1NUBA

Helix c deletion mutant of bm-40 fs-ec domain pair
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
226
structure length
226
Chain Sequence
b'APCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BASEMENT MEMBRANE PROTEIN BM-40
publication title Crystal structure and mapping by site-directed mutagenesis of the collagen-binding epitope of an activated form of BM-40/SPARC/osteonectin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Extracellular module
total genus 71
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
A PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nubA02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1nubA01
1QLSA 4MZKA 2KSPA 1B8LA 4DIRA 1F71A 1CFDA 5CSFA 2KBIA 1J7OA 2I94A 3O4YA 1ZOTB 2KAYA 1YVLA 2F8PA 2WCFA 4M2QA 3DF0A 2Y1MA 4WQ2A 4YBHB 3NXAA 4MRXA 1QX5B 5AANA 3NSKA 1K94A 1K95A 3EK4A 1AP4A 3SGBI 1QV0A 3JTDC 4XJKB 1TIZA 2BBNA 3SG7A 1S3PA 5KU1A 1PJUA 3SG4A 2M3WA 1BR1B 2P6BB 3JTDB 2MLEC 3EKJA 4OVOA 2I7AA 2V53A 1C7WA 1JWDA 1V1FA 1ODBA 1C7VA 2JZIA 1R6PA 1LA0A 1U5IA 3QRXA 3HH2C 4D1EA 2K7BA 1DVIA 5DKNA 1CB1A 1DS3I 2KNEA 1NCXA 1CDNA 1SL7A 2NZ0A 2SCPA 4YGCB 1FBVA 4F0ZB 1J1DA 1Y1BA 1MXEA 1F54A 2JRFA 4OVNF 2BCBA 2PVBA 3BUXB 1G4YR 1K96A 1KK7Z 2M49B 1DJIA 1YX7A 3HX4A 1V1GA 3RLZA 5ER4X 3TDUA 4YGDB 1BJFA 1G33A 3KF9A 1IRJA 2Q4UA 1SYMA 1MHOA 4A4BA 1OMTA 1TRFA 3OB1B 3D0YA 4PE4A 3BUWB 1BLQA 4AQIA 2GV5A 3H4SE 2M9GA 1TCFA 1DS2I 5ER5A 4M2PA 2CBLA 3NSIA 1QX2A 1PCEA 2OTGB 1OE9B 4ORCB 4PE1A 2L51A 1PVBA 3WHUB 1B47A 1KFXL 5CSJA 2BUSA 1S1EA 1IW4A 2G9BA 1S26D 3B4VC 4HRGA 3TS5B 4GGFA 2MRDA 1R0RI 1QIVA 2KAXA 5HKYA 2JZMA 1NPQA 2K61A 3PN7C 5HYDA 1SPYA 2HPSA 1A2XA 1PRWA 4I5NB 1JF2A 3PN7B 5HLOA 1TBQR 1EXRA 1IG5A 1K8UA 1J1EA 1AJ4A 1BG1A 1M45A 2DOQA 1MUXA 1AHRA 2L5XB 2LC5A 4HRHA 1CLBA 1CHOI 5B8IB 2ZN8A 2AMIA 5GQQC 1SR6C 1TCOB 1UP5A 3BQ3A 1PSRA 2K0JA 1XK4A 3LK0A 4GNKB 5G08A 5PALA 2LP2A 1NIWA 4DRWA 1S6JA 1WLMA 1QTXA 3MSEB 4BY5A 1LXFC 2LMVA 4I5JA 1PALA 4USLA 2LM5A 2WNDA 1QV1A 2Q91A 4YGBB 1DTLA 1M31A 1S5GY 3KO0A 1MT1A 1TBRR 1KK8C 1TURA 2FCEA 2H61C 4MBEA 3CR4X 3CR2A 1DJYA 1K9KA 1KK8B 4GAOA 2HF5A 1LR7A 1HT9A 2LAPA 3CLNA 2L0PA 2K8MB 1DJHA 4TNCA 4SGBI 3KPXA 1CGII 2MJWB 3VRQA 4ZCUA 1CGJI 1BODA 1CSOI 2QQCA 1LINA 2SGPI 1TNWA 2WOSA 1XFXO 2MHHA 1X02A 1DMOA 2M29A 2WCEA 2KBMA 1MXLC 1B8RA 2PSRA 3HCMA 5JJGA 2P6AC 3SJSA 2F3YA 4HSZA 1MWNA 1ALWA 2VRGA 3PALA 1Q80A 1YR5A 3AAKA 3IQQA 1NX0A 4ETOA 3FIAA 1M39A 1IQ5A 1SL9A 1EG4A 1DF0A 2JTTA 3AKAA 1FI5A 1OYVI 4ZCVA 1M8BA 1S5GZ 4OR9B 1IJ5A 3ZWHA 1S6CA 2WORA 1CFPA 2JPTA 1MR8A 1QASA 3BUMB 4C0JA 4P5OE 4JPZB 1YVHA 2KAVA 3DF0B 5HLVA 2ZRTA 2ZN9A 4CPVA 1QS7A 3WHTB 3OX5A 4OKHA 1KFUS 1M63B 5I2LA 1KCYA 3O6BA 1N65A 2LVJA 2M8UA 4Q04A 1Z7KB 3SEKC 2SGEI 1XFUO 1XFWO 2JT0A 1U5IB 1YURA 4FQOA 4GGNA 1DT7B 1H8BA 1OQPA 4CLNA 5JHWC 2KI4C 3CGAA 2NCOA 1PK0D 1KWOC 1JUOA 3GK2A 3VROA 3EVRA 5K89A 1IGVA 2KI4B 4UPGA 2JNXA 3VRPA 1KWOB 2COLB 1TNXA 1KQMC 2WC8A 2O5GA 2Y4QA 1CMGA 3CR5X 1SMGA 3M0WA 1EH2A 4CIDA 1N13A 1GQMA 1KQMB 1RJVA 5BPJA 4MVFA 1NSHA 2M1KB 1DJWA 3D0YB 1SCMC 1TNQA 1W7JB 3I5IC 1WRKA 5AERA 2AUCA 1SCMB 1F4OA 1SGQI 3I5IB 2JXDA 1TOPA 1FW4A 2ZNEA 4WRIA 2Y1NA 2M1UA 2O60A 1NCZA 5CSNA 4YGAA 2KMRA 1WRZA 2M0RA 5HKZA 1M46A 4GGFC 2A4JA 2QPTA 2KFFA 4C0LA 2F3CI 1SKTA 1EL4A 1FYBA 2L4IA 1JF0A 3E3RA 2K7DA 1KSOA 4L9MA 1G8IA 1QIWA 4I5LB 1RTP1 1XK4C 1UHHA 4YRUA 1CM1A 4QJ5B 1N0YA 3KHEA 2JT8A 4MEWA 2BCAA 2WCBA 4PHJA 1JFJA 1F70A 1J7PA 1AJ5A 3C1VA 1UURA 3LCPC 3PM8A 1DJXA 2R2IA 4IL1A 1YX8A 3OP0A 5AFPA 1PSBA 2GGZA 1UVGA 3TDIA 1W7IB 3EKHA 1IQ3A 4MRYA 1YTZC 2LANA 3AAJA 4GI3C 1B7TY 3BXKA 1KMAA 4PHKA 2K2AA 3OHMB 3CZTX 2SGFI 1CE3A 2LLSA 1B9AA 3A8RA 2LHIA 3QTLD 2BL0C 2FCDA 1OSAA 2KMQA 1LKJA 1VRKA 2KYFA 2LMUA 2LP3A 1DGUA 1SGNI 4AQJA 1HDLA 1SR6B 2BL0B 1NUBA 2KHNA 1NP8A 1OOJA 4HREE 5J3XA 1BUSA 2KMOA 3TZ1A 3SG6A 2L2EA 1ZFSA 2SASA 1YUSA 3OX6A 5CPVA 1UHKA 1MF8B 1TTXA 3I5GC 2LLTA 3PFVA 1CKKA 2SGDI 3VRNA 3I5GB 1OVOA 3LK1A 1CMFA 1CTRA 1XYDA 1J7QA 1KQVA 1TGSI 2QQDA 1CNPA 4NDDA 1DF0B 3F45A 2JWWA 2ZKMX 1KFXS 1Y0VH 1YUTA 3JVTC 4GFTA 4P2YB 2BKHB 4YGEB 5D69A 2NU0I 1SGEI 3JVTB 1F8HA 2ISDA 1UVFA 1B7TZ 3AKBA 1Y1UA 1OMRA 3SG5A 2RGIA 5AEQA 1OMVA 4U8DA 3GOFA 4N1FA 2BE4A 2ARPF 1UHNA 1PVAA 4DUQA 1D1OA 2SGQI 1ZMZA 1JC2A 1B8CA 1LVCD 4GUKA 5HKWA 1XA5A 1SGDI 4PE0A 2FJUB 5AXIA 3BOWA 1GGWA 2M7NA 3O78A 2KGBC 1YUUA 1K2HA 3CWGA 1SW8A 1NX2A 2MA2A 4ICBA 1XFYO 4YI9A 4OCIA 4C0KA 1WDCC 5IBWA 4QJ3B 4OV2A 1RFJA 1J55A 4GBAA 5F6TA 1WDCB 2F33A 1DGVA 2QACA 1A03A 2JYYA 1K9UA 2NXQA 3VRRA 2OS8C 1OZSA 1NYAA 2L98A 1A75A 4GPLB 2OS8B 4MSPA 2BKIB 2JXLA 1RWYA 1Y1AA 3DVMA 4NDBA 2LCPA 1S36A 1HQVA 2Y5IA 1IKUA 1XVJA 3BUNB 4YI8A 1TIHA 1WY9A 2K7CA 2F3ZA 1FI6A 2E6WA 2L50A 1B4CA 3WXAA 4AOMA 1CLLA 2K7OA 3A4UB 3SIAA 1SY9A 3EVUA 1UUCA 2N17A 1UHJA 3DD4A 3PATA 2NU3I 1CDPA 1DJZA 2BCXA 1IJ6A 4PCWA 1QJTA 2EC6C 2CCMA 2CXJA 4XYNA 3DVJA 2KYCA 2EC6B 2LNKA 2CTNA 2F2OA 2N71A 2KI6C 1AK8A 1OMUA 2ZNDA 1NX1A 2CT9A 2LLUA 1XO5A 2LV7A 1UWOA 2PALA 2WCYA 2ERWA 2JXCA 2KDHA 2PASA 3ZNIA 2M5XA 2CNPA 2LUXA 1LA3A 3WNXB 1HJAI 1TN4A 2LVIA 4PE7A 4PHNA 3TUYC 1YTPA 4MLWA 1AVSA 3IQOA 2BBMA 1RECA 2JTZA 3CTNA 1FF1A 3TUYB 4E68A 1BR4B 1SGRI 1SBJA 1E8AA 2L4HA 4JWQA 4CFRA 4DS7A 4ORAB 5D7FA 2NU1I 4CFQA 1EG3A 3TDZA 1UHIA 5I2OA 3I5FC 2LUCA 3FS7A 1LR8A 2NU2I 3I5FB 1CT0I 4N5XA 1F4QA 1K90D 4XJKA 3RM1A 2MBXA 1K93D 1L7ZA 3BUOB 1QX7A 3GK1A 2FOTA 1UUSA 2I2RE 2JT3A 1IY5A 1XFZO 2K2FA 5CSIA 1JSAA 3PLFB 2NCPA 4I5KA 4BY4A 2GKVA 3DVKA 2HETA 1SL8A 1BMOA 3NSLA 1BOCA 3PSRA 1H4BA 1CT4I 3SG2A 1QLKA 1WLZA 2I18A 3KEVA 3SIBA 1DJGA 2G2BA 5DAEA 1A4PA 2GKTI 2OTGC 3TJQA 1GJYA 3LL8B 4NDCA 1NWDA 1FPWA 2ZRSA 2KCXA 1IWQA 4MZLA 3CS1A 2MAZA 3D10A 4JQ0D 3TS5C 4PDZA 4NQGA 1RK9A 1NX3A 3FWBA 2GGMA 2LVVA 5I2QA 1JFKA 2AAOA 1AN1I 2KGRA 5JOLA 3O2PA 3SG3A 1F55A 2NU4I 1SCVA 1CT2I 2M7LA 1CDMA 2IS9A 2LHLA 1HPTA 3EK7A 1SRAA 2BE6A 2LMTA 2KFHA 3EK8A 3K21A 3IF7A 1ZACA 3GK4X 1LR9A 3LLEA 3BOWB 2KQYA 4MZJA 1BF5A 1SNLA 1QXPA 3BYAA 3FWCA 2H2KA 5TNCA 3OVOA 1C07A 1GGZA 2HQWA 1CM4A 1OZOA 1KFUL 4PALA 2KFGA 4A4CA 5I8NA 2B1UA 2PMYA 1SGPI 2NLNA 3ICBA 1CFCA 1MQ1A 2OPOA 2LEOA 4DCKA 1CFFA 5KTYA 1QATA 1BU3A 2MLFC 1BT6A 1A75B 1TNPA 1EJ3A 4PHMA 1OMDA 1QVIY 3DVEA 2TN4A 2ZFDA 2GKRI 1PULA 2PRUA 4QJ4B 3VGOA 1IH0A 5DKRA 5FYXA 1S6IA 1ALVA 2JULA 1Y1CA 1R2UA 2JQ6A 1KSMA 4WQ3A 1Y6WA 1IY6A 4HGUA 2EGDA 2JU0A 2JC2A 3I5HC 5DKQA 2H61A 2B0UC 1H0ZA 2XRCA 1A29A 1N2DA 3I5HB 1AUIB 2HQ8A 4ORBB 1B1GA 2KOTA 2LVKA 4N1GA 1ZUZA 2BECA 2OVOA 2KMPA 2N52A 1CDLA 2LE9B 1PPFI 2KQ6A 1YRTB 4MN0A 1CLMA 2KI6D 4M2OA 5KSZA 1JBAA 3OB2B 3SGQI 1K9PA 2EHBA 3NSOA 4R1EA 2M97A 1QVIZ 3EVVA 1L2OC 4FTGA 1YU6C 2JOJA 1SGYI 2E30A 1YRUB 2JNFA 1L2OB 1NCYA 1XFVO 1RROA 1SK6D 1TUSA 1WRLA 1M8CA 2D8NA 1Y1XA 2F2PA 1J7RA 1KK7Y
chains in the Genus database with same CATH superfamily
4MZKA 1CFDA 2KBIA 2I94A 1ZOTB 2WCFA 3NXAA 2JPOA 3NSKA 1K94A 1QV0A 1PJUA 3SG4A 2M3WA 1BR1B 2P6BB 2MLEC 1Z2IA 2I7AA 2JZIA 1LA0A 4MPIA 5DKNA 1CDNA 1SL7A 2A20A 2SCPA 1Y1BA 1FBVA 1J1DA 1MXEA 4OVNF 2BCBA 3UGIA 1YX7A 1V1GA 3TDUA 3KF9A 1IRJA 2Y0MA 4A4BA 1TRFA 4PE4A 1BLQA 4AQIA 3NSIA 1PCEA 4PE1A 2L51A 3WHUB 1B47A 5CSJA 2BUSA 2JA1A 2G9BA 1S26D 2MRDA 2K61A 4OZDA 2HPSA 1JF2A 1K8UA 3BFHA 1M45A 2LC5A 1CHOI 2AMIA 1PSRA 5G08A 4DRWA 1NIWA 3OXGA 4I5JA 2ELIA 2LM5A 3CR4X 1DJYA 1K9KA 4GAOA 2HF5A 2K8MB 1DJHA 1V1HA 3KPXA 1BODA 1CSOI 1LINA 3HCMA 2P6AC 3FIAA 1SL9A 1NXUA 3D75A 2JTTA 3AKAA 2OD1A 4ZCVA 1M8BA 3KY9A 4OR9B 2WORA 2JPTA 1MR8A 1QASA 3BUMB 4C0JA 3D74A 3D00A 2ZRTA 4CPVA 3OX5A 1KFUS 1KCYA 3O6BA 3FSXA 2DIPA 1XFUO 4FQOA 1H8BA 4E1PA 5JHWC 2KI4C 3CZ0A 1IGVA 2KI4B 2JNXA 2COLB 1EH2A 3CR5X 1SMGA 2H8VA 4MVFA 1W7JB 3R5DA 2PYQA 2Y1NA 2ERBA 1FYBA 3E3RA 4INWA 1KSOA 4I5LB 1XK4C 2WCBA 1F70A 1JFJA 3QAHA 1AJ5A 1DJXA 1UVGA 3TDIA 4MRYA 1XFRA 1C3YA 1YTZC 3AAJA 4PHKA 1OOGA 2SGFI 2LLSA 1B9AA 2FCDA 2LMUA 1HDLA 2KHNA 4HREE 1NP8A 5J3XA 1BUSA 3TZ1A 5CPVA 3VB1A 1TTXA 3I5GC 1S20A 3I5GB 1CTRA 1XYDA 1J7QA 2QQDA 1DF0B 2CWHA 3BFBA 3FC3A 2ISDA 5FI2A 1OMRA 3SG5A 1OMVA 5EX0A 4JD9A 4N1FA 2BE4A 1PVAA 2LUYA 1ZMZA 4GUKA 1XA5A 3R5AA 4UXJA 3O78A 1K2HA 2MA2A 1RFJA 3B86A 2JYYA 2NXQA 1NYAA 2L98A 1A75A 4MSPA 4WP4A 1WY9A 3L4LA 2L50A 1B4CA 4AOMA 3SIAA 2N17A 1CDPA 1QWVA 1DJZA 2BCXA 2CXJA 2RC4A 3TO9A 3DVJA 2CTNA 2OU2A 2N71A 2ZNDA 1NX1A 2CT9A 1XO5A 2LV7A 1UHAA 2KDHA 2PASA 3B6XA 4PE7A 2JTZA 3CTNA 5EL2A 2L4HA 4CFRA 4DS7A 2NU1I 1PTRA 3TDZA 3I5FC 2LUCA 2QEOA 3I5FB 1F4QA 1L7ZA 3GK1A 2JT3A 3UEJA 1XFZO 5CSIA 2YQPA 1MJAA 3PLFB 2HETA 3SG2A 3KEVA 5DAEA 1A4PA 2OTGC 1TOTA 2QEHA 2L5YA 4MZLA 3QWPA 3CS1A 4JQ0D 3PDNA 4NQGA 2GGMA 3N7HA 1CT2I 1SSEB 1Z4HA 2ODDA 3DZTA 3GK4X 4DNCA 1SNLA 1QXPA 2H2KA 1C07A 1GGZA 2HQWA 2B1UA 3TO7A 1SGPI 7WGAA 3R5CA 1DELA 3IVTA 3VDUA 1PULA 5EX3A 1ALVA 4HGUA 2EGDA 2JC2A 1N2DA 4IJ7A 1AUIB 4ORBB 3NHTA 1ZUZA 2KMPA 1CDLA 2LE9B 1JBAA 3NSOA 2M97A 3EVVA 1L2OC 4FTGA 1T14A 2JOJA 1YRUB 2JNFA 1L2OB 1TUSA 1WRLA 1BT6A 1B8LA 3O4YA 2CWGA 2F8PA 4M2QA 4YBHB 3EK4A 1AP4A 4XJKB 1TIZA 4OVOA 1C7WA 3TO6A 1V1FA 1ODBA 1C7VA 1R6PA 3HH2C 4D1EA 1DS3I 2KNEA 3BUXB 3UFFA 1KK7Z 2M49B 1DJIA 4PT1A 2Q4UA 2GV5A 3H4SE 1TCFA 4M2PA 2CBLA 4ORCB 2WCLA 2ROWA 1S1EA 1P9ZA 1QIVA 3DXLA 2JZMA 3GOXA 5HLOA 1J1EA 1AJ4A 1MUXA 1CLBA 1SR6C 1XK4A 2LMVA 4USLA 1IIOA 4YGBB 3KO0A 1HEVA 1TBRR 1MT1A 4INXA 2BAPA 2LAPA 2L0PA 1CGJI 1TNWA 1XFXO 2MHHA 1X02A 1DMOA 2WCEA 1GM0A 1B8RA 2OZUA 1MWNA 1FAQA 2VRGA 3PALA 1Q80A 3IQQA 1IQ5A 1EG4A 3R72A 1DF0A 1FI5A 1S5GZ 3ZWHA 1CFPA 2FNFX 4P5OE 2KPHA 4OKHA 1WGTA 4Q04A 1TUZA 1XFWO 1ULMA 4CLNA 1JUOA 3GK2A 4UPGA 2X3TA 2QDIA 1TNXA 2WC8A 1CMGA 2O5GA 3M0WA 2WC6A 1N13A 1GQMA 1RJVA 2J9RA 1NSHA 3D0YB 2ZNEA 3R1VA 4WRIA 2K60A 5E3QA 1WRZA 2M0RA 5HKZA 1M46A 5FUXA 5FUYA 2UVOA 2KFFA 4C0LA 2F3CI 1Y8FA 1JF0A 2K7DA 2B8TA 4L9MA 1QIWA 1RTP1 4MEWA 1J7PA 2R2IA 3VDPA 3OP0A 1DEKA 5HQ8A 1W7IB 3EKHA 3FE6A 4GI3C 3CZTX 2BL0C 2KMQA 1VRKA 2BL0B 2KMOA 3SG6A 1YUSA 1WTJA 1MF8B 2LLTA 3LK1A 2X52A 1TGSI 2JWWA 1X74A 1YUTA 3JVTC 2BKHB 2NU0I 1SGEI 3JVTB 2DB6A 1B7TZ 3AKBA 1Y1UA 5AEQA 3D73A 4U8DA 3GOFA 1UHNA 1D1OA 1JC2A 5HKWA 1SGDI 4PE0A 5FUWA 5D3OA 3BFAA 1NX2A 4YI9A 4GPLB 2BKIB 1Y1AA 4NDBA 2LCPA 2ORVA 1V1IA 1S36A 3BUNB 2F3ZA 3WXAA 1CLLA 3A4UB 3QMEA 2GVIA 1QJTA 2CCMA 4XYNA 3B87A 2F2OA 2KI6C 2WCYA 2ERWA 2JXCA 3ZNIA 3WNXB 2LVIA 3TUYC 4KYNA 1YTPA 4MLWA 3IQOA 1FF1A 3TUYB 4E68A 1E8AA 1UHIA 2K9HA 3FS7A 1CT0I 4N5XA 4XJKA 1QX7A 1JSAA 1W4RA 1MJBA 2NCPA 4BY4A 3DVKA 3CZ2A 1BOCA 1CT4I 2I18A 4UXHA 3TJQA 3LL8B 1NWDA 3R1OA 4UXIA 2KCXA 2DKVA 2ORWA 2MAZA 3D10A 3TS5C 3FWBA 3UNWA 3DY9A 1AN1I 3B88A 2N1AB 3SG3A 1F55A 1SCVA 5CCLA 2M7LA 2KFHA 2FJYA 3LLEA 3BOWB 1BF5A 3OVOA 1CM4A 4PALA 2KFGA 3UOEA 1CFCA 4DCKA 1BU3A 2MLFC 1TNPA 1EJ3A 1OMDA 3DVEA 2ZFDA 2GKRI 5DKRA 5FYXA 1R2UA 4WQ3A 1Y6WA 1IY6A 2JU0A 3I5HC 5DKQA 2XRCA 1A29A 3I5HB 4N1GA 2BECA 2N52A 1YRTB 4MN0A 2KI6D 3OB2B 3SGQI 4R1EA 1QVIZ 5FI7A 1YU6C 4A24A 2E30A 1NCYA 1XFVO 1M8CA 4FKDA 1KK7Y 5CSFA 1J7OA 1YVLA 2Y1MA 5AANA 4MRXA 1TWOA 1K95A 3UO9A 3JTDC 1S3PA 3JTDB 1R79A 2RIJA 2WGCA 2K7BA 1DVIA 1CB1A 5J8CA 1NCXA 4YGCB 4F0ZB 1TUJA 2JRFA 1G4YR 1K96A 3HX4A 2JW6A 1OOFA 4YGDB 1G33A 1SYMA 1MHOA 1OMTA 3D0YA 5ER5A 1QX2A 2OTGB 1KFXL 1IW4A 4JKTA 4HRGA 3R5BA 2CWFA 1NPQA 1PRWA 1IG5A 1BG1A 2PQLA 1AHRA 1ULKA 5B8IB 5PALA 3BQ3A 3LK0A 2LP2A 1S6JA 3MSEB 4BY5A 1PALA 2WNDA 1QV1A 1S5GY 2H61C 4MBEA 3CR2A 1DQEA 1HT9A 4SGBI 4ZCUA 2QQCA 2WOSA 3OGNA 1MXLC 2PSRA 5JJGA 2F3YA 3CZ1A 3TOBA 1ALWA 3AAKA 1YR5A 4ETOA 1M39A 1KBFA 1OYVI 1IJ5A 1S6CA 2YUUA 4JPZB 5HLVA 2KAVA 3DF0B 3WHTB 3EG5B 5I2LA 1N65A 2M8UA 3CYZA 1Z7KB 2SGEI 1DT7B 1U5IB 4GGNA 9WGAA 3CGAA 2NCOA 3FE8A 1KWOC 3EVRA 3DYEA 1KWOB 1RFHA 2WCMA 2Y4QA 4CIDA 3NGVA 1SCMC 1TNQA 1WRKA 1SCMB 1F4OA 2JXDA 2QEBA 1TOPA 2M1UA 2O60A 5CSNA 4YGAA 2KMRA 4GGFC 1DC1A 2QPTA 3L4AA 1FARA 5J8FA 1LS8A 1CM1A 4QJ5B 1N0YA 3KHEA 2JT8A 2BCAA 4PHJA 3LCPC 3PM8A 1YX8A 5AFPA 2GGZA 3UGDA 1IQ3A 2LANA 1B7TY 3BXKA 1KMAA 2QQEA 2K2AA 1CE3A 3A8RA 3QTLD 1Q9BA 1LKJA 2KYFA 1SR6B 2L2EA 1ZFSA 2SASA 1XA6A 3VRNA 1OVOA 1CMFA 1KQVA 3F45A 2ZKMX 1KFXS 4P2YB 4YGEB 5D69A 2GTEA 3D77A 1F8HA 1UVFA 2PQ8A 3BOWA 1GGWA 3SS5A 2KGBC 2P70A 1YUUA 1WDCC 5IBWA 3L47A 4QJ3B 3OXFA 1WDCB 2QACA 1A03A 1K9UA 3VRRA 2OS8C 1OZSA 3FE9A 1OW4A 2OS8B 3E59A 3RU0A 1IKUA 4YI8A 3UGLA 1TIHA 2K7CA 1U5KA 2K7OA 1SY9A 3EVUA 1UUCA 1UHJA 3PATA 2EC6C 2CJSC 3MEKA 2EC6B 2LNKA 1AK8A 1OMUA 2LLUA 2PALA 2M5XA 2CNPA 1LA3A 2WVJA 1AVSA 3FSYA 1RECA 1BR4B 1SGRI 1SBJA 1KBEA 1EG3A 1LR8A 2NU2I 1K93D 1UUSA 2I2RE 1IY5A 2K2FA 3D76A 2GKVA 1BMOA 3PSRA 1H4BA 1QLKA 1WLZA 3SIBA 1GJYA 1IWQA 3S0GA 4PDZA 1RK9A 1NX3A 3B7AA 5FI6A 2KGRA 5JOLA 3O2PA 2NU4I 2IS9A 2LHLA 2P71A 1HPTA 1SRAA 3EK8A 3IF7A 2QPOA 4MZJA 3BYAA 3FWCA 1OZOA 1MQ1A 2OPOA 2LEOA 1CFFA 5KTYA 1QATA 5DICA 4PHMA 1QVIY 2PRUA 4QJ4B 1IH0A 2JULA 1Y1CA 3SS3A 2H61A 2B0UC 2YGUA 1H0ZA 2QQ0A 1B1GA 2KOTA 2LVKA 2OVOA 1PPFI 2KQ6A 1CLMA 4M2OA 1ORGA 1K9PA 2EHBA 2KLEA 1SK6D 1Y1XA 2F2PA 1FY7A 1QLSA 2KSPA 4DIRA 1F71A 2KAYA 4WQ2A 3DF0A 1QX5B 3SGBI 3SG7A 2BBNA 5KU1A 3EKJA 2V53A 1JWDA 5I94A 1U5IA 2ENNA 3PM2A 3QRXA 4AMLA 2NZ0A 1F54A 2PVBA 3RLZA 5ER4X 1BJFA 3OB1B 3BUWB 2M9GA 1DS2I 1OE9B 1TBNA 1PVBA 1OOHA 2L2CA 2GIVA 3B4VC 3TS5B 4GGFA 2KLDA 1R0RI 2KAXA 5HKYA 3PN7C 2WCJA 5HYDA 1SPYA 1A2XA 4I5NB 5E3RA 3PN7B 1TBQR 1EXRA 2V1CC 2WCKA 2DOQA 2L5XB 4HRHA 2UZ3A 2ZN8A 5GQQC 1UP5A 1TCOB 2K0JA 4GNKB 1WLMA 1QTXA 1LXFC 2WCHA 2Q91A 1DTLA 1M31A 1KK8C 3S0FA 1TURA 2FCEA 2E73A 1KK8B 1LR7A 3CLNA 4TNCA 1VDDA 1CGII 2MJWB 3VRQA 4JCVE 2SGPI 2M29A 2KBMA 3SJSA 4HSZA 3SS4A 1NX0A 3S0DA 2WC5A 1YVHA 3S0BA 3CXLA 2ZN9A 1QS7A 1M63B 1K7TA 2LVJA 3SEKC 2JT0A 1YURA 1OQPA 2L8EA 1PK0D 3VROA 5K89A 4F7FA 3VRPA 1KQMC 1KQMB 5BPJA 2M1KB 1DJWA 3I5IC 5AERA 2AUCA 1MJ9A 3PJIA 1SGQI 1ULNA 3I5IB 1FW4A 3TOAA 1NCZA 1WGCA 1PTQA 2A4JA 2ENZA 1SKTA 1K7VA 5HI7A 2QEVA 1EL4A 2L4IA 2LB7A 1G8IA 3BJHA 1UHHA 4YRUA 1WKXA 3C1VA 1UURA 4IL1A 1XX6A 1PSBA 3E2IA 4B6DA 3OXLA 3OHMB 1K7UA 2LHIA 1OSAA 4E1RA 1SGNI 2LP3A 1DGUA 4AQJA 2L7XA 1NUBA 1OOJA 3K1EA 3OX6A 1UHKA 3PFVA 1CKKA 2SGDI 3RZSA 1CNPA 4NDDA 1Y0VH 4GFTA 5HL1A 3UEYA 2RGIA 2ARPF 4DUQA 2SGQI 1B8CA 1LVCD 5FUVA 2FJUB 5AXIA 2W0TA 2M7NA 5E3PA 1W3SA 3CWGA 1SW8A 4ICBA 1XFYO 4C0KA 4OCIA 2E5RA 4OV2A 4GBAA 1J55A 5F6TA 2F33A 1DGVA 4FQTA 3BJIA 1TBOA 2JXLA 1RWYA 3DVMA 3Q8IA 1HQVA 2Y5IA 1XVJA 1C3ZA 1FI6A 2E6WA 3OL0A 3DD4A 2NU3I 1IJ6A 4PCWA 3OBVA 2KYCA 3NHIA 1UWOA 3V2LA 1HJAI 2LUXA 1OOIX 1TN4A 4PHNA 2BNXA 2J87A 2BBMA 4JWQA 1P9GA 2VRWB 4ORAB 5D7FA 4CFQA 5I2OA 3CABA 1K90D 3RM1A 2MBXA 3BUOB 2FOTA 4I5KA 1SL8A 3NSLA 1DJGA 2G2BA 2GKTI 4NDCA 3S0AA 1FPWA 2ZRSA 3O4XA 2LVVA 3CDNA 5I2QA 1JFKA 2AAOA 1X4SA 1W9ZA 1CDMA 3EK7A 2BE6A 2LMTA 3K21A 1LR9A 1ZACA 2KQYA 5TNCA 3R1PA 5I8NA 1P28A 1KFUL 4A4CA 2PMYA 2NLNA 3ICBA 3S0EA 1A75B 2V1CA 3D78A 2TN4A 3VGOA 1S6IA 2JQ6A 1KSMA 1Z2CB 3VE5A 2HQ8A 1XBTA 5CCMA 5KSZA 1SGYI 1RROA 2D8NA 1J7RA
chains in the Genus database with same CATH topology
1QLSA 4MZKA 2KSPA 1B8LA 4DIRA 1F71A 1CFDA 5CSFA 2KBIA 1J7OA 2I94A 3O4YA 1ZOTB 2KAYA 1YVLA 2F8PA 2WCFA 4M2QA 3DF0A 2Y1MA 4WQ2A 4YBHB 3NXAA 4MRXA 1QX5B 5AANA 3NSKA 1K94A 1K95A 3EK4A 1AP4A 3SGBI 1QV0A 3JTDC 4XJKB 1TIZA 2BBNA 3SG7A 1S3PA 5KU1A 1PJUA 3SG4A 2M3WA 1BR1B 2P6BB 3JTDB 2MLEC 3EKJA 1R79A 2I7AA 4OVOA 2V53A 1C7WA 1JWDA 1V1FA 1ODBA 1C7VA 2JZIA 1R6PA 1LA0A 1U5IA 2ENNA 3QRXA 3HH2C 4D1EA 2K7BA 1DVIA 5DKNA 1CB1A 1DS3I 2KNEA 1NCXA 1CDNA 1SL7A 2A20A 2NZ0A 2SCPA 4YGCB 1FBVA 4F0ZB 1J1DA 1Y1BA 1MXEA 1F54A 2JRFA 4OVNF 2BCBA 2PVBA 3BUXB 3UGIA 3UFFA 1G4YR 1K96A 1KK7Z 2M49B 1DJIA 1YX7A 3HX4A 2JW6A 1V1GA 3RLZA 5ER4X 3TDUA 4YGDB 1BJFA 1G33A 3KF9A 1IRJA 2Q4UA 1SYMA 1MHOA 4A4BA 1OMTA 1TRFA 3OB1B 3D0YA 4PE4A 3BUWB 1BLQA 4AQIA 2GV5A 3H4SE 2M9GA 1TCFA 1DS2I 5ER5A 4M2PA 2CBLA 3NSIA 1QX2A 1PCEA 2OTGB 1OE9B 1TBNA 4ORCB 4PE1A 2L51A 1PVBA 3WHUB 1B47A 1KFXL 5CSJA 2BUSA 2ROWA 1S1EA 1IW4A 2JA1A 2G9BA 1S26D 3B4VC 4HRGA 3TS5B 4GGFA 2MRDA 1R0RI 1QIVA 2KAXA 5HKYA 2JZMA 1NPQA 2K61A 3GOXA 3PN7C 5HYDA 4SGBI 1SPYA 2HPSA 1A2XA 1PRWA 4I5NB 1JF2A 3PN7B 5HLOA 1TBQR 1EXRA 1IG5A 1K8UA 1J1EA 1AJ4A 2V1CC 1BG1A 1M45A 2DOQA 1MUXA 1AHRA 2L5XB 2LC5A 4HRHA 1CLBA 2UZ3A 1CHOI 5B8IB 2ZN8A 2AMIA 5GQQC 1SR6C 1TCOB 1UP5A 3BQ3A 1PSRA 2K0JA 1XK4A 3LK0A 4GNKB 5G08A 5PALA 2LP2A 1NIWA 4DRWA 1S6JA 1WLMA 1QTXA 3MSEB 4BY5A 1LXFC 2LMVA 4I5JA 3OXGA 1PALA 4USLA 2LM5A 2WNDA 2ELIA 1QV1A 2Q91A 4YGBB 1DTLA 1M31A 1S5GY 3KO0A 1MT1A 1TBRR 1KK8C 1TURA 2FCEA 2H61C 4MBEA 2E73A 3CR4X 3CR2A 1DJYA 1K9KA 1KK8B 4GAOA 2HF5A 1LR7A 1HT9A 2LAPA 3CLNA 2L0PA 2K8MB 1DJHA 4TNCA 1V1HA 3KPXA 1CGII 2MJWB 3VRQA 4ZCUA 1CGJI 1BODA 1VDDA 1CSOI 2QQCA 1LINA 4JCVE 2SGPI 1TNWA 2WOSA 1XFXO 2MHHA 1X02A 1DMOA 2M29A 2WCEA 2KBMA 1MXLC 1B8RA 2PSRA 3HCMA 5JJGA 2P6AC 3SJSA 2F3YA 4HSZA 1MWNA 1ALWA 1FAQA 2VRGA 3PALA 1Q80A 1YR5A 3AAKA 3IQQA 1NX0A 4ETOA 3FIAA 1M39A 1IQ5A 1SL9A 1EG4A 1KBFA 1DF0A 2JTTA 3AKAA 1FI5A 1OYVI 4ZCVA 1M8BA 2OD1A 3KY9A 1S5GZ 4OR9B 1IJ5A 3ZWHA 1S6CA 2WORA 1CFPA 2FNFX 2JPTA 1MR8A 1QASA 3BUMB 4C0JA 4P5OE 2YUUA 4JPZB 1YVHA 2KAVA 3DF0B 5HLVA 3D00A 3CXLA 2ZRTA 2ZN9A 4CPVA 1QS7A 3WHTB 3OX5A 4OKHA 1KFUS 1M63B 5I2LA 1KCYA 3O6BA 1N65A 2LVJA 2M8UA 4Q04A 1Z7KB 2DIPA 3SEKC 2SGEI 1XFUO 1XFWO 2JT0A 1U5IB 1YURA 4FQOA 4GGNA 1DT7B 1H8BA 1OQPA 4CLNA 4E1PA 5JHWC 2KI4C 2L8EA 3CGAA 2NCOA 1PK0D 1KWOC 1JUOA 3GK2A 3VROA 3EVRA 5K89A 1IGVA 2KI4B 4UPGA 2JNXA 3VRPA 1KWOB 1RFHA 2COLB 1TNXA 1KQMC 2WC8A 2O5GA 2Y4QA 1CMGA 3CR5X 1SMGA 3M0WA 1EH2A 4CIDA 1N13A 1GQMA 1KQMB 1RJVA 5BPJA 4MVFA 2J9RA 1NSHA 2M1KB 1DJWA 3D0YB 1SCMC 1TNQA 1W7JB 3I5IC 1WRKA 5AERA 2AUCA 1SCMB 1F4OA 1SGQI 3I5IB 2JXDA 1TOPA 1FW4A 2ZNEA 4WRIA 2Y1NA 2M1UA 2O60A 1NCZA 5CSNA 4YGAA 2KMRA 1WRZA 2M0RA 5HKZA 1M46A 4GGFC 1PTQA 5FUXA 2A4JA 5FUYA 2ENZA 2QPTA 2KFFA 4C0LA 2F3CI 1SKTA 5HI7A 1EL4A 1FYBA 2L4IA 1Y8FA 1FARA 1JF0A 3E3RA 2K7DA 2B8TA 1KSOA 4L9MA 1G8IA 1QIWA 4I5LB 1RTP1 1XK4C 1UHHA 4YRUA 1CM1A 4QJ5B 1N0YA 3KHEA 2JT8A 4MEWA 2BCAA 2WCBA 4PHJA 1JFJA 1F70A 1J7PA 1AJ5A 3C1VA 1UURA 3LCPC 3PM8A 1DJXA 2R2IA 4IL1A 3VDPA 1XX6A 1YX8A 3OP0A 5AFPA 1PSBA 2GGZA 3E2IA 3UGDA 1UVGA 3TDIA 1W7IB 3EKHA 1IQ3A 5HQ8A 4MRYA 4B6DA 3OXLA 1YTZC 2LANA 3AAJA 4GI3C 1B7TY 3BXKA 1KMAA 2QQEA 4PHKA 2K2AA 3OHMB 3CZTX 2SGFI 1CE3A 2LLSA 1B9AA 3A8RA 2LHIA 3QTLD 2BL0C 2FCDA 1OSAA 2KMQA 4E1RA 1LKJA 1VRKA 2KYFA 2LMUA 2LP3A 1DGUA 1SGNI 4AQJA 1HDLA 1SR6B 2BL0B 2L7XA 1NUBA 2KHNA 1NP8A 1OOJA 4HREE 5J3XA 1BUSA 2KMOA 3TZ1A 3SG6A 2L2EA 1ZFSA 2SASA 1YUSA 3OX6A 5CPVA 1UHKA 1MF8B 1XA6A 1TTXA 3I5GC 2LLTA 3PFVA 1CKKA 2SGDI 3VRNA 3I5GB 1OVOA 3LK1A 1CMFA 1CTRA 1XYDA 1J7QA 1KQVA 1TGSI 2QQDA 1CNPA 4NDDA 1DF0B 3F45A 2JWWA 2ZKMX 1KFXS 1X74A 1Y0VH 1YUTA 3JVTC 4GFTA 4P2YB 2BKHB 4YGEB 5D69A 2NU0I 3FC3A 1SGEI 3JVTB 1F8HA 2ISDA 1UVFA 1B7TZ 3AKBA 2DB6A 1Y1UA 1OMRA 3SG5A 3UEYA 2RGIA 5AEQA 1OMVA 4U8DA 3GOFA 4N1FA 5EX0A 2BE4A 2ARPF 1UHNA 1PVAA 4DUQA 1D1OA 2LUYA 1ZMZA 2SGQI 1JC2A 1B8CA 1LVCD 4GUKA 5HKWA 5FUVA 1XA5A 1SGDI 4PE0A 5FUWA 2FJUB 5AXIA 3BOWA 4UXJA 2W0TA 1GGWA 2M7NA 3O78A 2KGBC 1YUUA 1K2HA 1W3SA 3CWGA 1SW8A 1NX2A 2MA2A 4ICBA 1XFYO 4YI9A 4OCIA 4C0KA 1WDCC 5IBWA 2E5RA 4QJ3B 4OV2A 1RFJA 1J55A 4GBAA 3OXFA 5F6TA 1WDCB 2F33A 1DGVA 2QACA 1A03A 2JYYA 1K9UA 2NXQA 3VRRA 2OS8C 3BJIA 1OZSA 1TBOA 1NYAA 2L98A 1A75A 4GPLB 2OS8B 4MSPA 2BKIB 2JXLA 1RWYA 1Y1AA 3DVMA 4NDBA 2LCPA 2ORVA 1V1IA 3E59A 3RU0A 1S36A 1HQVA 2Y5IA 1IKUA 1XVJA 3BUNB 4YI8A 3UGLA 1TIHA 1WY9A 2K7CA 2F3ZA 1FI6A 2E6WA 2L50A 1B4CA 1U5KA 3WXAA 4AOMA 1CLLA 2K7OA 3A4UB 3SIAA 3OL0A 1SY9A 3EVUA 1UUCA 2N17A 1UHJA 3DD4A 3PATA 2NU3I 1CDPA 2GVIA 1DJZA 2BCXA 1IJ6A 4PCWA 1QJTA 2EC6C 2CJSC 3MEKA 2CCMA 2CXJA 4XYNA 3DVJA 2KYCA 2EC6B 2LNKA 2CTNA 2F2OA 2N71A 2KI6C 1AK8A 1OMUA 2ZNDA 1NX1A 2CT9A 2LLUA 1XO5A 2LV7A 1UWOA 2PALA 2WCYA 2ERWA 2JXCA 2KDHA 2PASA 3ZNIA 2M5XA 2CNPA 2LUXA 1LA3A 3WNXB 1HJAI 2WVJA 1TN4A 2LVIA 4PE7A 4PHNA 3TUYC 2J87A 1YTPA 4MLWA 1AVSA 3IQOA 2BBMA 1RECA 2JTZA 3CTNA 1FF1A 3TUYB 4E68A 1BR4B 1SGRI 1SBJA 1E8AA 2L4HA 4JWQA 4CFRA 1KBEA 4DS7A 4ORAB 2VRWB 5D7FA 2NU1I 4CFQA 1PTRA 1EG3A 3TDZA 1UHIA 5I2OA 3I5FC 2LUCA 2K9HA 3FS7A 1LR8A 2NU2I 3I5FB 1CT0I 4N5XA 1F4QA 1K90D 4XJKA 3RM1A 2MBXA 1K93D 1L7ZA 3BUOB 1QX7A 3GK1A 2FOTA 1UUSA 2I2RE 2JT3A 1IY5A 3UEJA 1XFZO 2K2FA 5CSIA 1JSAA 1W4RA 2YQPA 3PLFB 2NCPA 4I5KA 4BY4A 2GKVA 3DVKA 2HETA 1SL8A 1BMOA 3NSLA 1BOCA 3PSRA 1H4BA 1CT4I 3SG2A 1QLKA 1WLZA 2I18A 3KEVA 3SIBA 1DJGA 2G2BA 5DAEA 1A4PA 4UXHA 2GKTI 2OTGC 1TOTA 3TJQA 1GJYA 3LL8B 4NDCA 1NWDA 1FPWA 2ZRSA 4UXIA 2KCXA 1IWQA 4FKDA 4MZLA 2ORWA 3QWPA 3CS1A 2MAZA 3D10A 4JQ0D 3TS5C 3PDNA 4PDZA 4NQGA 1RK9A 1NX3A 3FWBA 2GGMA 2LVVA 5I2QA 1JFKA 2AAOA 1AN1I 2KGRA 5JOLA 3O2PA 2N1AB 3SG3A 1X4SA 1F55A 2NU4I 1SCVA 5CCLA 1CT2I 2M7LA 1CDMA 2IS9A 2LHLA 1HPTA 3EK7A 1SRAA 2BE6A 2LMTA 2KFHA 2ODDA 3EK8A 3K21A 3IF7A 1ZACA 3GK4X 1LR9A 3LLEA 2QPOA 3BOWB 2KQYA 4MZJA 1BF5A 1SNLA 1QXPA 3BYAA 3FWCA 2H2KA 5TNCA 3OVOA 1C07A 1GGZA 2HQWA 1CM4A 1OZOA 1KFUL 4PALA 2KFGA 4A4CA 5I8NA 2B1UA 2PMYA 1SGPI 2NLNA 3ICBA 1CFCA 1MQ1A 2OPOA 2LEOA 4DCKA 1CFFA 5KTYA 1QATA 1BU3A 2MLFC 1BT6A 1A75B 1TNPA 1EJ3A 4PHMA 1OMDA 1QVIY 2V1CA 3DVEA 2TN4A 3VDUA 2ZFDA 2GKRI 1PULA 2PRUA 4QJ4B 3VGOA 1IH0A 5DKRA 5FYXA 5EX3A 1S6IA 1ALVA 2JULA 1Y1CA 1R2UA 2JQ6A 1KSMA 4WQ3A 1Y6WA 1IY6A 4HGUA 2EGDA 2JU0A 2JC2A 3I5HC 5DKQA 2H61A 2B0UC 3VE5A 1H0ZA 2XRCA 1A29A 1N2DA 3I5HB 2QQ0A 1AUIB 2HQ8A 4ORBB 1B1GA 2KOTA 2LVKA 4N1GA 1XBTA 1ZUZA 2BECA 2OVOA 2KMPA 2N52A 1CDLA 2LE9B 1PPFI 2KQ6A 1YRTB 4MN0A 1CLMA 2KI6D 5CCMA 4M2OA 5KSZA 1JBAA 3OB2B 3SGQI 1K9PA 2EHBA 3NSOA 4R1EA 2M97A 1QVIZ 3EVVA 1L2OC 4FTGA 1YU6C 2JOJA 4A24A 1SGYI 2E30A 1YRUB 2JNFA 1L2OB 1NCYA 1XFVO 1RROA 1SK6D 1TUSA 1WRLA 1M8CA 2D8NA 1Y1XA 2F2PA 1J7RA 1KK7Y
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLS A;  4MZK A;  2KSP A;  1B8L A;  4DIR A;  1F71 A;  1CFD A;  5CSF A;  2KBI A;  1J7O A;  2I94 A;  3O4Y A;  1ZOT B;  2KAY A;  1YVL A;  2F8P A;  2WCF A;  4M2Q A;  3DF0 A;  2Y1M A;  4WQ2 A;  4YBH B;  3NXA A;  4MRX A;  1QX5 B;  5AAN A;  3NSK A;  1K94 A;  1K95 A;  3EK4 A;  1AP4 A;  3SGB I;  1QV0 A;  3JTD C;  4XJK B;  1TIZ A;  2BBN A;  3SG7 A;  1S3P A;  5KU1 A;  1PJU A;  3SG4 A;  2M3W A;  1BR1 B;  2P6B B;  3JTD B;  2MLE C;  3EKJ A;  4OVO A;  2I7A A;  2V53 A;  1C7W A;  1JWD A;  1V1F A;  1ODB A;  1C7V A;  2JZI A;  1R6P A;  1LA0 A;  1U5I A;  3QRX A;  3HH2 C;  4D1E A;  2K7B A;  1DVI A;  5DKN A;  1CB1 A;  1DS3 I;  2KNE A;  1NCX A;  1CDN A;  1SL7 A;  2NZ0 A;  2SCP A;  4YGC B;  1FBV A;  4F0Z B;  1J1D A;  1Y1B A;  1MXE A;  1F54 A;  2JRF A;  4OVN F;  2BCB A;  2PVB A;  3BUX B;  1G4Y R;  1K96 A;  1KK7 Z;  2M49 B;  1DJI A;  1YX7 A;  3HX4 A;  1V1G A;  3RLZ A;  5ER4 X;  3TDU A;  4YGD B;  1BJF A;  1G33 A;  3KF9 A;  1IRJ A;  2Q4U A;  1SYM A;  1MHO A;  4A4B A;  1OMT A;  1TRF A;  3OB1 B;  3D0Y A;  4PE4 A;  3BUW B;  1BLQ A;  4AQI A;  2GV5 A;  3H4S E;  2M9G A;  1TCF A;  1DS2 I;  5ER5 A;  4M2P A;  2CBL A;  3NSI A;  1QX2 A;  1PCE A;  2OTG B;  1OE9 B;  4ORC B;  4PE1 A;  2L51 A;  1PVB A;  3WHU B;  1B47 A;  1KFX L;  5CSJ A;  2BUS A;  1S1E A;  1IW4 A;  2G9B A;  1S26 D;  3B4V C;  4HRG A;  3TS5 B;  4GGF A;  2MRD A;  1R0R I;  1QIV A;  2KAX A;  5HKY A;  2JZM A;  1NPQ A;  2K61 A;  3PN7 C;  5HYD A;  1SPY A;  2HPS A;  1A2X A;  1PRW A;  4I5N B;  1JF2 A;  3PN7 B;  5HLO A;  1TBQ R;  1EXR A;  1IG5 A;  1K8U A;  1J1E A;  1AJ4 A;  1BG1 A;  1M45 A;  2DOQ A;  1MUX A;  1AHR A;  2L5X B;  2LC5 A;  4HRH A;  1CLB A;  1CHO I;  5B8I B;  2ZN8 A;  2AMI A;  5GQQ C;  1SR6 C;  1TCO B;  1UP5 A;  3BQ3 A;  1PSR A;  2K0J A;  1XK4 A;  3LK0 A;  4GNK B;  5G08 A;  5PAL A;  2LP2 A;  1NIW A;  4DRW A;  1S6J A;  1WLM A;  1QTX A;  3MSE B;  4BY5 A;  1LXF C;  2LMV A;  4I5J A;  1PAL A;  4USL A;  2LM5 A;  2WND A;  1QV1 A;  2Q91 A;  4YGB B;  1DTL A;  1M31 A;  1S5G Y;  3KO0 A;  1MT1 A;  1TBR R;  1KK8 C;  1TUR A;  2FCE A;  2H61 C;  4MBE A;  3CR4 X;  3CR2 A;  1DJY A;  1K9K A;  1KK8 B;  4GAO A;  2HF5 A;  1LR7 A;  1HT9 A;  2LAP A;  3CLN A;  2L0P A;  2K8M B;  1DJH A;  4TNC A;  4SGB I;  3KPX A;  1CGI I;  2MJW B;  3VRQ A;  4ZCU A;  1CGJ I;  1BOD A;  1CSO I;  2QQC A;  1LIN A;  2SGP I;  1TNW A;  2WOS A;  1XFX O;  2MHH A;  1X02 A;  1DMO A;  2M29 A;  2WCE A;  2KBM A;  1MXL C;  1B8R A;  2PSR A;  3HCM A;  5JJG A;  2P6A C;  3SJS A;  2F3Y A;  4HSZ A;  1MWN A;  1ALW A;  2VRG A;  3PAL A;  1Q80 A;  1YR5 A;  3AAK A;  3IQQ A;  1NX0 A;  4ETO A;  3FIA A;  1M39 A;  1IQ5 A;  1SL9 A;  1EG4 A;  1DF0 A;  2JTT A;  3AKA A;  1FI5 A;  1OYV I;  4ZCV A;  1M8B A;  1S5G Z;  4OR9 B;  1IJ5 A;  3ZWH A;  1S6C A;  2WOR A;  1CFP A;  2JPT A;  1MR8 A;  1QAS A;  3BUM B;  4C0J A;  4P5O E;  4JPZ B;  1YVH A;  2KAV A;  3DF0 B;  5HLV A;  2ZRT A;  2ZN9 A;  4CPV A;  1QS7 A;  3WHT B;  3OX5 A;  4OKH A;  1KFU S;  1M63 B;  5I2L A;  1KCY A;  3O6B A;  1N65 A;  2LVJ A;  2M8U A;  4Q04 A;  1Z7K B;  3SEK C;  2SGE I;  1XFU O;  1XFW O;  2JT0 A;  1U5I B;  1YUR A;  4FQO A;  4GGN A;  1DT7 B;  1H8B A;  1OQP A;  4CLN A;  5JHW C;  2KI4 C;  3CGA A;  2NCO A;  1PK0 D;  1KWO C;  1JUO A;  3GK2 A;  3VRO A;  3EVR A;  5K89 A;  1IGV A;  2KI4 B;  4UPG A;  2JNX A;  3VRP A;  1KWO B;  2COL B;  1TNX A;  1KQM C;  2WC8 A;  2O5G A;  2Y4Q A;  1CMG A;  3CR5 X;  1SMG A;  3M0W A;  1EH2 A;  4CID A;  1N13 A;  1GQM A;  1KQM B;  1RJV A;  5BPJ A;  4MVF A;  1NSH A;  2M1K B;  1DJW A;  3D0Y B;  1SCM C;  1TNQ A;  1W7J B;  3I5I C;  1WRK A;  5AER A;  2AUC A;  1SCM B;  1F4O A;  1SGQ I;  3I5I B;  2JXD A;  1TOP A;  1FW4 A;  2ZNE A;  4WRI A;  2Y1N A;  2M1U A;  2O60 A;  1NCZ A;  5CSN A;  4YGA A;  2KMR A;  1WRZ A;  2M0R A;  5HKZ A;  1M46 A;  4GGF C;  2A4J A;  2QPT A;  2KFF A;  4C0L A;  2F3C I;  1SKT A;  1EL4 A;  1FYB A;  2L4I A;  1JF0 A;  3E3R A;  2K7D A;  1KSO A;  4L9M A;  1G8I A;  1QIW A;  4I5L B;  1RTP 1;  1XK4 C;  1UHH A;  4YRU A;  1CM1 A;  4QJ5 B;  1N0Y A;  3KHE A;  2JT8 A;  4MEW A;  2BCA A;  2WCB A;  4PHJ A;  1JFJ A;  1F70 A;  1J7P A;  1AJ5 A;  3C1V A;  1UUR A;  3LCP C;  3PM8 A;  1DJX A;  2R2I A;  4IL1 A;  1YX8 A;  3OP0 A;  5AFP A;  1PSB A;  2GGZ A;  1UVG A;  3TDI A;  1W7I B;  3EKH A;  1IQ3 A;  4MRY A;  1YTZ C;  2LAN A;  3AAJ A;  4GI3 C;  1B7T Y;  3BXK A;  1KMA A;  4PHK A;  2K2A A;  3OHM B;  3CZT X;  2SGF I;  1CE3 A;  2LLS A;  1B9A A;  3A8R A;  2LHI A;  3QTL D;  2BL0 C;  2FCD A;  1OSA A;  2KMQ A;  1LKJ A;  1VRK A;  2KYF A;  2LMU A;  2LP3 A;  1DGU A;  1SGN I;  4AQJ A;  1HDL A;  1SR6 B;  2BL0 B;  1NUB A;  2KHN A;  1NP8 A;  1OOJ A;  4HRE E;  5J3X A;  1BUS A;  2KMO A;  3TZ1 A;  3SG6 A;  2L2E A;  1ZFS A;  2SAS A;  1YUS A;  3OX6 A;  5CPV A;  1UHK A;  1MF8 B;  1TTX A;  3I5G C;  2LLT A;  3PFV A;  1CKK A;  2SGD I;  3VRN A;  3I5G B;  1OVO A;  3LK1 A;  1CMF A;  1CTR A;  1XYD A;  1J7Q A;  1KQV A;  1TGS I;  2QQD A;  1CNP A;  4NDD A;  1DF0 B;  3F45 A;  2JWW A;  2ZKM X;  1KFX S;  1Y0V H;  1YUT A;  3JVT C;  4GFT A;  4P2Y B;  2BKH B;  4YGE B;  5D69 A;  2NU0 I;  1SGE I;  3JVT B;  1F8H A;  2ISD A;  1UVF A;  1B7T Z;  3AKB A;  1Y1U A;  1OMR A;  3SG5 A;  2RGI A;  5AEQ A;  1OMV A;  4U8D A;  3GOF A;  4N1F A;  2BE4 A;  2ARP F;  1UHN A;  1PVA A;  4DUQ A;  1D1O A;  2SGQ I;  1ZMZ A;  1JC2 A;  1B8C A;  1LVC D;  4GUK A;  5HKW A;  1XA5 A;  1SGD I;  4PE0 A;  2FJU B;  5AXI A;  3BOW A;  1GGW A;  2M7N A;  3O78 A;  2KGB C;  1YUU A;  1K2H A;  3CWG A;  1SW8 A;  1NX2 A;  2MA2 A;  4ICB A;  1XFY O;  4YI9 A;  4OCI A;  4C0K A;  1WDC C;  5IBW A;  4QJ3 B;  4OV2 A;  1RFJ A;  1J55 A;  4GBA A;  5F6T A;  1WDC B;  2F33 A;  1DGV A;  2QAC A;  1A03 A;  2JYY A;  1K9U A;  2NXQ A;  3VRR A;  2OS8 C;  1OZS A;  1NYA A;  2L98 A;  1A75 A;  4GPL B;  2OS8 B;  4MSP A;  2BKI B;  2JXL A;  1RWY A;  1Y1A A;  3DVM A;  4NDB A;  2LCP A;  1S36 A;  1HQV A;  2Y5I A;  1IKU A;  1XVJ A;  3BUN B;  4YI8 A;  1TIH A;  1WY9 A;  2K7C A;  2F3Z A;  1FI6 A;  2E6W A;  2L50 A;  1B4C A;  3WXA A;  4AOM A;  1CLL A;  2K7O A;  3A4U B;  3SIA A;  1SY9 A;  3EVU A;  1UUC A;  2N17 A;  1UHJ A;  3DD4 A;  3PAT A;  2NU3 I;  1CDP A;  1DJZ A;  2BCX A;  1IJ6 A;  4PCW A;  1QJT A;  2EC6 C;  2CCM A;  2CXJ A;  4XYN A;  3DVJ A;  2KYC A;  2EC6 B;  2LNK A;  2CTN A;  2F2O A;  2N71 A;  2KI6 C;  1AK8 A;  1OMU A;  2ZND A;  1NX1 A;  2CT9 A;  2LLU A;  1XO5 A;  2LV7 A;  1UWO A;  2PAL A;  2WCY A;  2ERW A;  2JXC A;  2KDH A;  2PAS A;  3ZNI A;  2M5X A;  2CNP A;  2LUX A;  1LA3 A;  3WNX B;  1HJA I;  1TN4 A;  2LVI A;  4PE7 A;  4PHN A;  3TUY C;  1YTP A;  4MLW A;  1AVS A;  3IQO A;  2BBM A;  1REC A;  2JTZ A;  3CTN A;  1FF1 A;  3TUY B;  4E68 A;  1BR4 B;  1SGR I;  1SBJ A;  1E8A A;  2L4H A;  4JWQ A;  4CFR A;  4DS7 A;  4ORA B;  5D7F A;  2NU1 I;  4CFQ A;  1EG3 A;  3TDZ A;  1UHI A;  5I2O A;  3I5F C;  2LUC A;  3FS7 A;  1LR8 A;  2NU2 I;  3I5F B;  1CT0 I;  4N5X A;  1F4Q A;  1K90 D;  4XJK A;  3RM1 A;  2MBX A;  1K93 D;  1L7Z A;  3BUO B;  1QX7 A;  3GK1 A;  2FOT A;  1UUS A;  2I2R E;  2JT3 A;  1IY5 A;  1XFZ O;  2K2F A;  5CSI A;  1JSA A;  3PLF B;  2NCP A;  4I5K A;  4BY4 A;  2GKV A;  3DVK A;  2HET A;  1SL8 A;  1BMO A;  3NSL A;  1BOC A;  3PSR A;  1H4B A;  1CT4 I;  3SG2 A;  1QLK A;  1WLZ A;  2I18 A;  3KEV A;  3SIB A;  1DJG A;  2G2B A;  5DAE A;  1A4P A;  2GKT I;  2OTG C;  3TJQ A;  1GJY A;  3LL8 B;  4NDC A;  1NWD A;  1FPW A;  2ZRS A;  2KCX A;  1IWQ A;  4MZL A;  3CS1 A;  2MAZ A;  3D10 A;  4JQ0 D;  3TS5 C;  4PDZ A;  4NQG A;  1RK9 A;  1NX3 A;  3FWB A;  2GGM A;  2LVV A;  5I2Q A;  1JFK A;  2AAO A;  1AN1 I;  2KGR A;  5JOL A;  3O2P A;  3SG3 A;  1F55 A;  2NU4 I;  1SCV A;  1CT2 I;  2M7L A;  1CDM A;  2IS9 A;  2LHL A;  1HPT A;  3EK7 A;  1SRA A;  2BE6 A;  2LMT A;  2KFH A;  3EK8 A;  3K21 A;  3IF7 A;  1ZAC A;  3GK4 X;  1LR9 A;  3LLE A;  3BOW B;  2KQY A;  4MZJ A;  1BF5 A;  1SNL A;  1QXP A;  3BYA A;  3FWC A;  2H2K A;  5TNC A;  3OVO A;  1C07 A;  1GGZ A;  2HQW A;  1CM4 A;  1OZO A;  1KFU L;  4PAL A;  2KFG A;  4A4C A;  5I8N A;  2B1U A;  2PMY A;  1SGP I;  2NLN A;  3ICB A;  1CFC A;  1MQ1 A;  2OPO A;  2LEO A;  4DCK A;  1CFF A;  5KTY A;  1QAT A;  1BU3 A;  2MLF C;  1BT6 A;  1A75 B;  1TNP A;  1EJ3 A;  4PHM A;  1OMD A;  1QVI Y;  3DVE A;  2TN4 A;  2ZFD A;  2GKR I;  1PUL A;  2PRU A;  4QJ4 B;  3VGO A;  1IH0 A;  5DKR A;  5FYX A;  1S6I A;  1ALV A;  2JUL A;  1Y1C A;  1R2U A;  2JQ6 A;  1KSM A;  4WQ3 A;  1Y6W A;  1IY6 A;  4HGU A;  2EGD A;  2JU0 A;  2JC2 A;  3I5H C;  5DKQ A;  2H61 A;  2B0U C;  1H0Z A;  2XRC A;  1A29 A;  1N2D A;  3I5H B;  1AUI B;  2HQ8 A;  4ORB B;  1B1G A;  2KOT A;  2LVK A;  4N1G A;  1ZUZ A;  2BEC A;  2OVO A;  2KMP A;  2N52 A;  1CDL A;  2LE9 B;  1PPF I;  2KQ6 A;  1YRT B;  4MN0 A;  1CLM A;  2KI6 D;  4M2O A;  5KSZ A;  1JBA A;  3OB2 B;  3SGQ I;  1K9P A;  2EHB A;  3NSO A;  4R1E A;  2M97 A;  1QVI Z;  3EVV A;  1L2O C;  4FTG A;  1YU6 C;  2JOJ A;  1SGY I;  2E30 A;  1YRU B;  2JNF A;  1L2O B;  1NCY A;  1XFV O;  1RRO A;  1SK6 D;  1TUS A;  1WRL A;  1M8C A;  2D8N A;  1Y1X A;  2F2P A;  1J7R A;  1KK7 Y; 
#chains in the Genus database with same CATH topology
 4MZK A;  1CFD A;  2KBI A;  2I94 A;  1ZOT B;  2WCF A;  3NXA A;  2JPO A;  3NSK A;  1K94 A;  1QV0 A;  1PJU A;  3SG4 A;  2M3W A;  1BR1 B;  2P6B B;  2MLE C;  1Z2I A;  2I7A A;  2JZI A;  1LA0 A;  4MPI A;  5DKN A;  1CDN A;  1SL7 A;  2A20 A;  2SCP A;  1Y1B A;  1FBV A;  1J1D A;  1MXE A;  4OVN F;  2BCB A;  3UGI A;  1YX7 A;  1V1G A;  3TDU A;  3KF9 A;  1IRJ A;  2Y0M A;  4A4B A;  1TRF A;  4PE4 A;  1BLQ A;  4AQI A;  3NSI A;  1PCE A;  4PE1 A;  2L51 A;  3WHU B;  1B47 A;  5CSJ A;  2BUS A;  2JA1 A;  2G9B A;  1S26 D;  2MRD A;  2K61 A;  4OZD A;  2HPS A;  1JF2 A;  1K8U A;  3BFH A;  1M45 A;  2LC5 A;  1CHO I;  2AMI A;  1PSR A;  5G08 A;  4DRW A;  1NIW A;  3OXG A;  4I5J A;  2ELI A;  2LM5 A;  3CR4 X;  1DJY A;  1K9K A;  4GAO A;  2HF5 A;  2K8M B;  1DJH A;  1V1H A;  3KPX A;  1BOD A;  1CSO I;  1LIN A;  3HCM A;  2P6A C;  3FIA A;  1SL9 A;  1NXU A;  3D75 A;  2JTT A;  3AKA A;  2OD1 A;  4ZCV A;  1M8B A;  3KY9 A;  4OR9 B;  2WOR A;  2JPT A;  1MR8 A;  1QAS A;  3BUM B;  4C0J A;  3D74 A;  3D00 A;  2ZRT A;  4CPV A;  3OX5 A;  1KFU S;  1KCY A;  3O6B A;  3FSX A;  2DIP A;  1XFU O;  4FQO A;  1H8B A;  4E1P A;  5JHW C;  2KI4 C;  3CZ0 A;  1IGV A;  2KI4 B;  2JNX A;  2COL B;  1EH2 A;  3CR5 X;  1SMG A;  2H8V A;  4MVF A;  1W7J B;  3R5D A;  2PYQ A;  2Y1N A;  2ERB A;  1FYB A;  3E3R A;  4INW A;  1KSO A;  4I5L B;  1XK4 C;  2WCB A;  1F70 A;  1JFJ A;  3QAH A;  1AJ5 A;  1DJX A;  1UVG A;  3TDI A;  4MRY A;  1XFR A;  1C3Y A;  1YTZ C;  3AAJ A;  4PHK A;  1OOG A;  2SGF I;  2LLS A;  1B9A A;  2FCD A;  2LMU A;  1HDL A;  2KHN A;  4HRE E;  1NP8 A;  5J3X A;  1BUS A;  3TZ1 A;  5CPV A;  3VB1 A;  1TTX A;  3I5G C;  1S20 A;  3I5G B;  1CTR A;  1XYD A;  1J7Q A;  2QQD A;  1DF0 B;  2CWH A;  3BFB A;  3FC3 A;  2ISD A;  5FI2 A;  1OMR A;  3SG5 A;  1OMV A;  5EX0 A;  4JD9 A;  4N1F A;  2BE4 A;  1PVA A;  2LUY A;  1ZMZ A;  4GUK A;  1XA5 A;  3R5A A;  4UXJ A;  3O78 A;  1K2H A;  2MA2 A;  1RFJ A;  3B86 A;  2JYY A;  2NXQ A;  1NYA A;  2L98 A;  1A75 A;  4MSP A;  4WP4 A;  1WY9 A;  3L4L A;  2L50 A;  1B4C A;  4AOM A;  3SIA A;  2N17 A;  1CDP A;  1QWV A;  1DJZ A;  2BCX A;  2CXJ A;  2RC4 A;  3TO9 A;  3DVJ A;  2CTN A;  2OU2 A;  2N71 A;  2ZND A;  1NX1 A;  2CT9 A;  1XO5 A;  2LV7 A;  1UHA A;  2KDH A;  2PAS A;  3B6X A;  4PE7 A;  2JTZ A;  3CTN A;  5EL2 A;  2L4H A;  4CFR A;  4DS7 A;  2NU1 I;  1PTR A;  3TDZ A;  3I5F C;  2LUC A;  2QEO A;  3I5F B;  1F4Q A;  1L7Z A;  3GK1 A;  2JT3 A;  3UEJ A;  1XFZ O;  5CSI A;  2YQP A;  1MJA A;  3PLF B;  2HET A;  3SG2 A;  3KEV A;  5DAE A;  1A4P A;  2OTG C;  1TOT A;  2QEH A;  2L5Y A;  4MZL A;  3QWP A;  3CS1 A;  4JQ0 D;  3PDN A;  4NQG A;  2GGM A;  3N7H A;  1CT2 I;  1SSE B;  1Z4H A;  2ODD A;  3DZT A;  3GK4 X;  4DNC A;  1SNL A;  1QXP A;  2H2K A;  1C07 A;  1GGZ A;  2HQW A;  2B1U A;  3TO7 A;  1SGP I;  7WGA A;  3R5C A;  1DEL A;  3IVT A;  3VDU A;  1PUL A;  5EX3 A;  1ALV A;  4HGU A;  2EGD A;  2JC2 A;  1N2D A;  4IJ7 A;  1AUI B;  4ORB B;  3NHT A;  1ZUZ A;  2KMP A;  1CDL A;  2LE9 B;  1JBA A;  3NSO A;  2M97 A;  3EVV A;  1L2O C;  4FTG A;  1T14 A;  2JOJ A;  1YRU B;  2JNF A;  1L2O B;  1TUS A;  1WRL A;  1BT6 A;  1B8L A;  3O4Y A;  2CWG A;  2F8P A;  4M2Q A;  4YBH B;  3EK4 A;  1AP4 A;  4XJK B;  1TIZ A;  4OVO A;  1C7W A;  3TO6 A;  1V1F A;  1ODB A;  1C7V A;  1R6P A;  3HH2 C;  4D1E A;  1DS3 I;  2KNE A;  3BUX B;  3UFF A;  1KK7 Z;  2M49 B;  1DJI A;  4PT1 A;  2Q4U A;  2GV5 A;  3H4S E;  1TCF A;  4M2P A;  2CBL A;  4ORC B;  2WCL A;  2ROW A;  1S1E A;  1P9Z A;  1QIV A;  3DXL A;  2JZM A;  3GOX A;  5HLO A;  1J1E A;  1AJ4 A;  1MUX A;  1CLB A;  1SR6 C;  1XK4 A;  2LMV A;  4USL A;  1IIO A;  4YGB B;  3KO0 A;  1HEV A;  1TBR R;  1MT1 A;  4INX A;  2BAP A;  2LAP A;  2L0P A;  1CGJ I;  1TNW A;  1XFX O;  2MHH A;  1X02 A;  1DMO A;  2WCE A;  1GM0 A;  1B8R A;  2OZU A;  1MWN A;  1FAQ A;  2VRG A;  3PAL A;  1Q80 A;  3IQQ A;  1IQ5 A;  1EG4 A;  3R72 A;  1DF0 A;  1FI5 A;  1S5G Z;  3ZWH A;  1CFP A;  2FNF X;  4P5O E;  2KPH A;  4OKH A;  1WGT A;  4Q04 A;  1TUZ A;  1XFW O;  1ULM A;  4CLN A;  1JUO A;  3GK2 A;  4UPG A;  2X3T A;  2QDI A;  1TNX A;  2WC8 A;  1CMG A;  2O5G A;  3M0W A;  2WC6 A;  1N13 A;  1GQM A;  1RJV A;  2J9R A;  1NSH A;  3D0Y B;  2ZNE A;  3R1V A;  4WRI A;  2K60 A;  5E3Q A;  1WRZ A;  2M0R A;  5HKZ A;  1M46 A;  5FUX A;  5FUY A;  2UVO A;  2KFF A;  4C0L A;  2F3C I;  1Y8F A;  1JF0 A;  2K7D A;  2B8T A;  4L9M A;  1QIW A;  1RTP 1;  4MEW A;  1J7P A;  2R2I A;  3VDP A;  3OP0 A;  1DEK A;  5HQ8 A;  1W7I B;  3EKH A;  3FE6 A;  4GI3 C;  3CZT X;  2BL0 C;  2KMQ A;  1VRK A;  2BL0 B;  2KMO A;  3SG6 A;  1YUS A;  1WTJ A;  1MF8 B;  2LLT A;  3LK1 A;  2X52 A;  1TGS I;  2JWW A;  1X74 A;  1YUT A;  3JVT C;  2BKH B;  2NU0 I;  1SGE I;  3JVT B;  2DB6 A;  1B7T Z;  3AKB A;  1Y1U A;  5AEQ A;  3D73 A;  4U8D A;  3GOF A;  1UHN A;  1D1O A;  1JC2 A;  5HKW A;  1SGD I;  4PE0 A;  5FUW A;  5D3O A;  3BFA A;  1NX2 A;  4YI9 A;  4GPL B;  2BKI B;  1Y1A A;  4NDB A;  2LCP A;  2ORV A;  1V1I A;  1S36 A;  3BUN B;  2F3Z A;  3WXA A;  1CLL A;  3A4U B;  3QME A;  2GVI A;  1QJT A;  2CCM A;  4XYN A;  3B87 A;  2F2O A;  2KI6 C;  2WCY A;  2ERW A;  2JXC A;  3ZNI A;  3WNX B;  2LVI A;  3TUY C;  4KYN A;  1YTP A;  4MLW A;  3IQO A;  1FF1 A;  3TUY B;  4E68 A;  1E8A A;  1UHI A;  2K9H A;  3FS7 A;  1CT0 I;  4N5X A;  4XJK A;  1QX7 A;  1JSA A;  1W4R A;  1MJB A;  2NCP A;  4BY4 A;  3DVK A;  3CZ2 A;  1BOC A;  1CT4 I;  2I18 A;  4UXH A;  3TJQ A;  3LL8 B;  1NWD A;  3R1O A;  4UXI A;  2KCX A;  2DKV A;  2ORW A;  2MAZ A;  3D10 A;  3TS5 C;  3FWB A;  3UNW A;  3DY9 A;  1AN1 I;  3B88 A;  2N1A B;  3SG3 A;  1F55 A;  1SCV A;  5CCL A;  2M7L A;  2KFH A;  2FJY A;  3LLE A;  3BOW B;  1BF5 A;  3OVO A;  1CM4 A;  4PAL A;  2KFG A;  3UOE A;  1CFC A;  4DCK A;  1BU3 A;  2MLF C;  1TNP A;  1EJ3 A;  1OMD A;  3DVE A;  2ZFD A;  2GKR I;  5DKR A;  5FYX A;  1R2U A;  4WQ3 A;  1Y6W A;  1IY6 A;  2JU0 A;  3I5H C;  5DKQ A;  2XRC A;  1A29 A;  3I5H B;  4N1G A;  2BEC A;  2N52 A;  1YRT B;  4MN0 A;  2KI6 D;  3OB2 B;  3SGQ I;  4R1E A;  1QVI Z;  5FI7 A;  1YU6 C;  4A24 A;  2E30 A;  1NCY A;  1XFV O;  1M8C A;  4FKD A;  1KK7 Y;  5CSF A;  1J7O A;  1YVL A;  2Y1M A;  5AAN A;  4MRX A;  1TWO A;  1K95 A;  3UO9 A;  3JTD C;  1S3P A;  3JTD B;  1R79 A;  2RIJ A;  2WGC A;  2K7B A;  1DVI A;  1CB1 A;  5J8C A;  1NCX A;  4YGC B;  4F0Z B;  1TUJ A;  2JRF A;  1G4Y R;  1K96 A;  3HX4 A;  2JW6 A;  1OOF A;  4YGD B;  1G33 A;  1SYM A;  1MHO A;  1OMT A;  3D0Y A;  5ER5 A;  1QX2 A;  2OTG B;  1KFX L;  1IW4 A;  4JKT A;  4HRG A;  3R5B A;  2CWF A;  1NPQ A;  1PRW A;  1IG5 A;  1BG1 A;  2PQL A;  1AHR A;  1ULK A;  5B8I B;  5PAL A;  3BQ3 A;  3LK0 A;  2LP2 A;  1S6J A;  3MSE B;  4BY5 A;  1PAL A;  2WND A;  1QV1 A;  1S5G Y;  2H61 C;  4MBE A;  3CR2 A;  1DQE A;  1HT9 A;  4SGB I;  4ZCU A;  2QQC A;  2WOS A;  3OGN A;  1MXL C;  2PSR A;  5JJG A;  2F3Y A;  3CZ1 A;  3TOB A;  1ALW A;  3AAK A;  1YR5 A;  4ETO A;  1M39 A;  1KBF A;  1OYV I;  1IJ5 A;  1S6C A;  2YUU A;  4JPZ B;  5HLV A;  2KAV A;  3DF0 B;  3WHT B;  3EG5 B;  5I2L A;  1N65 A;  2M8U A;  3CYZ A;  1Z7K B;  2SGE I;  1DT7 B;  1U5I B;  4GGN A;  9WGA A;  3CGA A;  2NCO A;  3FE8 A;  1KWO C;  3EVR A;  3DYE A;  1KWO B;  1RFH A;  2WCM A;  2Y4Q A;  4CID A;  3NGV A;  1SCM C;  1TNQ A;  1WRK A;  1SCM B;  1F4O A;  2JXD A;  2QEB A;  1TOP A;  2M1U A;  2O60 A;  5CSN A;  4YGA A;  2KMR A;  4GGF C;  1DC1 A;  2QPT A;  3L4A A;  1FAR A;  5J8F A;  1LS8 A;  1CM1 A;  4QJ5 B;  1N0Y A;  3KHE A;  2JT8 A;  2BCA A;  4PHJ A;  3LCP C;  3PM8 A;  1YX8 A;  5AFP A;  2GGZ A;  3UGD A;  1IQ3 A;  2LAN A;  1B7T Y;  3BXK A;  1KMA A;  2QQE A;  2K2A A;  1CE3 A;  3A8R A;  3QTL D;  1Q9B A;  1LKJ A;  2KYF A;  1SR6 B;  2L2E A;  1ZFS A;  2SAS A;  1XA6 A;  3VRN A;  1OVO A;  1CMF A;  1KQV A;  3F45 A;  2ZKM X;  1KFX S;  4P2Y B;  4YGE B;  5D69 A;  2GTE A;  3D77 A;  1F8H A;  1UVF A;  2PQ8 A;  3BOW A;  1GGW A;  3SS5 A;  2KGB C;  2P70 A;  1YUU A;  1WDC C;  5IBW A;  3L47 A;  4QJ3 B;  3OXF A;  1WDC B;  2QAC A;  1A03 A;  1K9U A;  3VRR A;  2OS8 C;  1OZS A;  3FE9 A;  1OW4 A;  2OS8 B;  3E59 A;  3RU0 A;  1IKU A;  4YI8 A;  3UGL A;  1TIH A;  2K7C A;  1U5K A;  2K7O A;  1SY9 A;  3EVU A;  1UUC A;  1UHJ A;  3PAT A;  2EC6 C;  2CJS C;  3MEK A;  2EC6 B;  2LNK A;  1AK8 A;  1OMU A;  2LLU A;  2PAL A;  2M5X A;  2CNP A;  1LA3 A;  2WVJ A;  1AVS A;  3FSY A;  1REC A;  1BR4 B;  1SGR I;  1SBJ A;  1KBE A;  1EG3 A;  1LR8 A;  2NU2 I;  1K93 D;  1UUS A;  2I2R E;  1IY5 A;  2K2F A;  3D76 A;  2GKV A;  1BMO A;  3PSR A;  1H4B A;  1QLK A;  1WLZ A;  3SIB A;  1GJY A;  1IWQ A;  3S0G A;  4PDZ A;  1RK9 A;  1NX3 A;  3B7A A;  5FI6 A;  2KGR A;  5JOL A;  3O2P A;  2NU4 I;  2IS9 A;  2LHL A;  2P71 A;  1HPT A;  1SRA A;  3EK8 A;  3IF7 A;  2QPO A;  4MZJ A;  3BYA A;  3FWC A;  1OZO A;  1MQ1 A;  2OPO A;  2LEO A;  1CFF A;  5KTY A;  1QAT A;  5DIC A;  4PHM A;  1QVI Y;  2PRU A;  4QJ4 B;  1IH0 A;  2JUL A;  1Y1C A;  3SS3 A;  2H61 A;  2B0U C;  2YGU A;  1H0Z A;  2QQ0 A;  1B1G A;  2KOT A;  2LVK A;  2OVO A;  1PPF I;  2KQ6 A;  1CLM A;  4M2O A;  1ORG A;  1K9P A;  2EHB A;  2KLE A;  1SK6 D;  1Y1X A;  2F2P A;  1FY7 A;  1QLS A;  2KSP A;  4DIR A;  1F71 A;  2KAY A;  4WQ2 A;  3DF0 A;  1QX5 B;  3SGB I;  3SG7 A;  2BBN A;  5KU1 A;  3EKJ A;  2V53 A;  1JWD A;  5I94 A;  1U5I A;  2ENN A;  3PM2 A;  3QRX A;  4AML A;  2NZ0 A;  1F54 A;  2PVB A;  3RLZ A;  5ER4 X;  1BJF A;  3OB1 B;  3BUW B;  2M9G A;  1DS2 I;  1OE9 B;  1TBN A;  1PVB A;  1OOH A;  2L2C A;  2GIV A;  3B4V C;  3TS5 B;  4GGF A;  2KLD A;  1R0R I;  2KAX A;  5HKY A;  3PN7 C;  2WCJ A;  5HYD A;  1SPY A;  1A2X A;  4I5N B;  5E3R A;  3PN7 B;  1TBQ R;  1EXR A;  2V1C C;  2WCK A;  2DOQ A;  2L5X B;  4HRH A;  2UZ3 A;  2ZN8 A;  5GQQ C;  1UP5 A;  1TCO B;  2K0J A;  4GNK B;  1WLM A;  1QTX A;  1LXF C;  2WCH A;  2Q91 A;  1DTL A;  1M31 A;  1KK8 C;  3S0F A;  1TUR A;  2FCE A;  2E73 A;  1KK8 B;  1LR7 A;  3CLN A;  4TNC A;  1VDD A;  1CGI I;  2MJW B;  3VRQ A;  4JCV E;  2SGP I;  2M29 A;  2KBM A;  3SJS A;  4HSZ A;  3SS4 A;  1NX0 A;  3S0D A;  2WC5 A;  1YVH A;  3S0B A;  3CXL A;  2ZN9 A;  1QS7 A;  1M63 B;  1K7T A;  2LVJ A;  3SEK C;  2JT0 A;  1YUR A;  1OQP A;  2L8E A;  1PK0 D;  3VRO A;  5K89 A;  4F7F A;  3VRP A;  1KQM C;  1KQM B;  5BPJ A;  2M1K B;  1DJW A;  3I5I C;  5AER A;  2AUC A;  1MJ9 A;  3PJI A;  1SGQ I;  1ULN A;  3I5I B;  1FW4 A;  3TOA A;  1NCZ A;  1WGC A;  1PTQ A;  2A4J A;  2ENZ A;  1SKT A;  1K7V A;  5HI7 A;  2QEV A;  1EL4 A;  2L4I A;  2LB7 A;  1G8I A;  3BJH A;  1UHH A;  4YRU A;  1WKX A;  3C1V A;  1UUR A;  4IL1 A;  1XX6 A;  1PSB A;  3E2I A;  4B6D A;  3OXL A;  3OHM B;  1K7U A;  2LHI A;  1OSA A;  4E1R A;  1SGN I;  2LP3 A;  1DGU A;  4AQJ A;  2L7X A;  1NUB A;  1OOJ A;  3K1E A;  3OX6 A;  1UHK A;  3PFV A;  1CKK A;  2SGD I;  3RZS A;  1CNP A;  4NDD A;  1Y0V H;  4GFT A;  5HL1 A;  3UEY A;  2RGI A;  2ARP F;  4DUQ A;  2SGQ I;  1B8C A;  1LVC D;  5FUV A;  2FJU B;  5AXI A;  2W0T A;  2M7N A;  5E3P A;  1W3S A;  3CWG A;  1SW8 A;  4ICB A;  1XFY O;  4C0K A;  4OCI A;  2E5R A;  4OV2 A;  4GBA A;  1J55 A;  5F6T A;  2F33 A;  1DGV A;  4FQT A;  3BJI A;  1TBO A;  2JXL A;  1RWY A;  3DVM A;  3Q8I A;  1HQV A;  2Y5I A;  1XVJ A;  1C3Z A;  1FI6 A;  2E6W A;  3OL0 A;  3DD4 A;  2NU3 I;  1IJ6 A;  4PCW A;  3OBV A;  2KYC A;  3NHI A;  1UWO A;  3V2L A;  1HJA I;  2LUX A;  1OOI X;  1TN4 A;  4PHN A;  2BNX A;  2J87 A;  2BBM A;  4JWQ A;  1P9G A;  2VRW B;  4ORA B;  5D7F A;  4CFQ A;  5I2O A;  3CAB A;  1K90 D;  3RM1 A;  2MBX A;  3BUO B;  2FOT A;  4I5K A;  1SL8 A;  3NSL A;  1DJG A;  2G2B A;  2GKT I;  4NDC A;  3S0A A;  1FPW A;  2ZRS A;  3O4X A;  2LVV A;  3CDN A;  5I2Q A;  1JFK A;  2AAO A;  1X4S A;  1W9Z A;  1CDM A;  3EK7 A;  2BE6 A;  2LMT A;  3K21 A;  1LR9 A;  1ZAC A;  2KQY A;  5TNC A;  3R1P A;  5I8N A;  1P28 A;  1KFU L;  4A4C A;  2PMY A;  2NLN A;  3ICB A;  3S0E A;  1A75 B;  2V1C A;  3D78 A;  2TN4 A;  3VGO A;  1S6I A;  2JQ6 A;  1KSM A;  1Z2C B;  3VE5 A;  2HQ8 A;  1XBT A;  5CCM A;  5KSZ A;  1SGY I;  1RRO A;  2D8N A;  1J7R A; 
#chains in the Genus database with same CATH homology
 1QLS A;  4MZK A;  2KSP A;  1B8L A;  4DIR A;  1F71 A;  1CFD A;  5CSF A;  2KBI A;  1J7O A;  2I94 A;  3O4Y A;  1ZOT B;  2KAY A;  1YVL A;  2F8P A;  2WCF A;  4M2Q A;  3DF0 A;  2Y1M A;  4WQ2 A;  4YBH B;  3NXA A;  4MRX A;  1QX5 B;  5AAN A;  3NSK A;  1K94 A;  1K95 A;  3EK4 A;  1AP4 A;  3SGB I;  1QV0 A;  3JTD C;  4XJK B;  1TIZ A;  2BBN A;  3SG7 A;  1S3P A;  5KU1 A;  1PJU A;  3SG4 A;  2M3W A;  1BR1 B;  2P6B B;  3JTD B;  2MLE C;  3EKJ A;  1R79 A;  2I7A A;  4OVO A;  2V53 A;  1C7W A;  1JWD A;  1V1F A;  1ODB A;  1C7V A;  2JZI A;  1R6P A;  1LA0 A;  1U5I A;  2ENN A;  3QRX A;  3HH2 C;  4D1E A;  2K7B A;  1DVI A;  5DKN A;  1CB1 A;  1DS3 I;  2KNE A;  1NCX A;  1CDN A;  1SL7 A;  2A20 A;  2NZ0 A;  2SCP A;  4YGC B;  1FBV A;  4F0Z B;  1J1D A;  1Y1B A;  1MXE A;  1F54 A;  2JRF A;  4OVN F;  2BCB A;  2PVB A;  3BUX B;  3UGI A;  3UFF A;  1G4Y R;  1K96 A;  1KK7 Z;  2M49 B;  1DJI A;  1YX7 A;  3HX4 A;  2JW6 A;  1V1G A;  3RLZ A;  5ER4 X;  3TDU A;  4YGD B;  1BJF A;  1G33 A;  3KF9 A;  1IRJ A;  2Q4U A;  1SYM A;  1MHO A;  4A4B A;  1OMT A;  1TRF A;  3OB1 B;  3D0Y A;  4PE4 A;  3BUW B;  1BLQ A;  4AQI A;  2GV5 A;  3H4S E;  2M9G A;  1TCF A;  1DS2 I;  5ER5 A;  4M2P A;  2CBL A;  3NSI A;  1QX2 A;  1PCE A;  2OTG B;  1OE9 B;  1TBN A;  4ORC B;  4PE1 A;  2L51 A;  1PVB A;  3WHU B;  1B47 A;  1KFX L;  5CSJ A;  2BUS A;  2ROW A;  1S1E A;  1IW4 A;  2JA1 A;  2G9B A;  1S26 D;  3B4V C;  4HRG A;  3TS5 B;  4GGF A;  2MRD A;  1R0R I;  1QIV A;  2KAX A;  5HKY A;  2JZM A;  1NPQ A;  2K61 A;  3GOX A;  3PN7 C;  5HYD A;  4SGB I;  1SPY A;  2HPS A;  1A2X A;  1PRW A;  4I5N B;  1JF2 A;  3PN7 B;  5HLO A;  1TBQ R;  1EXR A;  1IG5 A;  1K8U A;  1J1E A;  1AJ4 A;  2V1C C;  1BG1 A;  1M45 A;  2DOQ A;  1MUX A;  1AHR A;  2L5X B;  2LC5 A;  4HRH A;  1CLB A;  2UZ3 A;  1CHO I;  5B8I B;  2ZN8 A;  2AMI A;  5GQQ C;  1SR6 C;  1TCO B;  1UP5 A;  3BQ3 A;  1PSR A;  2K0J A;  1XK4 A;  3LK0 A;  4GNK B;  5G08 A;  5PAL A;  2LP2 A;  1NIW A;  4DRW A;  1S6J A;  1WLM A;  1QTX A;  3MSE B;  4BY5 A;  1LXF C;  2LMV A;  4I5J A;  3OXG A;  1PAL A;  4USL A;  2LM5 A;  2WND A;  2ELI A;  1QV1 A;  2Q91 A;  4YGB B;  1DTL A;  1M31 A;  1S5G Y;  3KO0 A;  1MT1 A;  1TBR R;  1KK8 C;  1TUR A;  2FCE A;  2H61 C;  4MBE A;  2E73 A;  3CR4 X;  3CR2 A;  1DJY A;  1K9K A;  1KK8 B;  4GAO A;  2HF5 A;  1LR7 A;  1HT9 A;  2LAP A;  3CLN A;  2L0P A;  2K8M B;  1DJH A;  4TNC A;  1V1H A;  3KPX A;  1CGI I;  2MJW B;  3VRQ A;  4ZCU A;  1CGJ I;  1BOD A;  1VDD A;  1CSO I;  2QQC A;  1LIN A;  4JCV E;  2SGP I;  1TNW A;  2WOS A;  1XFX O;  2MHH A;  1X02 A;  1DMO A;  2M29 A;  2WCE A;  2KBM A;  1MXL C;  1B8R A;  2PSR A;  3HCM A;  5JJG A;  2P6A C;  3SJS A;  2F3Y A;  4HSZ A;  1MWN A;  1ALW A;  1FAQ A;  2VRG A;  3PAL A;  1Q80 A;  1YR5 A;  3AAK A;  3IQQ A;  1NX0 A;  4ETO A;  3FIA A;  1M39 A;  1IQ5 A;  1SL9 A;  1EG4 A;  1KBF A;  1DF0 A;  2JTT A;  3AKA A;  1FI5 A;  1OYV I;  4ZCV A;  1M8B A;  2OD1 A;  3KY9 A;  1S5G Z;  4OR9 B;  1IJ5 A;  3ZWH A;  1S6C A;  2WOR A;  1CFP A;  2FNF X;  2JPT A;  1MR8 A;  1QAS A;  3BUM B;  4C0J A;  4P5O E;  2YUU A;  4JPZ B;  1YVH A;  2KAV A;  3DF0 B;  5HLV A;  3D00 A;  3CXL A;  2ZRT A;  2ZN9 A;  4CPV A;  1QS7 A;  3WHT B;  3OX5 A;  4OKH A;  1KFU S;  1M63 B;  5I2L A;  1KCY A;  3O6B A;  1N65 A;  2LVJ A;  2M8U A;  4Q04 A;  1Z7K B;  2DIP A;  3SEK C;  2SGE I;  1XFU O;  1XFW O;  2JT0 A;  1U5I B;  1YUR A;  4FQO A;  4GGN A;  1DT7 B;  1H8B A;  1OQP A;  4CLN A;  4E1P A;  5JHW C;  2KI4 C;  2L8E A;  3CGA A;  2NCO A;  1PK0 D;  1KWO C;  1JUO A;  3GK2 A;  3VRO A;  3EVR A;  5K89 A;  1IGV A;  2KI4 B;  4UPG A;  2JNX A;  3VRP A;  1KWO B;  1RFH A;  2COL B;  1TNX A;  1KQM C;  2WC8 A;  2O5G A;  2Y4Q A;  1CMG A;  3CR5 X;  1SMG A;  3M0W A;  1EH2 A;  4CID A;  1N13 A;  1GQM A;  1KQM B;  1RJV A;  5BPJ A;  4MVF A;  2J9R A;  1NSH A;  2M1K B;  1DJW A;  3D0Y B;  1SCM C;  1TNQ A;  1W7J B;  3I5I C;  1WRK A;  5AER A;  2AUC A;  1SCM B;  1F4O A;  1SGQ I;  3I5I B;  2JXD A;  1TOP A;  1FW4 A;  2ZNE A;  4WRI A;  2Y1N A;  2M1U A;  2O60 A;  1NCZ A;  5CSN A;  4YGA A;  2KMR A;  1WRZ A;  2M0R A;  5HKZ A;  1M46 A;  4GGF C;  1PTQ A;  5FUX A;  2A4J A;  5FUY A;  2ENZ A;  2QPT A;  2KFF A;  4C0L A;  2F3C I;  1SKT A;  5HI7 A;  1EL4 A;  1FYB A;  2L4I A;  1Y8F A;  1FAR A;  1JF0 A;  3E3R A;  2K7D A;  2B8T A;  1KSO A;  4L9M A;  1G8I A;  1QIW A;  4I5L B;  1RTP 1;  1XK4 C;  1UHH A;  4YRU A;  1CM1 A;  4QJ5 B;  1N0Y A;  3KHE A;  2JT8 A;  4MEW A;  2BCA A;  2WCB A;  4PHJ A;  1JFJ A;  1F70 A;  1J7P A;  1AJ5 A;  3C1V A;  1UUR A;  3LCP C;  3PM8 A;  1DJX A;  2R2I A;  4IL1 A;  3VDP A;  1XX6 A;  1YX8 A;  3OP0 A;  5AFP A;  1PSB A;  2GGZ A;  3E2I A;  3UGD A;  1UVG A;  3TDI A;  1W7I B;  3EKH A;  1IQ3 A;  5HQ8 A;  4MRY A;  4B6D A;  3OXL A;  1YTZ C;  2LAN A;  3AAJ A;  4GI3 C;  1B7T Y;  3BXK A;  1KMA A;  2QQE A;  4PHK A;  2K2A A;  3OHM B;  3CZT X;  2SGF I;  1CE3 A;  2LLS A;  1B9A A;  3A8R A;  2LHI A;  3QTL D;  2BL0 C;  2FCD A;  1OSA A;  2KMQ A;  4E1R A;  1LKJ A;  1VRK A;  2KYF A;  2LMU A;  2LP3 A;  1DGU A;  1SGN I;  4AQJ A;  1HDL A;  1SR6 B;  2BL0 B;  2L7X A;  1NUB A;  2KHN A;  1NP8 A;  1OOJ A;  4HRE E;  5J3X A;  1BUS A;  2KMO A;  3TZ1 A;  3SG6 A;  2L2E A;  1ZFS A;  2SAS A;  1YUS A;  3OX6 A;  5CPV A;  1UHK A;  1MF8 B;  1XA6 A;  1TTX A;  3I5G C;  2LLT A;  3PFV A;  1CKK A;  2SGD I;  3VRN A;  3I5G B;  1OVO A;  3LK1 A;  1CMF A;  1CTR A;  1XYD A;  1J7Q A;  1KQV A;  1TGS I;  2QQD A;  1CNP A;  4NDD A;  1DF0 B;  3F45 A;  2JWW A;  2ZKM X;  1KFX S;  1X74 A;  1Y0V H;  1YUT A;  3JVT C;  4GFT A;  4P2Y B;  2BKH B;  4YGE B;  5D69 A;  2NU0 I;  3FC3 A;  1SGE I;  3JVT B;  1F8H A;  2ISD A;  1UVF A;  1B7T Z;  3AKB A;  2DB6 A;  1Y1U A;  1OMR A;  3SG5 A;  3UEY A;  2RGI A;  5AEQ A;  1OMV A;  4U8D A;  3GOF A;  4N1F A;  5EX0 A;  2BE4 A;  2ARP F;  1UHN A;  1PVA A;  4DUQ A;  1D1O A;  2LUY A;  1ZMZ A;  2SGQ I;  1JC2 A;  1B8C A;  1LVC D;  4GUK A;  5HKW A;  5FUV A;  1XA5 A;  1SGD I;  4PE0 A;  5FUW A;  2FJU B;  5AXI A;  3BOW A;  4UXJ A;  2W0T A;  1GGW A;  2M7N A;  3O78 A;  2KGB C;  1YUU A;  1K2H A;  1W3S A;  3CWG A;  1SW8 A;  1NX2 A;  2MA2 A;  4ICB A;  1XFY O;  4YI9 A;  4OCI A;  4C0K A;  1WDC C;  5IBW A;  2E5R A;  4QJ3 B;  4OV2 A;  1RFJ A;  1J55 A;  4GBA A;  3OXF A;  5F6T A;  1WDC B;  2F33 A;  1DGV A;  2QAC A;  1A03 A;  2JYY A;  1K9U A;  2NXQ A;  3VRR A;  2OS8 C;  3BJI A;  1OZS A;  1TBO A;  1NYA A;  2L98 A;  1A75 A;  4GPL B;  2OS8 B;  4MSP A;  2BKI B;  2JXL A;  1RWY A;  1Y1A A;  3DVM A;  4NDB A;  2LCP A;  2ORV A;  1V1I A;  3E59 A;  3RU0 A;  1S36 A;  1HQV A;  2Y5I A;  1IKU A;  1XVJ A;  3BUN B;  4YI8 A;  3UGL A;  1TIH A;  1WY9 A;  2K7C A;  2F3Z A;  1FI6 A;  2E6W A;  2L50 A;  1B4C A;  1U5K A;  3WXA A;  4AOM A;  1CLL A;  2K7O A;  3A4U B;  3SIA A;  3OL0 A;  1SY9 A;  3EVU A;  1UUC A;  2N17 A;  1UHJ A;  3DD4 A;  3PAT A;  2NU3 I;  1CDP A;  2GVI A;  1DJZ A;  2BCX A;  1IJ6 A;  4PCW A;  1QJT A;  2EC6 C;  2CJS C;  3MEK A;  2CCM A;  2CXJ A;  4XYN A;  3DVJ A;  2KYC A;  2EC6 B;  2LNK A;  2CTN A;  2F2O A;  2N71 A;  2KI6 C;  1AK8 A;  1OMU A;  2ZND A;  1NX1 A;  2CT9 A;  2LLU A;  1XO5 A;  2LV7 A;  1UWO A;  2PAL A;  2WCY A;  2ERW A;  2JXC A;  2KDH A;  2PAS A;  3ZNI A;  2M5X A;  2CNP A;  2LUX A;  1LA3 A;  3WNX B;  1HJA I;  2WVJ A;  1TN4 A;  2LVI A;  4PE7 A;  4PHN A;  3TUY C;  2J87 A;  1YTP A;  4MLW A;  1AVS A;  3IQO A;  2BBM A;  1REC A;  2JTZ A;  3CTN A;  1FF1 A;  3TUY B;  4E68 A;  1BR4 B;  1SGR I;  1SBJ A;  1E8A A;  2L4H A;  4JWQ A;  4CFR A;  1KBE A;  4DS7 A;  4ORA B;  2VRW B;  5D7F A;  2NU1 I;  4CFQ A;  1PTR A;  1EG3 A;  3TDZ A;  1UHI A;  5I2O A;  3I5F C;  2LUC A;  2K9H A;  3FS7 A;  1LR8 A;  2NU2 I;  3I5F B;  1CT0 I;  4N5X A;  1F4Q A;  1K90 D;  4XJK A;  3RM1 A;  2MBX A;  1K93 D;  1L7Z A;  3BUO B;  1QX7 A;  3GK1 A;  2FOT A;  1UUS A;  2I2R E;  2JT3 A;  1IY5 A;  3UEJ A;  1XFZ O;  2K2F A;  5CSI A;  1JSA A;  1W4R A;  2YQP A;  3PLF B;  2NCP A;  4I5K A;  4BY4 A;  2GKV A;  3DVK A;  2HET A;  1SL8 A;  1BMO A;  3NSL A;  1BOC A;  3PSR A;  1H4B A;  1CT4 I;  3SG2 A;  1QLK A;  1WLZ A;  2I18 A;  3KEV A;  3SIB A;  1DJG A;  2G2B A;  5DAE A;  1A4P A;  4UXH A;  2GKT I;  2OTG C;  1TOT A;  3TJQ A;  1GJY A;  3LL8 B;  4NDC A;  1NWD A;  1FPW A;  2ZRS A;  4UXI A;  2KCX A;  1IWQ A;  4FKD A;  4MZL A;  2ORW A;  3QWP A;  3CS1 A;  2MAZ A;  3D10 A;  4JQ0 D;  3TS5 C;  3PDN A;  4PDZ A;  4NQG A;  1RK9 A;  1NX3 A;  3FWB A;  2GGM A;  2LVV A;  5I2Q A;  1JFK A;  2AAO A;  1AN1 I;  2KGR A;  5JOL A;  3O2P A;  2N1A B;  3SG3 A;  1X4S A;  1F55 A;  2NU4 I;  1SCV A;  5CCL A;  1CT2 I;  2M7L A;  1CDM A;  2IS9 A;  2LHL A;  1HPT A;  3EK7 A;  1SRA A;  2BE6 A;  2LMT A;  2KFH A;  2ODD A;  3EK8 A;  3K21 A;  3IF7 A;  1ZAC A;  3GK4 X;  1LR9 A;  3LLE A;  2QPO A;  3BOW B;  2KQY A;  4MZJ A;  1BF5 A;  1SNL A;  1QXP A;  3BYA A;  3FWC A;  2H2K A;  5TNC A;  3OVO A;  1C07 A;  1GGZ A;  2HQW A;  1CM4 A;  1OZO A;  1KFU L;  4PAL A;  2KFG A;  4A4C A;  5I8N A;  2B1U A;  2PMY A;  1SGP I;  2NLN A;  3ICB A;  1CFC A;  1MQ1 A;  2OPO A;  2LEO A;  4DCK A;  1CFF A;  5KTY A;  1QAT A;  1BU3 A;  2MLF C;  1BT6 A;  1A75 B;  1TNP A;  1EJ3 A;  4PHM A;  1OMD A;  1QVI Y;  2V1C A;  3DVE A;  2TN4 A;  3VDU A;  2ZFD A;  2GKR I;  1PUL A;  2PRU A;  4QJ4 B;  3VGO A;  1IH0 A;  5DKR A;  5FYX A;  5EX3 A;  1S6I A;  1ALV A;  2JUL A;  1Y1C A;  1R2U A;  2JQ6 A;  1KSM A;  4WQ3 A;  1Y6W A;  1IY6 A;  4HGU A;  2EGD A;  2JU0 A;  2JC2 A;  3I5H C;  5DKQ A;  2H61 A;  2B0U C;  3VE5 A;  1H0Z A;  2XRC A;  1A29 A;  1N2D A;  3I5H B;  2QQ0 A;  1AUI B;  2HQ8 A;  4ORB B;  1B1G A;  2KOT A;  2LVK A;  4N1G A;  1XBT A;  1ZUZ A;  2BEC A;  2OVO A;  2KMP A;  2N52 A;  1CDL A;  2LE9 B;  1PPF I;  2KQ6 A;  1YRT B;  4MN0 A;  1CLM A;  2KI6 D;  5CCM A;  4M2O A;  5KSZ A;  1JBA A;  3OB2 B;  3SGQ I;  1K9P A;  2EHB A;  3NSO A;  4R1E A;  2M97 A;  1QVI Z;  3EVV A;  1L2O C;  4FTG A;  1YU6 C;  2JOJ A;  4A24 A;  1SGY I;  2E30 A;  1YRU B;  2JNF A;  1L2O B;  1NCY A;  1XFV O;  1RRO A;  1SK6 D;  1TUS A;  1WRL A;  1M8C A;  2D8N A;  1Y1X A;  2F2P A;  1J7R A;  1KK7 Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...