAA 2AUCA 1QV1A 2KHNA 2Y1NA 1H4BA 3TS5C 4GGNA 2H2KA 4FQOA 4GPLB 1TUSA 1SKTA 3DVMA 3PATA 1F71A 1M46A 3O2PA 1F4OA 5CSIA 4ORAB 3CR5X 3NSOA 1IH0A 4AOMA 3H4SE 1Y1CA 1KSOA 1CLBA 3EVVA 2JWWA 2QACA 3EKJA 2ZFDA 2RGIA 1DJXA 5J3XA 1M8BA 1CLLA 2MHHA 4MEWA 1SL7A 1SL8A 1IQ3A 2QQCA 1BR1B 1K9KA 1OSAA 3DVJA 2CTNA 5I2QA 3OX5A 3AKBA 1OZSA 1M8CA 4WQ3A 1SBJA 2XRCA 4PHJA 3EVUA 1D1OA 4YRUA 1M31A 1TGSI 2M49B 3CWGA 1G33A 1QLKA 2KSPA 2NU1I 1ZACA 4N1GA 1UUSA 1MWNA 4XJKB 5CSJA 1BR4B 4A4CA 1WDCB 1DJHA 2K2FA 1U5IB 3OX6A 1SCMC 1YX8A 2NU2I 1Y1AA 4XJKA 1BMOA 4N1FA 3SEKC 4NDCA 2F8PA 1UP5A 1K8UA 2BUSA 1A75B 4D1EA 1QS7A 1U5IA 1RECA 2JXLA 2FOTA 1DJWA 1AJ4A 1SY9A 1S5GZ 4GFTA 1KQMC 4PCWA 2JT0A 1A75A 2WORA 2GKRI 1MUXA 3LK0A 4GGFC 3JTDB 4GUKA 4I5KA 1K93D 1NX1A 4L9MA 1CNPA 4OR9B 4YBHB 1WLZA 5ER4X 2K7BA 2BCAA 2R2IA 1KK8B 3SG2A 2LC5A 2LP3A 1UHKA 1DJYA 2F2OA 5JJGA 1K94A 1R0RI 1KWOC 2MJWB 1Y1BA 2LLUA 2B0UC 1SGYI 1BUSA 2BL0C 2HPSA 1KMAA 3JVTC 4P5OE 4HRGA 4P2YB 1FW4A 2JNFA 3NSLA 4PDZA 2M9GA 1M45A 1RJVA 1TTXA 2JC2A 1FI6A 4AQJA 2PVBA 1Y1XA 3I5HB 2K7OA 2LEOA 4QJ4B 2L4HA 2BE4A 1GGWA 2SGFI 3FIAA 2Y4QA 1EH2A 1LVCD 3BYAA 2GKTI 2CBLA 3PLFB 1PSRA 2EC6B 2OTGB 1KFXL 4CFRA 4CLNA 1CDPA 1J1DA 4HGUA 5HKYA 2KAXA 5HKZA 3HH2C 4I5NB 1UVFA 2KBIA 1J7QA 4JQ0D 3KEVA 2WCEA 1AHRA 3GK1A 3I5GB 4UPGA 1J7PA 1UHJA 1B4CA 1FPWA 3DF0B 1R2UA 2KQ6A 1CKKA 1NPQA 2JT3A 2A4JA 1W7JB 2BBMA 2Y5IA 2NU0I 2JOJA 1B8RA 1V1FA 3OP0A 3WNXB 3KHEA 3NSKA 4PHNA 2CCMA 2PASA 3FWBA 1PCEA 2I7AA 1EJ3A 3NXAA 1WRLA 1NCXA 4DS7A 2LANA 1QXPA 3AAJA 1F54A 1OVOA 1KSMA 1CB1A 2BBNA 1KFXS 2SCPA 5CPVA 3OB2B 1G4YR 4YGDB 3ICBA 3DVEA 1AUIB 2DOQA 2KI6D 2OS8C 2KMQA 1UUCA 2SGQI 1SL9A 3D10A 3TZ1A 2LUXA 5AEQA 3SG6A 1J7OA 4I5LB 2KOTA 5D69A 3RM1A 1DJIA 5DAEA 2NXQA 4DRWA 1OMRA 2EGDA 1NCZA 1IJ6A 1TNQA 4GNKB 1CHOI 1K2HA 1H0ZA 1SPYA 1XO5A 1Y1UA 1PRWA 3I5FB 3IQOA 4MZJA 3KO0A 5DKNA 2KI4C 3O78A 1L7ZA 3CLNA 1SMGA 2KQYA 5ER5A 3SIBA 3SG5A 1BLQA 1L2OC 3DD4A 3BUNB 3CTNA 4MSPA 2MBXA 1SGRI 2KYCA 3M0WA 1V1GA 2K8MB 4XYNA 1OZOA 2LVJA 2H61A 1GQMA 5D7FA 1QV0A 1OMTA 2BECA 2HF5A 2HQ8A 2PMYA 2E30A 2LVIA 5HLOA 2PRUA 2N17A 1JSAA 1N65A 2GGZA 3PN7C 5I8NA 2FCEA 2F3ZA 5DKRA 2KAYA 1MXEA 2PALA 4NQGA 1YURA 1XYDA 1KCYA 4MZKA 3OHMB 1DJGA 2M1KB 1OMVA 2LMTA 3K21A 2SGDI 1TN4A 1QVIZ 1N13A 1DGVA 1SNLA 2HQWA 1YX7A 1TBQR 1RK9A 3I5IC 4ORCB 4BY5A 3BUMB 2CT9A 3WHUB 2PSRA 3CGAA 2MLEC 1XK4A 2O60A 2SGPI 1YR5A 4PHKA 5FYXA 2V53A 1LA0A 1TNWA 2KDHA 3CS1A 1DS2I 1QX2A 2L0PA 1IJ5A 1K9PA 3LL8B 1SGNI 2NCPA 1AK8A 1ODBA 1AN1I 3NSIA 3A8RA 5BPJA 3SGBI 4USLA 2M3WA 1JFKA 1EG3A 2F3CI 4R1EA 1WLMA 1LKJA 1TIHA 5HKWA 3TS5B 4OVOA 1UWOA 2M1UA 1Y6WA 1TIZA 1BT6A 3BXKA 1CFDA 2F33A 2LMVA 3EK8A 3OB1B 2P6AC 1NX3A 2JRFA 4ZCUA 1LXFC 2ZN9A 1DT7B 5I2OA 2K61A 3CR4X 4NDBA 2LUCA 4YGCB 5AXIA 4QJ3B 2LHIA 1CFPA 1YTPA 2KNEA 1FBVA 1BG1A 1CLMA 3LK1A 2LM5A 2BKHB 1MXLC 4ICBA 3ZNIA 3TUYC 1AVSA 1NWDA 1LR8A 1CE3A 5F6TA 2JZIA 2LP2A 1A4PA 4ETOA 1SGPI 4U8DA 5AANA 1CDMA 5KTYA 5TNCA 4M2PA 1UVGA 1QATA 1S5GY 2LVKA 4WQ2A 4MLWA 1S6IA 2B1UA 2P6BB 1EG4A 1TCFA 3BOWB 1PULA 2K7CA 2KYFA 4CPVA 1CGII 4FTGA 3SIAA 5CSFA 1TNPA 3BOWA 1SCMB 1JUOA 1NX2A 5CSNA 4GI3C 1A2XA 2ARPF 1CSOI 1YRTB 3D0YB 1MR8A 1JF2A 2NU3I 1C7WA 1XA5A 2E6WA 2JTTA 2L5XB 1SYMA 3D0YA 5HYDA 1KQMB 4BY4A 1CFFA 1TRFA 3DF0A 1Y0VH 1N2DA 3WHTB 1RROA 1XFZO 4PE0A 1MQ1A 4JPZB 4M2OA 1CT0I 4GGFA 1CM4A 2LNKA 1WRZA 4MN0A 2K7DA 2NLNA 1DTLA 1AP4A 1N0YA 1CT4I 1K90D 1KWOB 3BUOB 2BL0B 4OVNF 3JVTB 1F55A 1YUSA 1ZFSA 2FCDA 1QX5B 2Q4UA 3O4YA 3TDUA 1UURA 1SCVA 3BQ3A 4PE7A 4C0LA 4HRHA 1LINA 3SG3A 2CXJA 1NSHA 2WCFA 1LR9A 2KMRA 2TN4A 2H61C 2LVVA 1C7VA 4PE4A 2MLFC 5IBWA 1PK0D 1S1EA 1XFYO 5AERA 2G2BA 1PSBA 3EVRA 1XFWO 3PM8A 4GAOA 4I5JA 1RFJA 1H8BA 1LR7A 3GOFA 3PSRA
chains in the Genus database with same CATH superfamily
2KGBC 1YU6C 4DCKA 1QX7A 5JOLA 2ENNA 1NXUA 3PALA 5JHWC 3V2LA 1PTQA 1XK4C 3VRPA 2JZMA 3EK7A 1J55A 2LCPA 4CFQA 1C07A 1IW4A 2ZNEA 1NUBA 2SASA 2Q91A 1IKUA 1WDCC 1S26D 2OS8B 2COLB 1HQVA 3L47A 3TDIA 1W3SA 5DICA 5K89A 2DIPA 3IQQA 2L2EA 3TDZA 1BF5A 1CFCA 1CTRA 1CMFA 2GV5A 4WRIA 3HCMA 5CCLA 1RWYA 1IG5A 1U5KA 1MF8B 1KFUS 1CMGA 3FC3A 1UHIA 1HT9A 3PN7B 3L4LA 4FKDA 2FJUB 2N1AB 2LV7A 3QAHA 2WOSA 4YGBB 3SJSA 2M5XA 1TNXA 2AAOA 4JWQA 2ZNDA 1FYBA 3UO9A 4YI8A 1K9UA 2WCMA 1F8HA 3O6BA 1NX0A 3VRNA 2LAPA 3BUWB 1TUJA 2ZN8A 3HX4A 1SW8A 1YUTA 1QIVA 3SS4A 3B7AA 2J9RA 4YGEB 1JFJA 1FF1A 4MVFA 4ORBB 1AJ5A 4M2QA 4DUQA 2L5YA 2BKIB 3N7HA 2JT8A 1DS3I 1PVAA 1GM0A 2I18A 1B7TY 1SR6C 5DKQA 3VRRA 1MJBA 2KMOA 3S0FA 1OE9B 1TBRR 2ERBA 4MZLA 1XFVO 2ZKMX 3CZTX 1C3ZA 3MSEB 3FSXA 3KY9A 1B1GA 1IIOA 1ALVA 4HREE 4PHMA 3RLZA 1Q80A 2RIJA 2AUCA 4GPLB 4FQOA 3DVMA 1M46A 1IH0A 3D73A 1DQEA 1CLBA 2JWWA 3EKJA 5J3XA 1M8BA 2MHHA 4MEWA 4B6DA 2QQCA 1BR1B 5I2QA 1OZSA 3S0EA 1ZACA 1MWNA 4A4CA 1WDCB 2P71A 3OX6A 1U5IB 2NU2I 3UNWA 4XJKA 1BMOA 2BUSA 1K8UA 2JXLA 1FY7A 4PCWA 2JT0A 2WORA 2GIVA 2GKRI 1R79A 4YBHB 1WLZA 2R2IA 2LC5A 3OBVA 1BUSA 3L4AA 2UVOA 3NSLA 1M45A 2JC2A 4A24A 1Y8FA 3BJIA 2QDIA 2JA1A 2WCJA 1PSRA 3CZ0A 3HH2C 5HKZA 2KBIA 1KBFA 1UHJA 3DF0B 1CKKA 1TBNA 2A4JA 1W7JB 7WGAA 1DC1A 1B8RA 3OP0A 3KHEA 4PHNA 2CCMA 1EJ3A 3NXAA 2YUUA 3D78A 1CB1A 4YGDB 3DVEA 2DOQA 3D10A 5AEQA 1J7OA 1DJIA 1SSEB 5DAEA 1OMRA 2EGDA 1IJ6A 1TNQA 1CHOI 1K2HA 1V1IA 3KO0A 2KI4C 1Z4HA 1L7ZA 1SMGA 4MSPA 2MBXA 1SGRI 2KYCA 4OZDA 2X3TA 2K8MB 5D7FA 1QV0A 2HQ8A 2LVIA 2N17A 2PRUA 1JSAA 5I8NA 1XYDA 1KCYA 1TN4A 1N13A 1SNLA 2HQWA 1YX7A 4ORCB 4BY5A 3BUMB 2CT9A 3R1PA 3WHUB 2MLEC 1XK4A 2QEOA 2KDHA 3CS1A 3LL8B 1SGNI 1ODBA 3A8RA 1W9ZA 1JFKA 1LKJA 2FJYA 1BT6A 2F33A 2LMVA 3OB1B 1NX3A 3B86A 4NDBA 2LUCA 1YTPA 4ICBA 3DYEA 2LP2A 1CDMA 5KTYA 1S6IA 2ENZA 5CCMA 4FTGA 4GI3C 3D0YB 2QQEA 4BY4A 1CFFA 2OZUA 3DF0A 1RROA 3CZ2A 1MQ1A 4M2OA 1CT0I 1W4RA 2K7DA 2WCKA 3CABA 1N0YA 1K90D 1F55A 1QX5B 2Q4UA 3BQ3A 1OOFA 2L8EA 1LINA 3SG3A 2WCLA 2OU2A 3PDNA 2MLFC 1XFYO 1XFWO 1RFJA 3GOFA 3OXLA 1IQ5A 3OVOA 4A4BA 1XVJA 3A4UB 2JPTA 1DJZA 2O5GA 2QPTA 2ORVA 1T14A 3SG4A 5HLVA 1HJAI 1RTP1 1MJ9A 2M29A 2LMUA 3PJIA 3UOEA 4MBEA 2KFFA 2M7LA 5G08A 3OL0A 1PTRA 2L51A 1CM1A 1FAQA 1R6PA 2K2AA 4JCVE 3BUXB 1PALA 1NP8A 3D74A 1UHAA 2KI4B 4CIDA 1CT2I 2PQLA 1BJFA 2M7NA 1TOTA 3DVKA 1MT1A 1OYVI 1DELA 2CNPA 3VRQA 2FNFX 3I5HC 5EX0A 2N52A 1NYAA 2F2PA 4UXHA 3E3RA 4SGBI 3VDPA 2LLTA 1OMDA 2MAZA 3I5GC 2JXDA 4MRYA 3TJQA 1EXRA 2NU4I 4E68A 1GJYA 1TURA 2WC8A 1JC2A 1ZOTB 1S6CA 1K7UA 1S36A 2KI6C 2HETA 2H8VA 4DIRA 2NZ0A 5EX3A 2K0JA 2BE6A 2DB6A 4F0ZB 2NCOA 2M0RA 3VROA 2QEVA 3QTLD 3TOBA 1B7TZ 3I5FC 2Y1MA 2M97A 3SGQI 3CR2A 2MA2A 1KBEA 2JYYA 1M63B 5EL2A 2N71A 4E1RA 2WCBA 1JF0A 4UXIA 1VRKA 1Z2IA 3F45A 4PE1A 4Q04A 3B4VC 3R5AA 3KF9A 5B8IB 1OOJA 4C0JA 2P70A 4IL1A 2GTEA 2WCYA 2F3YA 2ZRTA 2LHLA 5I2LA 3D76A 1BOCA 4NDDA 4JD9A 5FUYA 1J1EA 3AAKA 1SRAA 3TS5C 1TUSA 1SKTA 1X74A 4ORAB 3H4SE 3EVVA 2ZFDA 1CLLA 3FE6A 1K9KA 3DVJA 2CTNA 4WQ3A 3EVUA 1D1OA 2M49B 3CWGA 1UUSA 4XJKB 5CSJA 3VE5A 2K2FA 1Y1AA 4D1EA 1QS7A 1RECA 2PYQA 1SY9A 1AJ4A 1KQMC 1A75A 4L9MA 4I5KA 1K93D 5ER4X 2BCAA 1DJYA 2F2OA 5JJGA 2YQPA 2B0UC 2MJWB 1SGYI 3JVTC 4P5OE 4HRGA 4P2YB 1FW4A 2JNFA 2M9GA 1TTXA 3I5HB 2BE4A 1GGWA 2SGFI 1EH2A 3BYAA 1WTJA 1KFXL 4CLNA 1J1DA 5HKYA 4I5NB 1J7QA 4JQ0D 3I5GB 4UPGA 1J7PA 1FPWA 2KQ6A 5HI7A 4WP4A 2JOJA 2PASA 3FWBA 2V1CC 1OVOA 3OB2B 2WC5A 2K9HA 3B6XA 1SL9A 2LUXA 4I5LB 5D69A 3RM1A 1NCZA 4GNKB 1Y1UA 2OD1A 1PRWA 3I5FB 3IQOA 5DKNA 3O78A 3SIBA 3SG5A 1L2OC 3VB1A 4XYNA 2LVJA 4INXA 1OMTA 2HF5A 2PMYA 1N65A 2GGZA 2FCEA 1MXEA 4NQGA 3B88A 4MZKA 1DJGA 2LMTA 2SGDI 1DGVA 1TBQR 3I5IC 3OXGA 2PSRA 3CGAA 2O60A 1TNWA 2L0PA 1K9PA 1AN1I 3NSIA 5BPJA 3SGBI 5J8FA 4R1EA 5HKWA 3R1OA 3TS5B 3FE9A 2P6AC 3TO6A 2JRFA 4ZCUA 1LXFC 1DT7B 3CR4X 4YGCB 2LHIA 1FBVA 1BG1A 1MXLC 3ZNIA 1AVSA 1NWDA 5TNCA 2P6BB 2KYFA 3SIAA 3BOWA 1NX2A 2LB7A 1A2XA 1JF2A 2L5XB 5HYDA 1KQMB 1TRFA 4F7FA 1XFZO 4JPZB 4GGFA 1CM4A 3CZ1A 4MN0A 1AP4A 5FUVA 4OVNF 3JVTB 1ZFSA 3TDUA 4PE7A 4C0LA 4HRHA 2ROWA 1NSHA 2WCFA 1LR9A 2KMRA 2LVVA 5AERA 2G2BA 3PM8A 1LR7A 1H8BA 1QJTA 2WVJA 2IS9A 2OVOA 3RZSA 1B8CA 1F70A 3S0BA 1W7IB 2LUYA 2LLSA 3CYZA 3UGLA 5GQQC 3UGIA 1VDDA 1XFUO 1SR6B 1XFRA 3TO7A 2G9BA 1XFXO 1QASA 4AQIA 3JTDC 4YGAA 2EHBA 4IJ7A 3FWCA 2GVIA 1M39A 3LCPC 4YI9A 1X4SA 2L4IA 1IY6A 2I94A 1UHNA 1ULMA 1L2OB 2KCXA 1TBOA 2L2CA 1Z2CB 2OTGC 2EC6C 1MHOA 1DF0A 1IGVA 3GK4X 1DGUA 1TCOB 3I5IB 2KMPA 2MRDA 5AFPA 2D8NA 2BCXA 3PFVA 3CXLA 1G8IA 2L98A 1B9AA 1TWOA 1LA3A 2QPOA 3ZWHA 1B8LA 1UHHA 1F4QA 3NHIA 3FSYA 3FS7A 3EKHA 2JTZA 1TUZA 3GK2A 1KK7Y 2OPOA 1S6JA 1SK6D 1GGZA 1CGJI 3SG7A 1TOPA 1IWQA 1HDLA 1WKXA 3BFBA 1PPFI 3NGVA 1SGEI 1P28A 2CWFA 4OV2A 1YVLA 3DXLA 2JQ6A 1Z7KB 2KLDA 2BNXA 2JNXA 1NCYA 2KAVA 2SGEI 2ERWA 2GKVA 1HPTA 3EK4A 4PALA 1XBTA 1C3YA 3LLEA 1YUUA 1OMUA 2WNDA 2JXCA 1KQVA 4N5XA 2V1CA 1YRUB 1ZMZA 3WXAA 3E2IA 2KHNA 2Y1NA 4MPIA 5CSIA 3NSOA 2CJSC 4AOMA 5E3PA 2E5RA 4E1PA 1KSOA 1SL7A 1SL8A 1IQ3A 3OX5A 1SBJA 2XRCA 2A20A 1M31A 1TGSI 1QLKA 2NU1I 2X52A 1DJHA 1SCMC 2F8PA 3B87A 1A75B 1DJWA 1S5GZ 4GFTA 4GGFC 3JTDB 4GUKA 1NX1A 2K7BA 2LP3A 5FI2A 4PT1A 4INWA 1R0RI 1Y1BA 2LLUA 4DNCA 5I94A 4PDZA 1FI6A 1QWVA 1Y1XA 4QJ4B 2L4HA 3FIAA 2Y4QA 2GKTI 2OTGB 2EC6B 4CFRA 1CDPA 4HGUA 1UVFA 2K60A 3KEVA 1AHRA 3GK1A 3PM2A 2L7XA 1NPQA 2BBMA 2YGUA 1WGTA 1V1FA 3NSKA 3DY9A 3K1EA 2I7AA 1QXPA 1KFXS 1G4YR 3R5BA 3ICBA 1AUIB 2KI6D 2KMQA 3E59A 2NXQA 4DRWA 2DKVA 1RFHA 4KYNA 4MZJA 5ER5A 3CLNA 1BLQA 3DD4A 1Q9BA 3M0WA 2QEHA 2BECA 3FE8A 5HLOA 2KAYA 1YURA 3TOAA 3GOXA 3K21A 1QVIZ 4PHKA 2V53A 1AK8A 4USLA 2F3CI 1WLMA 1TIHA 4OVOA 1Y6WA 3O4XA 3BXKA 2KPHA 5I2OA 2K61A 1CFPA 9WGAA 1CLMA 3LK1A 2LM5A 3CDNA 3TUYC 5F6TA 2JZIA 1SGPI 4U8DA 2B8TA 1UVGA 1QATA 1S5GY 2LVKA 4WQ2A 1OOHA 4MLWA 3BOWB 2K7CA 2QQ0A 1TNPA 1WGCA 5CSNA 1SCMB 1JUOA 1CSOI 1YRTB 2NU3I 1MR8A 1C7WA 2E6WA 2JTTA 1ULNA 3EG5B 1SYMA 3WHTB 1WRZA 1YUSA 2FCDA 1UURA 3OGNA 1S20A 2TN4A 2H61C 4PE4A 4GAOA 1FI5A 3PSRA 4GBAA 1ALWA 5FUWA 3R1VA 3D75A 3UEYA 3VGOA 1WRKA 1V1HA 5FUXA 1QTXA 1J7RA 1QLSA 1QIWA 1IRJA 1BU3A 1KFUL 2GGMA 2CWHA 1NIWA 1CDNA 2VRGA 3KPXA 1EL4A 3IF7A 1KK8C 2KFGA 2AMIA 1SGQI 2I2RE 1FARA 1DVIA 1LS8A 3TO9A 1QVIY 3BFHA 1PVBA 2KBMA 1SGDI 4TNCA 1DF0B 4QJ5B 2JULA 1YTZC 3AKAA 1JBAA 2KFHA 4MRXA 1KK7Z 5J8CA 2ISDA 2CWGA 3QRXA 5HQ8A 1K95A 3Q8IA 2BCBA 4FQTA 4C0KA 2LE9B 1A03A 2KGRA 1S3PA 3UGDA 1A29A 1WY9A 1X02A 4ZCVA 2ZRSA 1CDLA 5E3RA 1YVHA 2L50A 1OQPA 1B47A 2PQ8A 1K96A 5PALA 3TUYB 1IY5A 2RC4A 4OKHA 1OW4A 2JU0A 2QQDA 1E8AA 3R5CA 2Y0MA 4HSZA 1DMOA 5KSZA 5KU1A 3C1VA 1BODA 1JWDA 3R72A 3SS5A 2M8UA 1PJUA 1ZUZA 2E73A 3QWPA 3S0DA 3R5DA 4OCIA 1QV1A 4JKTA 4GGNA 2H2KA 3PATA 2QEBA 1F71A 3O2PA 1F4OA 5E3QA 3CR5X 3S0GA 1Y1CA 2QACA 2RGIA 1DJXA 1OSAA 3AKBA 1M8CA 1OOIX 4PHJA 4YRUA 3IVTA 1G33A 2KSPA 4N1GA 1BR4B 2J87A 3SEKC 1YX8A 5FI7A 4N1FA 4NDCA 1UP5A 1U5IA 2FOTA 3BFAA 2KLEA 1MUXA 3LK0A 1H4BA 1CNPA 3SS3A 4OR9B 1KK8B 3SG2A 1UHKA 1K94A 1KWOC 1KMAA 2BL0C 2HPSA 1RJVA 2JW6A 4AQJA 2PVBA 2K7OA 1K7TA 2LEOA 2WC6A 1LVCD 2CBLA 3PLFB 2WGCA 2KAXA 2WCEA 1MJAA 1B4CA 1R2UA 2JT3A 2NU0I 2Y5IA 1P9ZA 3WNXB 3DZTA 1PCEA 3S0AA 1WRLA 1NCXA 4DS7A 2LANA 3AAJA 1F54A 1KSMA 2ELIA 2BBNA 2SCPA 5CPVA 3MEKA 2SGQI 2OS8C 1UUCA 2VRWB 3TZ1A 3SG6A 2KOTA 1XX6A 1H0ZA 3QMEA 1SPYA 1XO5A 2KQYA 3OXFA 3UEJA 3BUNB 3CTNA 1V1GA 1OZOA 2H61A 1GQMA 2BAPA 2E30A 3PN7C 2F3ZA 5DKRA 2PALA 3OHMB 2M1KB 1OMVA 3D77A 4AMLA 1RK9A 1DEKA 3BJHA 2SGPI 1YR5A 5FYXA 1LA0A 1OOGA 1DS2I 1QX2A 1IJ5A 2NCPA 1ORGA 5D3OA 2M3WA 2UZ3A 1EG3A 2ORWA 1UWOA 2M1UA 1TIZA 1CFDA 3EK8A 2ZN9A 5AXIA 4QJ3B 2KNEA 2WCHA 2BKHB 1LR8A 1CE3A 3VDUA 1A4PA 4ETOA 5AANA 3UFFA 4M2PA 2B1UA 1XA6A 1EG4A 1TCFA 1PULA 2ODDA 1K7VA 4CPVA 1CGII 5CSFA 2JPOA 2ARPF 3RU0A 1XA5A 3D0YA 1Y0VH 1N2DA 4PE0A 5HL1A 5FI6A 2LNKA 2NLNA 1DTLA 1CT4I 1KWOB 3BUOB 2BL0B 1HEVA 3O4YA 1SCVA 2CXJA 3D00A 1ULKA 2W0TA 1P9GA 1C7VA 5IBWA 1PK0D 1S1EA 4UXJA 3EVRA 1PSBA 4I5JA 3NHTA
chains in the Genus database with same CATH topology
2KGBC 4GBAA 1IQ5A 1ALWA 1QJTA 1QX7A 5JOLA 4DCKA 1YU6C 2ENNA 2WVJA 3OVOA 4A4BA 2IS9A 3PALA 1XVJA 3A4UB 2JPTA 2OVOA 5FUWA 5JHWC 1DJZA 2O5GA 1PTQA 3UEYA 3VGOA 2QPTA 1WRKA 1XK4C 2ORVA 1V1HA 5FUXA 1QTXA 1B8CA 1J7RA 1QLSA 3VRPA 1F70A 1QIWA 2JZMA 3SG4A 1IRJA 3EK7A 1J55A 1W7IB 2LCPA 5HLVA 4CFQA 2LUYA 2LLSA 1C07A 1IW4A 1HJAI 3UGLA 1RTP1 2ZNEA 1NUBA 1BU3A 5GQQC 3UGIA 2M29A 2LMUA 2SASA 1VDDA 2Q91A 1IKUA 1KFUL 1WDCC 1S26D 4MBEA 2GGMA 2COLB 1XFUO 2KFFA 2OS8B 5G08A 1SR6B 2M7LA 1HQVA 3OL0A 1NIWA 1PTRA 1CDNA 2L51A 1CM1A 2VRGA 3TDIA 1FI5A 1W3SA 2G9BA 1XFXO 1FAQA 1QASA 5K89A 3KPXA 4AQIA 1R6PA 1EL4A 3JTDC 2DIPA 4YGAA 3IQQA 2EHBA 3IF7A 3FWCA 2L2EA 2GVIA 1M39A 2K2AA 3TDZA 1KK8C 4JCVE 3BUXB 1BF5A 1PALA 1NP8A 3LCPC 1CFCA 4YI9A 2KI4B 2KFGA 1CTRA 1X4SA 2L4IA 2AMIA 4CIDA 1SGQI 1IY6A 1CMFA 2I94A 2GV5A 4WRIA 1CT2I 1UHNA 2I2RE 3HCMA 5CCLA 1BJFA 1RWYA 1L2OB 1DVIA 1FARA 1IG5A 2KCXA 2M7NA 1TOTA 1U5KA 3DVKA 1MT1A 1OYVI 1MF8B 1TBOA 1QVIY 1KFUS 2CNPA 1PVBA 3VRQA 2KBMA 1CMGA 3FC3A 2FNFX 3I5HC 1UHIA 5EX0A 1SGDI 2N52A 1HT9A 1NYAA 2F2PA 4UXHA 4TNCA 1DF0B 3PN7B 2OTGC 2EC6C 3E3RA 4QJ5B 1MHOA 4FKDA 2FJUB 2JULA 4SGBI 3VDPA 1DF0A 1YTZC 2LV7A 2N1AB 2LLTA 1IGVA 2WOSA 3GK4X 1DGUA 1OMDA 2MAZA 1TCOB 3AKAA 3I5GC 1JBAA 3I5IB 2KFHA 4MRXA 1KK7Z 4YGBB 2KMPA 2MRDA 5AFPA 3SJSA 2JXDA 2M5XA 4MRYA 3TJQA 1EXRA 2D8NA 2BCXA 2ISDA 3PFVA 3CXLA 1TNXA 2AAOA 3QRXA 1G8IA 2L98A 4JWQA 2NU4I 5HQ8A 1B9AA 1K95A 4E68A 1GJYA 1TURA 1LA3A 2BCBA 2WC8A 1JC2A 1ZOTB 1S6CA 2QPOA 4C0KA 2LE9B 2ZNDA 1A03A 2KGRA 1S36A 1S3PA 2KI6C 3ZWHA 1FYBA 1B8LA 2HETA 3UGDA 1A29A 4YI8A 1WY9A 1K9UA 1UHHA 1F4QA 1X02A 3FS7A 1F8HA 3EKHA 3O6BA 1NX0A 2JTZA 2ZRSA 4ZCVA 3VRNA 2LAPA 4DIRA 3GK2A 2NZ0A 1CDLA 1KK7Y 1YVHA 2OPOA 2L50A 1OQPA 1B47A 1S6JA 1SK6D 3BUWB 5EX3A 1GGZA 2ZN8A 1CGJI 2K0JA 3HX4A 1SW8A 1TOPA 1YUTA 3SG7A 1QIVA 2BE6A 2DB6A 1K96A 4F0ZB 1IWQA 2NCOA 2M0RA 3VROA 3QTLD 1HDLA 1B7TZ 3I5FC 5PALA 3TUYB 1IY5A 2J9RA 2Y1MA 1PPFI 2M97A 3SGQI 3CR2A 1SGEI 2MA2A 1KBEA 4OKHA 2JYYA 1M63B 4YGEB 1JFJA 2N71A 4OV2A 1FF1A 2WCBA 4E1RA 1JF0A 1YVLA 4MVFA 2JQ6A 2JU0A 2QQDA 1Z7KB 4ORBB 4UXIA 1AJ5A 4M2QA 1VRKA 4DUQA 2JNXA 1NCYA 2BKIB 1E8AA 2JT8A 2KAVA 2SGEI 1DS3I 1PVAA 2ERWA 2I18A 4HSZA 1B7TY 1SR6C 2GKVA 3F45A 1HPTA 3EK4A 1DMOA 4PALA 4PE1A 4Q04A 5DKQA 5KSZA 3VRRA 2KMOA 3B4VC 1XBTA 1OE9B 3KF9A 5B8IB 5KU1A 1OOJA 4C0JA 1TBRR 3C1VA 1BODA 3LLEA 4MZLA 1YUUA 1XFVO 4IL1A 2ZKMX 3CZTX 1OMUA 2WCYA 1JWDA 2WNDA 2JXCA 1KQVA 2F3YA 2ZRTA 4N5XA 2LHLA 2M8UA 3MSEB 5I2LA 1PJUA 1ZUZA 2V1CA 1YRUB 1ZMZA 3KY9A 1B1GA 3WXAA 1ALVA 2E73A 3QWPA 1BOCA 4HREE 4NDDA 5FUYA 4PHMA 3RLZA 3E2IA 1Q80A 1J1EA 3AAKA 4OCIA 1SRAA 2AUCA 1QV1A 2KHNA 2Y1NA 1H4BA 3TS5C 4GGNA 2H2KA 4FQOA 4GPLB 1TUSA 1SKTA 3DVMA 3PATA 1X74A 1F71A 1M46A 3O2PA 1F4OA 5CSIA 4ORAB 3CR5X 3NSOA 1IH0A 2CJSC 4AOMA 3H4SE 2E5RA 1Y1CA 4E1PA 1KSOA 1CLBA 3EVVA 2JWWA 2QACA 3EKJA 2ZFDA 2RGIA 1DJXA 5J3XA 1M8BA 1CLLA 2MHHA 4MEWA 1SL7A 1SL8A 4B6DA 1IQ3A 2QQCA 1BR1B 1K9KA 1OSAA 3DVJA 2CTNA 5I2QA 3OX5A 3AKBA 1OZSA 1M8CA 4WQ3A 1SBJA 2XRCA 4PHJA 3EVUA 1D1OA 2A20A 4YRUA 1M31A 1TGSI 2M49B 3CWGA 1G33A 1QLKA 2KSPA 2NU1I 1ZACA 4N1GA 1UUSA 1MWNA 4XJKB 5CSJA 1BR4B 4A4CA 1WDCB 3VE5A 2J87A 1DJHA 2K2FA 1U5IB 3OX6A 1SCMC 1YX8A 2NU2I 1Y1AA 4XJKA 1BMOA 4N1FA 3SEKC 4NDCA 2F8PA 1UP5A 1K8UA 2BUSA 1A75B 4D1EA 1QS7A 1U5IA 1RECA 2JXLA 2FOTA 1DJWA 1AJ4A 1SY9A 1S5GZ 4GFTA 1KQMC 4PCWA 2JT0A 1A75A 2WORA 2GKRI 1MUXA 3LK0A 4GGFC 3JTDB 4GUKA 4I5KA 1K93D 1NX1A 4L9MA 1CNPA 4OR9B 4YBHB 1WLZA 5ER4X 2K7BA 2BCAA 2R2IA 1KK8B 3SG2A 2LC5A 2LP3A 1UHKA 1DJYA 2F2OA 5JJGA 2YQPA 1K94A 1R0RI 1KWOC 2MJWB 1Y1BA 2LLUA 2B0UC 1SGYI 1BUSA 2BL0C 2HPSA 1KMAA 3JVTC 4P5OE 4HRGA 4P2YB 1FW4A 2JNFA 3NSLA 4PDZA 2M9GA 1M45A 1RJVA 1TTXA 2JC2A 1FI6A 2JW6A 1Y8FA 4A24A 4AQJA 3BJIA 2PVBA 1Y1XA 2JA1A 3I5HB 2K7OA 2LEOA 4QJ4B 2L4HA 2BE4A 1GGWA 2SGFI 3FIAA 2Y4QA 1EH2A 1LVCD 3BYAA 2GKTI 2CBLA 3PLFB 1PSRA 2EC6B 2OTGB 1KFXL 4CFRA 4CLNA 1CDPA 1J1DA 4HGUA 5HKYA 2KAXA 5HKZA 3HH2C 4I5NB 1UVFA 2KBIA 1J7QA 4JQ0D 3KEVA 2WCEA 1AHRA 3GK1A 3I5GB 4UPGA 1KBFA 1J7PA 1UHJA 1B4CA 1FPWA 3DF0B 1R2UA 2KQ6A 2L7XA 1CKKA 1NPQA 2JT3A 1TBNA 5HI7A 2A4JA 1W7JB 2BBMA 2Y5IA 2NU0I 2JOJA 1B8RA 1V1FA 3OP0A 3WNXB 3KHEA 3NSKA 4PHNA 2CCMA 2PASA 3FWBA 1PCEA 2I7AA 1EJ3A 3NXAA 2YUUA 1WRLA 2V1CC 1NCXA 4DS7A 2LANA 1QXPA 3AAJA 1F54A 1OVOA 1KSMA 2ELIA 1CB1A 2BBNA 1KFXS 2SCPA 5CPVA 3OB2B 1G4YR 4YGDB 3ICBA 3MEKA 3DVEA 1AUIB 2DOQA 2K9HA 2KI6D 2OS8C 2KMQA 1UUCA 2SGQI 2VRWB 1SL9A 3D10A 3TZ1A 2LUXA 5AEQA 3SG6A 1J7OA 4I5LB 2KOTA 3E59A 5D69A 3RM1A 1DJIA 5DAEA 2NXQA 4DRWA 1OMRA 2EGDA 1XX6A 1NCZA 1IJ6A 1TNQA 4GNKB 1CHOI 1K2HA 1H0ZA 1RFHA 1V1IA 1SPYA 1XO5A 1Y1UA 2OD1A 1PRWA 3I5FB 3IQOA 4MZJA 3KO0A 5DKNA 2KI4C 3O78A 1L7ZA 3CLNA 1SMGA 2KQYA 5ER5A 3SIBA 3OXFA 3UEJA 3SG5A 1BLQA 1L2OC 3DD4A 3BUNB 3CTNA 4MSPA 2MBXA 1SGRI 2KYCA 3M0WA 1V1GA 2K8MB 4XYNA 1OZOA 2LVJA 2H61A 1GQMA 5D7FA 1QV0A 1OMTA 2BECA 2HF5A 2HQ8A 2PMYA 2E30A 2LVIA 5HLOA 2PRUA 2N17A 1JSAA 1N65A 2GGZA 3PN7C 5I8NA 2FCEA 2F3ZA 5DKRA 2KAYA 1MXEA 2PALA 4NQGA 1YURA 1XYDA 1KCYA 4MZKA 3GOXA 3OHMB 1DJGA 2M1KB 1OMVA 2LMTA 3K21A 2SGDI 1TN4A 1QVIZ 1N13A 1DGVA 1SNLA 2HQWA 1YX7A 1TBQR 1RK9A 3I5IC 4ORCB 4BY5A 3BUMB 3OXGA 2CT9A 3WHUB 2PSRA 3CGAA 2MLEC 1XK4A 2O60A 2SGPI 1YR5A 4PHKA 5FYXA 2V53A 1LA0A 1TNWA 2KDHA 3CS1A 1DS2I 1QX2A 2L0PA 1IJ5A 1K9PA 3LL8B 1SGNI 2NCPA 1AK8A 1ODBA 1AN1I 3NSIA 3A8RA 5BPJA 3SGBI 4USLA 2M3WA 2UZ3A 1JFKA 1EG3A 2F3CI 4R1EA 1WLMA 1LKJA 1TIHA 5HKWA 3TS5B 2ORWA 4OVOA 1UWOA 2M1UA 1Y6WA 1TIZA 1BT6A 3BXKA 1CFDA 2F33A 2LMVA 3EK8A 3OB1B 2P6AC 1NX3A 2JRFA 4ZCUA 1LXFC 2ZN9A 1DT7B 5I2OA 2K61A 3CR4X 4NDBA 2LUCA 4YGCB 5AXIA 4QJ3B 2LHIA 1CFPA 1YTPA 2KNEA 1FBVA 1BG1A 1CLMA 3LK1A 2LM5A 2BKHB 1MXLC 4ICBA 3ZNIA 3TUYC 1AVSA 1NWDA 1LR8A 1CE3A 5F6TA 2JZIA 2LP2A 1A4PA 4ETOA 1SGPI 3VDUA 4U8DA 5AANA 1CDMA 3UFFA 5KTYA 5TNCA 4M2PA 2B8TA 1UVGA 1QATA 1S5GY 2LVKA 4WQ2A 4MLWA 1S6IA 2ENZA 2B1UA 5CCMA 1XA6A 2P6BB 1EG4A 1TCFA 3BOWB 1PULA 2K7CA 2KYFA 2ODDA 4CPVA 2QQ0A 1CGII 4FTGA 3SIAA 5CSFA 1TNPA 3BOWA 1SCMB 1JUOA 1NX2A 5CSNA 4GI3C 1A2XA 2ARPF 1CSOI 1YRTB 3D0YB 1MR8A 1JF2A 2NU3I 3RU0A 1C7WA 1XA5A 2E6WA 2JTTA 2L5XB 1SYMA 3D0YA 5HYDA 2QQEA 1KQMB 4BY4A 1CFFA 1TRFA 3DF0A 1Y0VH 1N2DA 3WHTB 1RROA 1XFZO 4PE0A 1MQ1A 1R79A 4JPZB 4M2OA 1CT0I 4GGFA 1CM4A 2LNKA 1WRZA 4MN0A 1W4RA 2K7DA 2NLNA 1DTLA 1AP4A 1N0YA 1CT4I 1K90D 1KWOB 5FUVA 3BUOB 2BL0B 4OVNF 3JVTB 1F55A 1YUSA 1ZFSA 2FCDA 1QX5B 2Q4UA 3O4YA 3TDUA 1UURA 1SCVA 3BQ3A 4PE7A 2L8EA 4C0LA 4HRHA 2ROWA 1LINA 3SG3A 2CXJA 1NSHA 3D00A 2WCFA 2W0TA 1LR9A 2KMRA 2TN4A 2H61C 2LVVA 1C7VA 3PDNA 4PE4A 2MLFC 5IBWA 1PK0D 1S1EA 1XFYO 5AERA 4UXJA 2G2BA 1PSBA 3EVRA 1XFWO 3PM8A 4GAOA 4I5JA 1RFJA 1H8BA 1LR7A 3GOFA 3PSRA 3OXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGB C;  4GBA A;  1IQ5 A;  1ALW A;  1QJT A;  1QX7 A;  5JOL A;  4DCK A;  1YU6 C;  3OVO A;  4A4B A;  2IS9 A;  3PAL A;  1XVJ A;  3A4U B;  2JPT A;  2OVO A;  5JHW C;  1DJZ A;  2O5G A;  3VGO A;  2QPT A;  1WRK A;  1XK4 C;  1QTX A;  1B8C A;  1J7R A;  1QLS A;  3VRP A;  1F70 A;  1QIW A;  2JZM A;  3SG4 A;  1IRJ A;  3EK7 A;  1J55 A;  1W7I B;  2LCP A;  5HLV A;  4CFQ A;  2LLS A;  1C07 A;  1IW4 A;  1HJA I;  1RTP 1;  2ZNE A;  1NUB A;  1BU3 A;  5GQQ C;  2M29 A;  2LMU A;  2SAS A;  2Q91 A;  1IKU A;  1KFU L;  1WDC C;  1S26 D;  4MBE A;  2GGM A;  2COL B;  1XFU O;  2KFF A;  2OS8 B;  5G08 A;  1SR6 B;  2M7L A;  1HQV A;  1NIW A;  1CDN A;  2L51 A;  1CM1 A;  2VRG A;  3TDI A;  1FI5 A;  2G9B A;  1XFX O;  1QAS A;  5K89 A;  3KPX A;  4AQI A;  1R6P A;  1EL4 A;  3JTD C;  4YGA A;  3IQQ A;  2EHB A;  3IF7 A;  3FWC A;  2L2E A;  1M39 A;  2K2A A;  3TDZ A;  1KK8 C;  3BUX B;  1BF5 A;  1PAL A;  1NP8 A;  3LCP C;  1CFC A;  4YI9 A;  2KI4 B;  2KFG A;  1CTR A;  2L4I A;  2AMI A;  4CID A;  1SGQ I;  1IY6 A;  1CMF A;  2I94 A;  2GV5 A;  4WRI A;  1CT2 I;  1UHN A;  2I2R E;  3HCM A;  1BJF A;  1RWY A;  1L2O B;  1DVI A;  2KCX A;  1IG5 A;  2M7N A;  3DVK A;  1MT1 A;  1OYV I;  1MF8 B;  1QVI Y;  1KFU S;  2CNP A;  1PVB A;  3VRQ A;  2KBM A;  1CMG A;  3I5H C;  1UHI A;  1SGD I;  2N52 A;  1HT9 A;  1NYA A;  2F2P A;  4TNC A;  1DF0 B;  3PN7 B;  2OTG C;  2EC6 C;  3E3R A;  4QJ5 B;  1MHO A;  2FJU B;  2JUL A;  4SGB I;  1DF0 A;  1YTZ C;  2LV7 A;  2LLT A;  1IGV A;  2WOS A;  3GK4 X;  1DGU A;  1OMD A;  2MAZ A;  1TCO B;  3AKA A;  3I5G C;  1JBA A;  3I5I B;  2KFH A;  4MRX A;  1KK7 Z;  4YGB B;  2KMP A;  2MRD A;  5AFP A;  3SJS A;  2JXD A;  2M5X A;  4MRY A;  3TJQ A;  1EXR A;  2D8N A;  2BCX A;  2ISD A;  3PFV A;  1TNX A;  2AAO A;  3QRX A;  1G8I A;  2L98 A;  4JWQ A;  2NU4 I;  1B9A A;  1K95 A;  4E68 A;  1GJY A;  1TUR A;  1LA3 A;  2BCB A;  2WC8 A;  1JC2 A;  1ZOT B;  1S6C A;  4C0K A;  2LE9 B;  2ZND A;  1A03 A;  2KGR A;  1S36 A;  1S3P A;  2KI6 C;  3ZWH A;  1FYB A;  1B8L A;  2HET A;  1A29 A;  4YI8 A;  1WY9 A;  1K9U A;  1UHH A;  1F4Q A;  1X02 A;  3FS7 A;  1F8H A;  3EKH A;  3O6B A;  1NX0 A;  2JTZ A;  2ZRS A;  4ZCV A;  3VRN A;  2LAP A;  4DIR A;  3GK2 A;  2NZ0 A;  1CDL A;  1KK7 Y;  1YVH A;  2OPO A;  2L50 A;  1OQP A;  1B47 A;  1S6J A;  1SK6 D;  3BUW B;  1GGZ A;  2ZN8 A;  1CGJ I;  2K0J A;  3HX4 A;  1SW8 A;  1TOP A;  1YUT A;  3SG7 A;  1QIV A;  2BE6 A;  1K96 A;  4F0Z B;  1IWQ A;  2NCO A;  2M0R A;  3VRO A;  3QTL D;  1HDL A;  1B7T Z;  3I5F C;  5PAL A;  3TUY B;  1IY5 A;  2Y1M A;  1PPF I;  2M97 A;  3SGQ I;  3CR2 A;  1SGE I;  2MA2 A;  4OKH A;  2JYY A;  1M63 B;  4YGE B;  1JFJ A;  2N71 A;  4OV2 A;  1FF1 A;  2WCB A;  1JF0 A;  1YVL A;  4MVF A;  2JQ6 A;  2JU0 A;  2QQD A;  1Z7K B;  4ORB B;  1AJ5 A;  4M2Q A;  1VRK A;  4DUQ A;  2JNX A;  1NCY A;  2BKI B;  1E8A A;  2JT8 A;  2KAV A;  2SGE I;  1DS3 I;  1PVA A;  2ERW A;  2I18 A;  4HSZ A;  1B7T Y;  1SR6 C;  2GKV A;  3F45 A;  1HPT A;  3EK4 A;  1DMO A;  4PAL A;  4PE1 A;  4Q04 A;  5DKQ A;  5KSZ A;  3VRR A;  2KMO A;  3B4V C;  1OE9 B;  3KF9 A;  5B8I B;  5KU1 A;  1OOJ A;  4C0J A;  1TBR R;  3C1V A;  1BOD A;  3LLE A;  4MZL A;  1YUU A;  1XFV O;  4IL1 A;  2ZKM X;  3CZT X;  1OMU A;  2WCY A;  1JWD A;  2WND A;  2JXC A;  1KQV A;  2F3Y A;  2ZRT A;  4N5X A;  2LHL A;  2M8U A;  3MSE B;  5I2L A;  1PJU A;  1ZUZ A;  1YRU B;  1ZMZ A;  1B1G A;  3WXA A;  1ALV A;  1BOC A;  4HRE E;  4NDD A;  4PHM A;  3RLZ A;  1Q80 A;  1J1E A;  3AAK A;  4OCI A;  1SRA A;  2AUC A;  1QV1 A;  2KHN A;  2Y1N A;  1H4B A;  3TS5 C;  4GGN A;  2H2K A;  4FQO A;  4GPL B;  1TUS A;  1SKT A;  3DVM A;  3PAT A;  1F71 A;  1M46 A;  3O2P A;  1F4O A;  5CSI A;  4ORA B;  3CR5 X;  3NSO A;  1IH0 A;  4AOM A;  3H4S E;  1Y1C A;  1KSO A;  1CLB A;  3EVV A;  2JWW A;  2QAC A;  3EKJ A;  2ZFD A;  2RGI A;  1DJX A;  5J3X A;  1M8B A;  1CLL A;  2MHH A;  4MEW A;  1SL7 A;  1SL8 A;  1IQ3 A;  2QQC A;  1BR1 B;  1K9K A;  1OSA A;  3DVJ A;  2CTN A;  5I2Q A;  3OX5 A;  3AKB A;  1OZS A;  1M8C A;  4WQ3 A;  1SBJ A;  2XRC A;  4PHJ A;  3EVU A;  1D1O A;  4YRU A;  1M31 A;  1TGS I;  2M49 B;  3CWG A;  1G33 A;  1QLK A;  2KSP A;  2NU1 I;  1ZAC A;  4N1G A;  1UUS A;  1MWN A;  4XJK B;  5CSJ A;  1BR4 B;  4A4C A;  1WDC B;  1DJH A;  2K2F A;  1U5I B;  3OX6 A;  1SCM C;  1YX8 A;  2NU2 I;  1Y1A A;  4XJK A;  1BMO A;  4N1F A;  3SEK C;  4NDC A;  2F8P A;  1UP5 A;  1K8U A;  2BUS A;  1A75 B;  4D1E A;  1QS7 A;  1U5I A;  1REC A;  2JXL A;  2FOT A;  1DJW A;  1AJ4 A;  1SY9 A;  1S5G Z;  4GFT A;  1KQM C;  4PCW A;  2JT0 A;  1A75 A;  2WOR A;  2GKR I;  1MUX A;  3LK0 A;  4GGF C;  3JTD B;  4GUK A;  4I5K A;  1K93 D;  1NX1 A;  4L9M A;  1CNP A;  4OR9 B;  4YBH B;  1WLZ A;  5ER4 X;  2K7B A;  2BCA A;  2R2I A;  1KK8 B;  3SG2 A;  2LC5 A;  2LP3 A;  1UHK A;  1DJY A;  2F2O A;  5JJG A;  1K94 A;  1R0R I;  1KWO C;  2MJW B;  1Y1B A;  2LLU A;  2B0U C;  1SGY I;  1BUS A;  2BL0 C;  2HPS A;  1KMA A;  3JVT C;  4P5O E;  4HRG A;  4P2Y B;  1FW4 A;  2JNF A;  3NSL A;  4PDZ A;  2M9G A;  1M45 A;  1RJV A;  1TTX A;  2JC2 A;  1FI6 A;  4AQJ A;  2PVB A;  1Y1X A;  3I5H B;  2K7O A;  2LEO A;  4QJ4 B;  2L4H A;  2BE4 A;  1GGW A;  2SGF I;  3FIA A;  2Y4Q A;  1EH2 A;  1LVC D;  3BYA A;  2GKT I;  2CBL A;  3PLF B;  1PSR A;  2EC6 B;  2OTG B;  1KFX L;  4CFR A;  4CLN A;  1CDP A;  1J1D A;  4HGU A;  5HKY A;  2KAX A;  5HKZ A;  3HH2 C;  4I5N B;  1UVF A;  2KBI A;  1J7Q A;  4JQ0 D;  3KEV A;  2WCE A;  1AHR A;  3GK1 A;  3I5G B;  4UPG A;  1J7P A;  1UHJ A;  1B4C A;  1FPW A;  3DF0 B;  1R2U A;  2KQ6 A;  1CKK A;  1NPQ A;  2JT3 A;  2A4J A;  1W7J B;  2BBM A;  2Y5I A;  2NU0 I;  2JOJ A;  1B8R A;  1V1F A;  3OP0 A;  3WNX B;  3KHE A;  3NSK A;  4PHN A;  2CCM A;  2PAS A;  3FWB A;  1PCE A;  2I7A A;  1EJ3 A;  3NXA A;  1WRL A;  1NCX A;  4DS7 A;  2LAN A;  1QXP A;  3AAJ A;  1F54 A;  1OVO A;  1KSM A;  1CB1 A;  2BBN A;  1KFX S;  2SCP A;  5CPV A;  3OB2 B;  1G4Y R;  4YGD B;  3ICB A;  3DVE A;  1AUI B;  2DOQ A;  2KI6 D;  2OS8 C;  2KMQ A;  1UUC A;  2SGQ I;  1SL9 A;  3D10 A;  3TZ1 A;  2LUX A;  5AEQ A;  3SG6 A;  1J7O A;  4I5L B;  2KOT A;  5D69 A;  3RM1 A;  1DJI A;  5DAE A;  2NXQ A;  4DRW A;  1OMR A;  2EGD A;  1NCZ A;  1IJ6 A;  1TNQ A;  4GNK B;  1CHO I;  1K2H A;  1H0Z A;  1SPY A;  1XO5 A;  1Y1U A;  1PRW A;  3I5F B;  3IQO A;  4MZJ A;  3KO0 A;  5DKN A;  2KI4 C;  3O78 A;  1L7Z A;  3CLN A;  1SMG A;  2KQY A;  5ER5 A;  3SIB A;  3SG5 A;  1BLQ A;  1L2O C;  3DD4 A;  3BUN B;  3CTN A;  4MSP A;  2MBX A;  1SGR I;  2KYC A;  3M0W A;  1V1G A;  2K8M B;  4XYN A;  1OZO A;  2LVJ A;  2H61 A;  1GQM A;  5D7F A;  1QV0 A;  1OMT A;  2BEC A;  2HF5 A;  2HQ8 A;  2PMY A;  2E30 A;  2LVI A;  5HLO A;  2PRU A;  2N17 A;  1JSA A;  1N65 A;  2GGZ A;  3PN7 C;  5I8N A;  2FCE A;  2F3Z A;  5DKR A;  2KAY A;  1MXE A;  2PAL A;  4NQG A;  1YUR A;  1XYD A;  1KCY A;  4MZK A;  3OHM B;  1DJG A;  2M1K B;  1OMV A;  2LMT A;  3K21 A;  2SGD I;  1TN4 A;  1QVI Z;  1N13 A;  1DGV A;  1SNL A;  2HQW A;  1YX7 A;  1TBQ R;  1RK9 A;  3I5I C;  4ORC B;  4BY5 A;  3BUM B;  2CT9 A;  3WHU B;  2PSR A;  3CGA A;  2MLE C;  1XK4 A;  2O60 A;  2SGP I;  1YR5 A;  4PHK A;  5FYX A;  2V53 A;  1LA0 A;  1TNW A;  2KDH A;  3CS1 A;  1DS2 I;  1QX2 A;  2L0P A;  1IJ5 A;  1K9P A;  3LL8 B;  1SGN I;  2NCP A;  1AK8 A;  1ODB A;  1AN1 I;  3NSI A;  3A8R A;  5BPJ A;  3SGB I;  4USL A;  2M3W A;  1JFK A;  1EG3 A;  2F3C I;  4R1E A;  1WLM A;  1LKJ A;  1TIH A;  5HKW A;  3TS5 B;  4OVO A;  1UWO A;  2M1U A;  1Y6W A;  1TIZ A;  1BT6 A;  3BXK A;  1CFD A;  2F33 A;  2LMV A;  3EK8 A;  3OB1 B;  2P6A C;  1NX3 A;  2JRF A;  4ZCU A;  1LXF C;  2ZN9 A;  1DT7 B;  5I2O A;  2K61 A;  3CR4 X;  4NDB A;  2LUC A;  4YGC B;  5AXI A;  4QJ3 B;  2LHI A;  1CFP A;  1YTP A;  2KNE A;  1FBV A;  1BG1 A;  1CLM A;  3LK1 A;  2LM5 A;  2BKH B;  1MXL C;  4ICB A;  3ZNI A;  3TUY C;  1AVS A;  1NWD A;  1LR8 A;  1CE3 A;  5F6T A;  2JZI A;  2LP2 A;  1A4P A;  4ETO A;  1SGP I;  4U8D A;  5AAN A;  1CDM A;  5KTY A;  5TNC A;  4M2P A;  1UVG A;  1QAT A;  1S5G Y;  2LVK A;  4WQ2 A;  4MLW A;  1S6I A;  2B1U A;  2P6B B;  1EG4 A;  1TCF A;  3BOW B;  1PUL A;  2K7C A;  2KYF A;  4CPV A;  1CGI I;  4FTG A;  3SIA A;  5CSF A;  1TNP A;  3BOW A;  1SCM B;  1JUO A;  1NX2 A;  5CSN A;  4GI3 C;  1A2X A;  2ARP F;  1CSO I;  1YRT B;  3D0Y B;  1MR8 A;  1JF2 A;  2NU3 I;  1C7W A;  1XA5 A;  2E6W A;  2JTT A;  2L5X B;  1SYM A;  3D0Y A;  5HYD A;  1KQM B;  4BY4 A;  1CFF A;  1TRF A;  3DF0 A;  1Y0V H;  1N2D A;  3WHT B;  1RRO A;  1XFZ O;  4PE0 A;  1MQ1 A;  4JPZ B;  4M2O A;  1CT0 I;  4GGF A;  1CM4 A;  2LNK A;  1WRZ A;  4MN0 A;  2K7D A;  2NLN A;  1DTL A;  1AP4 A;  1N0Y A;  1CT4 I;  1K90 D;  1KWO B;  3BUO B;  2BL0 B;  4OVN F;  3JVT B;  1F55 A;  1YUS A;  1ZFS A;  2FCD A;  1QX5 B;  2Q4U A;  3O4Y A;  3TDU A;  1UUR A;  1SCV A;  3BQ3 A;  4PE7 A;  4C0L A;  4HRH A;  1LIN A;  3SG3 A;  2CXJ A;  1NSH A;  2WCF A;  1LR9 A;  2KMR A;  2TN4 A;  2H61 C;  2LVV A;  1C7V A;  4PE4 A;  2MLF C;  5IBW A;  1PK0 D;  1S1E A;  1XFY O;  5AER A;  2G2B A;  1PSB A;  3EVR A;  1XFW O;  3PM8 A;  4GAO A;  4I5J A;  1RFJ A;  1H8B A;  1LR7 A;  3GOF A;  3PSR A; 
#chains in the Genus database with same CATH topology
 2KGB C;  1YU6 C;  4DCK A;  1QX7 A;  5JOL A;  2ENN A;  1NXU A;  3PAL A;  5JHW C;  3V2L A;  1PTQ A;  1XK4 C;  3VRP A;  2JZM A;  3EK7 A;  1J55 A;  2LCP A;  4CFQ A;  1C07 A;  1IW4 A;  2ZNE A;  1NUB A;  2SAS A;  2Q91 A;  1IKU A;  1WDC C;  1S26 D;  2OS8 B;  2COL B;  1HQV A;  3L47 A;  3TDI A;  1W3S A;  5DIC A;  5K89 A;  2DIP A;  3IQQ A;  2L2E A;  3TDZ A;  1BF5 A;  1CFC A;  1CTR A;  1CMF A;  2GV5 A;  4WRI A;  3HCM A;  5CCL A;  1RWY A;  1IG5 A;  1U5K A;  1MF8 B;  1KFU S;  1CMG A;  3FC3 A;  1UHI A;  1HT9 A;  3PN7 B;  3L4L A;  4FKD A;  2FJU B;  2N1A B;  2LV7 A;  3QAH A;  2WOS A;  4YGB B;  3SJS A;  2M5X A;  1TNX A;  2AAO A;  4JWQ A;  2ZND A;  1FYB A;  3UO9 A;  4YI8 A;  1K9U A;  2WCM A;  1F8H A;  3O6B A;  1NX0 A;  3VRN A;  2LAP A;  3BUW B;  1TUJ A;  2ZN8 A;  3HX4 A;  1SW8 A;  1YUT A;  1QIV A;  3SS4 A;  3B7A A;  2J9R A;  4YGE B;  1JFJ A;  1FF1 A;  4MVF A;  4ORB B;  1AJ5 A;  4M2Q A;  4DUQ A;  2L5Y A;  2BKI B;  3N7H A;  2JT8 A;  1DS3 I;  1PVA A;  1GM0 A;  2I18 A;  1B7T Y;  1SR6 C;  5DKQ A;  3VRR A;  1MJB A;  2KMO A;  3S0F A;  1OE9 B;  1TBR R;  2ERB A;  4MZL A;  1XFV O;  2ZKM X;  3CZT X;  1C3Z A;  3MSE B;  3FSX A;  3KY9 A;  1B1G A;  1IIO A;  1ALV A;  4HRE E;  4PHM A;  3RLZ A;  1Q80 A;  2RIJ A;  2AUC A;  4GPL B;  4FQO A;  3DVM A;  1M46 A;  1IH0 A;  3D73 A;  1DQE A;  1CLB A;  2JWW A;  3EKJ A;  5J3X A;  1M8B A;  2MHH A;  4MEW A;  4B6D A;  2QQC A;  1BR1 B;  5I2Q A;  1OZS A;  3S0E A;  1ZAC A;  1MWN A;  4A4C A;  1WDC B;  2P71 A;  3OX6 A;  1U5I B;  2NU2 I;  3UNW A;  4XJK A;  1BMO A;  2BUS A;  1K8U A;  2JXL A;  1FY7 A;  4PCW A;  2JT0 A;  2WOR A;  2GIV A;  2GKR I;  1R79 A;  4YBH B;  1WLZ A;  2R2I A;  2LC5 A;  3OBV A;  1BUS A;  3L4A A;  2UVO A;  3NSL A;  1M45 A;  2JC2 A;  4A24 A;  1Y8F A;  3BJI A;  2QDI A;  2JA1 A;  2WCJ A;  1PSR A;  3CZ0 A;  3HH2 C;  5HKZ A;  2KBI A;  1KBF A;  1UHJ A;  3DF0 B;  1CKK A;  1TBN A;  2A4J A;  1W7J B;  7WGA A;  1DC1 A;  1B8R A;  3OP0 A;  3KHE A;  4PHN A;  2CCM A;  1EJ3 A;  3NXA A;  2YUU A;  3D78 A;  1CB1 A;  4YGD B;  3DVE A;  2DOQ A;  3D10 A;  5AEQ A;  1J7O A;  1DJI A;  1SSE B;  5DAE A;  1OMR A;  2EGD A;  1IJ6 A;  1TNQ A;  1CHO I;  1K2H A;  1V1I A;  3KO0 A;  2KI4 C;  1Z4H A;  1L7Z A;  1SMG A;  4MSP A;  2MBX A;  1SGR I;  2KYC A;  4OZD A;  2X3T A;  2K8M B;  5D7F A;  1QV0 A;  2HQ8 A;  2LVI A;  2N17 A;  2PRU A;  1JSA A;  5I8N A;  1XYD A;  1KCY A;  1TN4 A;  1N13 A;  1SNL A;  2HQW A;  1YX7 A;  4ORC B;  4BY5 A;  3BUM B;  2CT9 A;  3R1P A;  3WHU B;  2MLE C;  1XK4 A;  2QEO A;  2KDH A;  3CS1 A;  3LL8 B;  1SGN I;  1ODB A;  3A8R A;  1W9Z A;  1JFK A;  1LKJ A;  2FJY A;  1BT6 A;  2F33 A;  2LMV A;  3OB1 B;  1NX3 A;  3B86 A;  4NDB A;  2LUC A;  1YTP A;  4ICB A;  3DYE A;  2LP2 A;  1CDM A;  5KTY A;  1S6I A;  2ENZ A;  5CCM A;  4FTG A;  4GI3 C;  3D0Y B;  2QQE A;  4BY4 A;  1CFF A;  2OZU A;  3DF0 A;  1RRO A;  3CZ2 A;  1MQ1 A;  4M2O A;  1CT0 I;  1W4R A;  2K7D A;  2WCK A;  3CAB A;  1N0Y A;  1K90 D;  1F55 A;  1QX5 B;  2Q4U A;  3BQ3 A;  1OOF A;  2L8E A;  1LIN A;  3SG3 A;  2WCL A;  2OU2 A;  3PDN A;  2MLF C;  1XFY O;  1XFW O;  1RFJ A;  3GOF A;  3OXL A;  1IQ5 A;  3OVO A;  4A4B A;  1XVJ A;  3A4U B;  2JPT A;  1DJZ A;  2O5G A;  2QPT A;  2ORV A;  1T14 A;  3SG4 A;  5HLV A;  1HJA I;  1RTP 1;  1MJ9 A;  2M29 A;  2LMU A;  3PJI A;  3UOE A;  4MBE A;  2KFF A;  2M7L A;  5G08 A;  3OL0 A;  1PTR A;  2L51 A;  1CM1 A;  1FAQ A;  1R6P A;  2K2A A;  4JCV E;  3BUX B;  1PAL A;  1NP8 A;  3D74 A;  1UHA A;  2KI4 B;  4CID A;  1CT2 I;  2PQL A;  1BJF A;  2M7N A;  1TOT A;  3DVK A;  1MT1 A;  1OYV I;  1DEL A;  2CNP A;  3VRQ A;  2FNF X;  3I5H C;  5EX0 A;  2N52 A;  1NYA A;  2F2P A;  4UXH A;  3E3R A;  4SGB I;  3VDP A;  2LLT A;  1OMD A;  2MAZ A;  3I5G C;  2JXD A;  4MRY A;  3TJQ A;  1EXR A;  2NU4 I;  4E68 A;  1GJY A;  1TUR A;  2WC8 A;  1JC2 A;  1ZOT B;  1S6C A;  1K7U A;  1S36 A;  2KI6 C;  2HET A;  2H8V A;  4DIR A;  2NZ0 A;  5EX3 A;  2K0J A;  2BE6 A;  2DB6 A;  4F0Z B;  2NCO A;  2M0R A;  3VRO A;  2QEV A;  3QTL D;  3TOB A;  1B7T Z;  3I5F C;  2Y1M A;  2M97 A;  3SGQ I;  3CR2 A;  2MA2 A;  1KBE A;  2JYY A;  1M63 B;  5EL2 A;  2N71 A;  4E1R A;  2WCB A;  1JF0 A;  4UXI A;  1VRK A;  1Z2I A;  3F45 A;  4PE1 A;  4Q04 A;  3B4V C;  3R5A A;  3KF9 A;  5B8I B;  1OOJ A;  4C0J A;  2P70 A;  4IL1 A;  2GTE A;  2WCY A;  2F3Y A;  2ZRT A;  2LHL A;  5I2L A;  3D76 A;  1BOC A;  4NDD A;  4JD9 A;  5FUY A;  1J1E A;  3AAK A;  1SRA A;  3TS5 C;  1TUS A;  1SKT A;  1X74 A;  4ORA B;  3H4S E;  3EVV A;  2ZFD A;  1CLL A;  3FE6 A;  1K9K A;  3DVJ A;  2CTN A;  4WQ3 A;  3EVU A;  1D1O A;  2M49 B;  3CWG A;  1UUS A;  4XJK B;  5CSJ A;  3VE5 A;  2K2F A;  1Y1A A;  4D1E A;  1QS7 A;  1REC A;  2PYQ A;  1SY9 A;  1AJ4 A;  1KQM C;  1A75 A;  4L9M A;  4I5K A;  1K93 D;  5ER4 X;  2BCA A;  1DJY A;  2F2O A;  5JJG A;  2YQP A;  2B0U C;  2MJW B;  1SGY I;  3JVT C;  4P5O E;  4HRG A;  4P2Y B;  1FW4 A;  2JNF A;  2M9G A;  1TTX A;  3I5H B;  2BE4 A;  1GGW A;  2SGF I;  1EH2 A;  3BYA A;  1WTJ A;  1KFX L;  4CLN A;  1J1D A;  5HKY A;  4I5N B;  1J7Q A;  4JQ0 D;  3I5G B;  4UPG A;  1J7P A;  1FPW A;  2KQ6 A;  5HI7 A;  4WP4 A;  2JOJ A;  2PAS A;  3FWB A;  2V1C C;  1OVO A;  3OB2 B;  2WC5 A;  2K9H A;  3B6X A;  1SL9 A;  2LUX A;  4I5L B;  5D69 A;  3RM1 A;  1NCZ A;  4GNK B;  1Y1U A;  2OD1 A;  1PRW A;  3I5F B;  3IQO A;  5DKN A;  3O78 A;  3SIB A;  3SG5 A;  1L2O C;  3VB1 A;  4XYN A;  2LVJ A;  4INX A;  1OMT A;  2HF5 A;  2PMY A;  1N65 A;  2GGZ A;  2FCE A;  1MXE A;  4NQG A;  3B88 A;  4MZK A;  1DJG A;  2LMT A;  2SGD I;  1DGV A;  1TBQ R;  3I5I C;  3OXG A;  2PSR A;  3CGA A;  2O60 A;  1TNW A;  2L0P A;  1K9P A;  1AN1 I;  3NSI A;  5BPJ A;  3SGB I;  5J8F A;  4R1E A;  5HKW A;  3R1O A;  3TS5 B;  3FE9 A;  2P6A C;  3TO6 A;  2JRF A;  4ZCU A;  1LXF C;  1DT7 B;  3CR4 X;  4YGC B;  2LHI A;  1FBV A;  1BG1 A;  1MXL C;  3ZNI A;  1AVS A;  1NWD A;  5TNC A;  2P6B B;  2KYF A;  3SIA A;  3BOW A;  1NX2 A;  2LB7 A;  1A2X A;  1JF2 A;  2L5X B;  5HYD A;  1KQM B;  1TRF A;  4F7F A;  1XFZ O;  4JPZ B;  4GGF A;  1CM4 A;  3CZ1 A;  4MN0 A;  1AP4 A;  5FUV A;  4OVN F;  3JVT B;  1ZFS A;  3TDU A;  4PE7 A;  4C0L A;  4HRH A;  2ROW A;  1NSH A;  2WCF A;  1LR9 A;  2KMR A;  2LVV A;  5AER A;  2G2B A;  3PM8 A;  1LR7 A;  1H8B A;  1QJT A;  2WVJ A;  2IS9 A;  2OVO A;  3RZS A;  1B8C A;  1F70 A;  3S0B A;  1W7I B;  2LUY A;  2LLS A;  3CYZ A;  3UGL A;  5GQQ C;  3UGI A;  1VDD A;  1XFU O;  1SR6 B;  1XFR A;  3TO7 A;  2G9B A;  1XFX O;  1QAS A;  4AQI A;  3JTD C;  4YGA A;  2EHB A;  4IJ7 A;  3FWC A;  2GVI A;  1M39 A;  3LCP C;  4YI9 A;  1X4S A;  2L4I A;  1IY6 A;  2I94 A;  1UHN A;  1ULM A;  1L2O B;  2KCX A;  1TBO A;  2L2C A;  1Z2C B;  2OTG C;  2EC6 C;  1MHO A;  1DF0 A;  1IGV A;  3GK4 X;  1DGU A;  1TCO B;  3I5I B;  2KMP A;  2MRD A;  5AFP A;  2D8N A;  2BCX A;  3PFV A;  3CXL A;  1G8I A;  2L98 A;  1B9A A;  1TWO A;  1LA3 A;  2QPO A;  3ZWH A;  1B8L A;  1UHH A;  1F4Q A;  3NHI A;  3FSY A;  3FS7 A;  3EKH A;  2JTZ A;  1TUZ A;  3GK2 A;  1KK7 Y;  2OPO A;  1S6J A;  1SK6 D;  1GGZ A;  1CGJ I;  3SG7 A;  1TOP A;  1IWQ A;  1HDL A;  1WKX A;  3BFB A;  1PPF I;  3NGV A;  1SGE I;  1P28 A;  2CWF A;  4OV2 A;  1YVL A;  3DXL A;  2JQ6 A;  1Z7K B;  2KLD A;  2BNX A;  2JNX A;  1NCY A;  2KAV A;  2SGE I;  2ERW A;  2GKV A;  1HPT A;  3EK4 A;  4PAL A;  1XBT A;  1C3Y A;  3LLE A;  1YUU A;  1OMU A;  2WND A;  2JXC A;  1KQV A;  4N5X A;  2V1C A;  1YRU B;  1ZMZ A;  3WXA A;  3E2I A;  2KHN A;  2Y1N A;  4MPI A;  5CSI A;  3NSO A;  2CJS C;  4AOM A;  5E3P A;  2E5R A;  4E1P A;  1KSO A;  1SL7 A;  1SL8 A;  1IQ3 A;  3OX5 A;  1SBJ A;  2XRC A;  2A20 A;  1M31 A;  1TGS I;  1QLK A;  2NU1 I;  2X52 A;  1DJH A;  1SCM C;  2F8P A;  3B87 A;  1A75 B;  1DJW A;  1S5G Z;  4GFT A;  4GGF C;  3JTD B;  4GUK A;  1NX1 A;  2K7B A;  2LP3 A;  5FI2 A;  4PT1 A;  4INW A;  1R0R I;  1Y1B A;  2LLU A;  4DNC A;  5I94 A;  4PDZ A;  1FI6 A;  1QWV A;  1Y1X A;  4QJ4 B;  2L4H A;  3FIA A;  2Y4Q A;  2GKT I;  2OTG B;  2EC6 B;  4CFR A;  1CDP A;  4HGU A;  1UVF A;  2K60 A;  3KEV A;  1AHR A;  3GK1 A;  3PM2 A;  2L7X A;  1NPQ A;  2BBM A;  2YGU A;  1WGT A;  1V1F A;  3NSK A;  3DY9 A;  3K1E A;  2I7A A;  1QXP A;  1KFX S;  1G4Y R;  3R5B A;  3ICB A;  1AUI B;  2KI6 D;  2KMQ A;  3E59 A;  2NXQ A;  4DRW A;  2DKV A;  1RFH A;  4KYN A;  4MZJ A;  5ER5 A;  3CLN A;  1BLQ A;  3DD4 A;  1Q9B A;  3M0W A;  2QEH A;  2BEC A;  3FE8 A;  5HLO A;  2KAY A;  1YUR A;  3TOA A;  3GOX A;  3K21 A;  1QVI Z;  4PHK A;  2V53 A;  1AK8 A;  4USL A;  2F3C I;  1WLM A;  1TIH A;  4OVO A;  1Y6W A;  3O4X A;  3BXK A;  2KPH A;  5I2O A;  2K61 A;  1CFP A;  9WGA A;  1CLM A;  3LK1 A;  2LM5 A;  3CDN A;  3TUY C;  5F6T A;  2JZI A;  1SGP I;  4U8D A;  2B8T A;  1UVG A;  1QAT A;  1S5G Y;  2LVK A;  4WQ2 A;  1OOH A;  4MLW A;  3BOW B;  2K7C A;  2QQ0 A;  1TNP A;  1WGC A;  5CSN A;  1SCM B;  1JUO A;  1CSO I;  1YRT B;  2NU3 I;  1MR8 A;  1C7W A;  2E6W A;  2JTT A;  1ULN A;  3EG5 B;  1SYM A;  3WHT B;  1WRZ A;  1YUS A;  2FCD A;  1UUR A;  3OGN A;  1S20 A;  2TN4 A;  2H61 C;  4PE4 A;  4GAO A;  1FI5 A;  3PSR A;  4GBA A;  1ALW A;  5FUW A;  3R1V A;  3D75 A;  3UEY A;  3VGO A;  1WRK A;  1V1H A;  5FUX A;  1QTX A;  1J7R A;  1QLS A;  1QIW A;  1IRJ A;  1BU3 A;  1KFU L;  2GGM A;  2CWH A;  1NIW A;  1CDN A;  2VRG A;  3KPX A;  1EL4 A;  3IF7 A;  1KK8 C;  2KFG A;  2AMI A;  1SGQ I;  2I2R E;  1FAR A;  1DVI A;  1LS8 A;  3TO9 A;  1QVI Y;  3BFH A;  1PVB A;  2KBM A;  1SGD I;  4TNC A;  1DF0 B;  4QJ5 B;  2JUL A;  1YTZ C;  3AKA A;  1JBA A;  2KFH A;  4MRX A;  1KK7 Z;  5J8C A;  2ISD A;  2CWG A;  3QRX A;  5HQ8 A;  1K95 A;  3Q8I A;  2BCB A;  4FQT A;  4C0K A;  2LE9 B;  1A03 A;  2KGR A;  1S3P A;  3UGD A;  1A29 A;  1WY9 A;  1X02 A;  4ZCV A;  2ZRS A;  1CDL A;  5E3R A;  1YVH A;  2L50 A;  1OQP A;  1B47 A;  2PQ8 A;  1K96 A;  5PAL A;  3TUY B;  1IY5 A;  2RC4 A;  4OKH A;  1OW4 A;  2JU0 A;  2QQD A;  1E8A A;  3R5C A;  2Y0M A;  4HSZ A;  1DMO A;  5KSZ A;  5KU1 A;  3C1V A;  1BOD A;  1JWD A;  3R72 A;  3SS5 A;  2M8U A;  1PJU A;  1ZUZ A;  2E73 A;  3QWP A;  3S0D A;  3R5D A;  4OCI A;  1QV1 A;  4JKT A;  4GGN A;  2H2K A;  3PAT A;  2QEB A;  1F71 A;  3O2P A;  1F4O A;  5E3Q A;  3CR5 X;  3S0G A;  1Y1C A;  2QAC A;  2RGI A;  1DJX A;  1OSA A;  3AKB A;  1M8C A;  1OOI X;  4PHJ A;  4YRU A;  3IVT A;  1G33 A;  2KSP A;  4N1G A;  1BR4 B;  2J87 A;  3SEK C;  1YX8 A;  5FI7 A;  4N1F A;  4NDC A;  1UP5 A;  1U5I A;  2FOT A;  3BFA A;  2KLE A;  1MUX A;  3LK0 A;  1H4B A;  1CNP A;  3SS3 A;  4OR9 B;  1KK8 B;  3SG2 A;  1UHK A;  1K94 A;  1KWO C;  1KMA A;  2BL0 C;  2HPS A;  1RJV A;  2JW6 A;  4AQJ A;  2PVB A;  2K7O A;  1K7T A;  2LEO A;  2WC6 A;  1LVC D;  2CBL A;  3PLF B;  2WGC A;  2KAX A;  2WCE A;  1MJA A;  1B4C A;  1R2U A;  2JT3 A;  2NU0 I;  2Y5I A;  1P9Z A;  3WNX B;  3DZT A;  1PCE A;  3S0A A;  1WRL A;  1NCX A;  4DS7 A;  2LAN A;  3AAJ A;  1F54 A;  1KSM A;  2ELI A;  2BBN A;  2SCP A;  5CPV A;  3MEK A;  2SGQ I;  2OS8 C;  1UUC A;  2VRW B;  3TZ1 A;  3SG6 A;  2KOT A;  1XX6 A;  1H0Z A;  3QME A;  1SPY A;  1XO5 A;  2KQY A;  3OXF A;  3UEJ A;  3BUN B;  3CTN A;  1V1G A;  1OZO A;  2H61 A;  1GQM A;  2BAP A;  2E30 A;  3PN7 C;  2F3Z A;  5DKR A;  2PAL A;  3OHM B;  2M1K B;  1OMV A;  3D77 A;  4AML A;  1RK9 A;  1DEK A;  3BJH A;  2SGP I;  1YR5 A;  5FYX A;  1LA0 A;  1OOG A;  1DS2 I;  1QX2 A;  1IJ5 A;  2NCP A;  1ORG A;  5D3O A;  2M3W A;  2UZ3 A;  1EG3 A;  2ORW A;  1UWO A;  2M1U A;  1TIZ A;  1CFD A;  3EK8 A;  2ZN9 A;  5AXI A;  4QJ3 B;  2KNE A;  2WCH A;  2BKH B;  1LR8 A;  1CE3 A;  3VDU A;  1A4P A;  4ETO A;  5AAN A;  3UFF A;  4M2P A;  2B1U A;  1XA6 A;  1EG4 A;  1TCF A;  1PUL A;  2ODD A;  1K7V A;  4CPV A;  1CGI I;  5CSF A;  2JPO A;  2ARP F;  3RU0 A;  1XA5 A;  3D0Y A;  1Y0V H;  1N2D A;  4PE0 A;  5HL1 A;  5FI6 A;  2LNK A;  2NLN A;  1DTL A;  1CT4 I;  1KWO B;  3BUO B;  2BL0 B;  1HEV A;  3O4Y A;  1SCV A;  2CXJ A;  3D00 A;  1ULK A;  2W0T A;  1P9G A;  1C7V A;  5IBW A;  1PK0 D;  1S1E A;  4UXJ A;  3EVR A;  1PSB A;  4I5J A;  3NHT A; 
#chains in the Genus database with same CATH homology
 2KGB C;  4GBA A;  1IQ5 A;  1ALW A;  1QJT A;  1QX7 A;  5JOL A;  4DCK A;  1YU6 C;  2ENN A;  2WVJ A;  3OVO A;  4A4B A;  2IS9 A;  3PAL A;  1XVJ A;  3A4U B;  2JPT A;  2OVO A;  5FUW A;  5JHW C;  1DJZ A;  2O5G A;  1PTQ A;  3UEY A;  3VGO A;  2QPT A;  1WRK A;  1XK4 C;  2ORV A;  1V1H A;  5FUX A;  1QTX A;  1B8C A;  1J7R A;  1QLS A;  3VRP A;  1F70 A;  1QIW A;  2JZM A;  3SG4 A;  1IRJ A;  3EK7 A;  1J55 A;  1W7I B;  2LCP A;  5HLV A;  4CFQ A;  2LUY A;  2LLS A;  1C07 A;  1IW4 A;  1HJA I;  3UGL A;  1RTP 1;  2ZNE A;  1NUB A;  1BU3 A;  5GQQ C;  3UGI A;  2M29 A;  2LMU A;  2SAS A;  1VDD A;  2Q91 A;  1IKU A;  1KFU L;  1WDC C;  1S26 D;  4MBE A;  2GGM A;  2COL B;  1XFU O;  2KFF A;  2OS8 B;  5G08 A;  1SR6 B;  2M7L A;  1HQV A;  3OL0 A;  1NIW A;  1PTR A;  1CDN A;  2L51 A;  1CM1 A;  2VRG A;  3TDI A;  1FI5 A;  1W3S A;  2G9B A;  1XFX O;  1FAQ A;  1QAS A;  5K89 A;  3KPX A;  4AQI A;  1R6P A;  1EL4 A;  3JTD C;  2DIP A;  4YGA A;  3IQQ A;  2EHB A;  3IF7 A;  3FWC A;  2L2E A;  2GVI A;  1M39 A;  2K2A A;  3TDZ A;  1KK8 C;  4JCV E;  3BUX B;  1BF5 A;  1PAL A;  1NP8 A;  3LCP C;  1CFC A;  4YI9 A;  2KI4 B;  2KFG A;  1CTR A;  1X4S A;  2L4I A;  2AMI A;  4CID A;  1SGQ I;  1IY6 A;  1CMF A;  2I94 A;  2GV5 A;  4WRI A;  1CT2 I;  1UHN A;  2I2R E;  3HCM A;  5CCL A;  1BJF A;  1RWY A;  1L2O B;  1DVI A;  1FAR A;  1IG5 A;  2KCX A;  2M7N A;  1TOT A;  1U5K A;  3DVK A;  1MT1 A;  1OYV I;  1MF8 B;  1TBO A;  1QVI Y;  1KFU S;  2CNP A;  1PVB A;  3VRQ A;  2KBM A;  1CMG A;  3FC3 A;  2FNF X;  3I5H C;  1UHI A;  5EX0 A;  1SGD I;  2N52 A;  1HT9 A;  1NYA A;  2F2P A;  4UXH A;  4TNC A;  1DF0 B;  3PN7 B;  2OTG C;  2EC6 C;  3E3R A;  4QJ5 B;  1MHO A;  4FKD A;  2FJU B;  2JUL A;  4SGB I;  3VDP A;  1DF0 A;  1YTZ C;  2LV7 A;  2N1A B;  2LLT A;  1IGV A;  2WOS A;  3GK4 X;  1DGU A;  1OMD A;  2MAZ A;  1TCO B;  3AKA A;  3I5G C;  1JBA A;  3I5I B;  2KFH A;  4MRX A;  1KK7 Z;  4YGB B;  2KMP A;  2MRD A;  5AFP A;  3SJS A;  2JXD A;  2M5X A;  4MRY A;  3TJQ A;  1EXR A;  2D8N A;  2BCX A;  2ISD A;  3PFV A;  3CXL A;  1TNX A;  2AAO A;  3QRX A;  1G8I A;  2L98 A;  4JWQ A;  2NU4 I;  5HQ8 A;  1B9A A;  1K95 A;  4E68 A;  1GJY A;  1TUR A;  1LA3 A;  2BCB A;  2WC8 A;  1JC2 A;  1ZOT B;  1S6C A;  2QPO A;  4C0K A;  2LE9 B;  2ZND A;  1A03 A;  2KGR A;  1S36 A;  1S3P A;  2KI6 C;  3ZWH A;  1FYB A;  1B8L A;  2HET A;  3UGD A;  1A29 A;  4YI8 A;  1WY9 A;  1K9U A;  1UHH A;  1F4Q A;  1X02 A;  3FS7 A;  1F8H A;  3EKH A;  3O6B A;  1NX0 A;  2JTZ A;  2ZRS A;  4ZCV A;  3VRN A;  2LAP A;  4DIR A;  3GK2 A;  2NZ0 A;  1CDL A;  1KK7 Y;  1YVH A;  2OPO A;  2L50 A;  1OQP A;  1B47 A;  1S6J A;  1SK6 D;  3BUW B;  5EX3 A;  1GGZ A;  2ZN8 A;  1CGJ I;  2K0J A;  3HX4 A;  1SW8 A;  1TOP A;  1YUT A;  3SG7 A;  1QIV A;  2BE6 A;  2DB6 A;  1K96 A;  4F0Z B;  1IWQ A;  2NCO A;  2M0R A;  3VRO A;  3QTL D;  1HDL A;  1B7T Z;  3I5F C;  5PAL A;  3TUY B;  1IY5 A;  2J9R A;  2Y1M A;  1PPF I;  2M97 A;  3SGQ I;  3CR2 A;  1SGE I;  2MA2 A;  1KBE A;  4OKH A;  2JYY A;  1M63 B;  4YGE B;  1JFJ A;  2N71 A;  4OV2 A;  1FF1 A;  2WCB A;  4E1R A;  1JF0 A;  1YVL A;  4MVF A;  2JQ6 A;  2JU0 A;  2QQD A;  1Z7K B;  4ORB B;  4UXI A;  1AJ5 A;  4M2Q A;  1VRK A;  4DUQ A;  2JNX A;  1NCY A;  2BKI B;  1E8A A;  2JT8 A;  2KAV A;  2SGE I;  1DS3 I;  1PVA A;  2ERW A;  2I18 A;  4HSZ A;  1B7T Y;  1SR6 C;  2GKV A;  3F45 A;  1HPT A;  3EK4 A;  1DMO A;  4PAL A;  4PE1 A;  4Q04 A;  5DKQ A;  5KSZ A;  3VRR A;  2KMO A;  3B4V C;  1XBT A;  1OE9 B;  3KF9 A;  5B8I B;  5KU1 A;  1OOJ A;  4C0J A;  1TBR R;  3C1V A;  1BOD A;  3LLE A;  4MZL A;  1YUU A;  1XFV O;  4IL1 A;  2ZKM X;  3CZT X;  1OMU A;  2WCY A;  1JWD A;  2WND A;  2JXC A;  1KQV A;  2F3Y A;  2ZRT A;  4N5X A;  2LHL A;  2M8U A;  3MSE B;  5I2L A;  1PJU A;  1ZUZ A;  2V1C A;  1YRU B;  1ZMZ A;  3KY9 A;  1B1G A;  3WXA A;  1ALV A;  2E73 A;  3QWP A;  1BOC A;  4HRE E;  4NDD A;  5FUY A;  4PHM A;  3RLZ A;  3E2I A;  1Q80 A;  1J1E A;  3AAK A;  4OCI A;  1SRA A;  2AUC A;  1QV1 A;  2KHN A;  2Y1N A;  1H4B A;  3TS5 C;  4GGN A;  2H2K A;  4FQO A;  4GPL B;  1TUS A;  1SKT A;  3DVM A;  3PAT A;  1X74 A;  1F71 A;  1M46 A;  3O2P A;  1F4O A;  5CSI A;  4ORA B;  3CR5 X;  3NSO A;  1IH0 A;  2CJS C;  4AOM A;  3H4S E;  2E5R A;  1Y1C A;  4E1P A;  1KSO A;  1CLB A;  3EVV A;  2JWW A;  2QAC A;  3EKJ A;  2ZFD A;  2RGI A;  1DJX A;  5J3X A;  1M8B A;  1CLL A;  2MHH A;  4MEW A;  1SL7 A;  1SL8 A;  4B6D A;  1IQ3 A;  2QQC A;  1BR1 B;  1K9K A;  1OSA A;  3DVJ A;  2CTN A;  5I2Q A;  3OX5 A;  3AKB A;  1OZS A;  1M8C A;  4WQ3 A;  1SBJ A;  2XRC A;  4PHJ A;  3EVU A;  1D1O A;  2A20 A;  4YRU A;  1M31 A;  1TGS I;  2M49 B;  3CWG A;  1G33 A;  1QLK A;  2KSP A;  2NU1 I;  1ZAC A;  4N1G A;  1UUS A;  1MWN A;  4XJK B;  5CSJ A;  1BR4 B;  4A4C A;  1WDC B;  3VE5 A;  2J87 A;  1DJH A;  2K2F A;  1U5I B;  3OX6 A;  1SCM C;  1YX8 A;  2NU2 I;  1Y1A A;  4XJK A;  1BMO A;  4N1F A;  3SEK C;  4NDC A;  2F8P A;  1UP5 A;  1K8U A;  2BUS A;  1A75 B;  4D1E A;  1QS7 A;  1U5I A;  1REC A;  2JXL A;  2FOT A;  1DJW A;  1AJ4 A;  1SY9 A;  1S5G Z;  4GFT A;  1KQM C;  4PCW A;  2JT0 A;  1A75 A;  2WOR A;  2GKR I;  1MUX A;  3LK0 A;  4GGF C;  3JTD B;  4GUK A;  4I5K A;  1K93 D;  1NX1 A;  4L9M A;  1CNP A;  4OR9 B;  4YBH B;  1WLZ A;  5ER4 X;  2K7B A;  2BCA A;  2R2I A;  1KK8 B;  3SG2 A;  2LC5 A;  2LP3 A;  1UHK A;  1DJY A;  2F2O A;  5JJG A;  2YQP A;  1K94 A;  1R0R I;  1KWO C;  2MJW B;  1Y1B A;  2LLU A;  2B0U C;  1SGY I;  1BUS A;  2BL0 C;  2HPS A;  1KMA A;  3JVT C;  4P5O E;  4HRG A;  4P2Y B;  1FW4 A;  2JNF A;  3NSL A;  4PDZ A;  2M9G A;  1M45 A;  1RJV A;  1TTX A;  2JC2 A;  1FI6 A;  2JW6 A;  1Y8F A;  4A24 A;  4AQJ A;  3BJI A;  2PVB A;  1Y1X A;  2JA1 A;  3I5H B;  2K7O A;  2LEO A;  4QJ4 B;  2L4H A;  2BE4 A;  1GGW A;  2SGF I;  3FIA A;  2Y4Q A;  1EH2 A;  1LVC D;  3BYA A;  2GKT I;  2CBL A;  3PLF B;  1PSR A;  2EC6 B;  2OTG B;  1KFX L;  4CFR A;  4CLN A;  1CDP A;  1J1D A;  4HGU A;  5HKY A;  2KAX A;  5HKZ A;  3HH2 C;  4I5N B;  1UVF A;  2KBI A;  1J7Q A;  4JQ0 D;  3KEV A;  2WCE A;  1AHR A;  3GK1 A;  3I5G B;  4UPG A;  1KBF A;  1J7P A;  1UHJ A;  1B4C A;  1FPW A;  3DF0 B;  1R2U A;  2KQ6 A;  2L7X A;  1CKK A;  1NPQ A;  2JT3 A;  1TBN A;  5HI7 A;  2A4J A;  1W7J B;  2BBM A;  2Y5I A;  2NU0 I;  2JOJ A;  1B8R A;  1V1F A;  3OP0 A;  3WNX B;  3KHE A;  3NSK A;  4PHN A;  2CCM A;  2PAS A;  3FWB A;  1PCE A;  2I7A A;  1EJ3 A;  3NXA A;  2YUU A;  1WRL A;  2V1C C;  1NCX A;  4DS7 A;  2LAN A;  1QXP A;  3AAJ A;  1F54 A;  1OVO A;  1KSM A;  2ELI A;  1CB1 A;  2BBN A;  1KFX S;  2SCP A;  5CPV A;  3OB2 B;  1G4Y R;  4YGD B;  3ICB A;  3MEK A;  3DVE A;  1AUI B;  2DOQ A;  2K9H A;  2KI6 D;  2OS8 C;  2KMQ A;  1UUC A;  2SGQ I;  2VRW B;  1SL9 A;  3D10 A;  3TZ1 A;  2LUX A;  5AEQ A;  3SG6 A;  1J7O A;  4I5L B;  2KOT A;  3E59 A;  5D69 A;  3RM1 A;  1DJI A;  5DAE A;  2NXQ A;  4DRW A;  1OMR A;  2EGD A;  1XX6 A;  1NCZ A;  1IJ6 A;  1TNQ A;  4GNK B;  1CHO I;  1K2H A;  1H0Z A;  1RFH A;  1V1I A;  1SPY A;  1XO5 A;  1Y1U A;  2OD1 A;  1PRW A;  3I5F B;  3IQO A;  4MZJ A;  3KO0 A;  5DKN A;  2KI4 C;  3O78 A;  1L7Z A;  3CLN A;  1SMG A;  2KQY A;  5ER5 A;  3SIB A;  3OXF A;  3UEJ A;  3SG5 A;  1BLQ A;  1L2O C;  3DD4 A;  3BUN B;  3CTN A;  4MSP A;  2MBX A;  1SGR I;  2KYC A;  3M0W A;  1V1G A;  2K8M B;  4XYN A;  1OZO A;  2LVJ A;  2H61 A;  1GQM A;  5D7F A;  1QV0 A;  1OMT A;  2BEC A;  2HF5 A;  2HQ8 A;  2PMY A;  2E30 A;  2LVI A;  5HLO A;  2PRU A;  2N17 A;  1JSA A;  1N65 A;  2GGZ A;  3PN7 C;  5I8N A;  2FCE A;  2F3Z A;  5DKR A;  2KAY A;  1MXE A;  2PAL A;  4NQG A;  1YUR A;  1XYD A;  1KCY A;  4MZK A;  3GOX A;  3OHM B;  1DJG A;  2M1K B;  1OMV A;  2LMT A;  3K21 A;  2SGD I;  1TN4 A;  1QVI Z;  1N13 A;  1DGV A;  1SNL A;  2HQW A;  1YX7 A;  1TBQ R;  1RK9 A;  3I5I C;  4ORC B;  4BY5 A;  3BUM B;  3OXG A;  2CT9 A;  3WHU B;  2PSR A;  3CGA A;  2MLE C;  1XK4 A;  2O60 A;  2SGP I;  1YR5 A;  4PHK A;  5FYX A;  2V53 A;  1LA0 A;  1TNW A;  2KDH A;  3CS1 A;  1DS2 I;  1QX2 A;  2L0P A;  1IJ5 A;  1K9P A;  3LL8 B;  1SGN I;  2NCP A;  1AK8 A;  1ODB A;  1AN1 I;  3NSI A;  3A8R A;  5BPJ A;  3SGB I;  4USL A;  2M3W A;  2UZ3 A;  1JFK A;  1EG3 A;  2F3C I;  4R1E A;  1WLM A;  1LKJ A;  1TIH A;  5HKW A;  3TS5 B;  2ORW A;  4OVO A;  1UWO A;  2M1U A;  1Y6W A;  1TIZ A;  1BT6 A;  3BXK A;  1CFD A;  2F33 A;  2LMV A;  3EK8 A;  3OB1 B;  2P6A C;  1NX3 A;  2JRF A;  4ZCU A;  1LXF C;  2ZN9 A;  1DT7 B;  5I2O A;  2K61 A;  3CR4 X;  4NDB A;  2LUC A;  4YGC B;  5AXI A;  4QJ3 B;  2LHI A;  1CFP A;  1YTP A;  2KNE A;  1FBV A;  1BG1 A;  1CLM A;  3LK1 A;  2LM5 A;  2BKH B;  1MXL C;  4ICB A;  3ZNI A;  3TUY C;  1AVS A;  1NWD A;  1LR8 A;  1CE3 A;  5F6T A;  2JZI A;  2LP2 A;  1A4P A;  4ETO A;  1SGP I;  3VDU A;  4U8D A;  5AAN A;  1CDM A;  3UFF A;  5KTY A;  5TNC A;  4M2P A;  2B8T A;  1UVG A;  1QAT A;  1S5G Y;  2LVK A;  4WQ2 A;  4MLW A;  1S6I A;  2ENZ A;  2B1U A;  5CCM A;  1XA6 A;  2P6B B;  1EG4 A;  1TCF A;  3BOW B;  1PUL A;  2K7C A;  2KYF A;  2ODD A;  4CPV A;  2QQ0 A;  1CGI I;  4FTG A;  3SIA A;  5CSF A;  1TNP A;  3BOW A;  1SCM B;  1JUO A;  1NX2 A;  5CSN A;  4GI3 C;  1A2X A;  2ARP F;  1CSO I;  1YRT B;  3D0Y B;  1MR8 A;  1JF2 A;  2NU3 I;  3RU0 A;  1C7W A;  1XA5 A;  2E6W A;  2JTT A;  2L5X B;  1SYM A;  3D0Y A;  5HYD A;  2QQE A;  1KQM B;  4BY4 A;  1CFF A;  1TRF A;  3DF0 A;  1Y0V H;  1N2D A;  3WHT B;  1RRO A;  1XFZ O;  4PE0 A;  1MQ1 A;  1R79 A;  4JPZ B;  4M2O A;  1CT0 I;  4GGF A;  1CM4 A;  2LNK A;  1WRZ A;  4MN0 A;  1W4R A;  2K7D A;  2NLN A;  1DTL A;  1AP4 A;  1N0Y A;  1CT4 I;  1K90 D;  1KWO B;  5FUV A;  3BUO B;  2BL0 B;  4OVN F;  3JVT B;  1F55 A;  1YUS A;  1ZFS A;  2FCD A;  1QX5 B;  2Q4U A;  3O4Y A;  3TDU A;  1UUR A;  1SCV A;  3BQ3 A;  4PE7 A;  2L8E A;  4C0L A;  4HRH A;  2ROW A;  1LIN A;  3SG3 A;  2CXJ A;  1NSH A;  3D00 A;  2WCF A;  2W0T A;  1LR9 A;  2KMR A;  2TN4 A;  2H61 C;  2LVV A;  1C7V A;  3PDN A;  4PE4 A;  2MLF C;  5IBW A;  1PK0 D;  1S1E A;  1XFY O;  5AER A;  4UXJ A;  2G2B A;  1PSB A;  3EVR A;  1XFW O;  3PM8 A;  4GAO A;  4I5J A;  1RFJ A;  1H8B A;  1LR7 A;  3GOF A;  3PSR A;  3OXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...