1NUBA

Helix c deletion mutant of bm-40 fs-ec domain pair
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
226
structure length
226
Chain Sequence
APCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and mapping by site-directed mutagenesis of the collagen-binding epitope of an activated form of BM-40/SPARC/osteonectin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Extracellular module
molecule keywords BASEMENT MEMBRANE PROTEIN BM-40
total genus 71
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
A PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nubA02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1nubA01
4WQ3A 1QLSA 5CSIA 1B8CA 3HH2C 1PK0D 2MLFC 1KWOC 1CHOI 3CZTX 1KQMB 1TBRR 2JOJA 2KQYA 2ZN8A 5I2LA 3BQ3A 1XFUO 3TS5B 3BYAA 2K2FA 3EK4A 1RK9A 3BOWA 1OMVA 2LMTA 4PE7A 3PN7C 1WLZA 4QJ5B 2NU4I 1MXLC 1LR7A 1MQ1A 3LL8B 1QVIZ 1XYDA 2KDHA 1OMTA 4ORBB 1DJGA 3TS5C 2CNPA 2M9GA 5F6TA 3GK4X 4ORCB 1DGUA 1SGYI 3JVTC 4PHJA 2JQ6A 2MRDA 1DJXA 5JHWC 1UURA 4YI8A 2MBXA 3WHTB 1TNWA 1YUTA 4GGNA 5D69A 1FI6A 5DAEA 1XFYO 2F33A 2JPTA 1B7TZ 2HQ8A 5D7FA 5AERA 1A03A 2JYYA 1M45A 1CT2I 1JUOA 1YUSA 2JTTA 2OTGB 1Y0VH 5HLOA 3TDUA 4A4CA 1IQ5A 1XK4A 2KI4C 2F2PA 2LM5A 1CFPA 2LE9B 1QV1A 2OS8B 1YU6C 1CSOI 2LVKA 2LMUA 2OS8C 3VRPA 1YR5A 4PE0A 1A75B 3BUXB 2AAOA 2JULA 1NP8A 3QTLD 2BE6A 2XRCA 2LHIA 1CM1A 3VRQA 1ZMZA 2V53A 4I5KA 1TURA 4PHMA 4Q04A 1LR9A 1R2UA 1NWDA 1Y1AA 4OKHA 2BUSA 2LNKA 3AKAA 2NCOA 1K90D 2LUCA 4OCIA 4BY4A 2KI6C 2L51A 2PMYA 3D0YB 2M1UA 3O2PA 1SL7A 3OB1B 1FBVA 1W7IB 2ZRSA 3NSIA 3AKBA 1Y1UA 2KYFA 2WCBA 3FWCA 4YRUA 3OX6A 1F70A 1NX0A 4PHKA 1KK8C 1ZACA 2PASA 1KK7Z 1NIWA 3QRXA 3SJSA 2Q91A 1KQMC 1YVHA 2Y4QA 4DCKA 3E3RA 1ALWA 2JT8A 3I5IB 5I8NA 1K9PA 1N13A 1M46A 1IH0A 2LVVA 4MN0A 2LANA 4OVNF 1D1OA 2D8NA 1PPFI 5HLVA 5JOLA 3PATA 2NLNA 2QACA 5GQQC 1G4YR 2PRUA 1R6PA 1NCZA 2HETA 1WRZA 2KMOA 1TNXA 2G9BA 3CGAA 4FTGA 2ARPF 3M0WA 1UWOA 4MRYA 2JZMA 2JXDA 1FF1A 1KFUL 3DF0B 2KBMA 1AUIB 1KFUS 2N71A 1BR1B 5AEQA 1KCYA 2NXQA 3KEVA 1MXEA 1QX2A 2KMRA 2I18A 1AP4A 4YGEB 5I2OA 1M8BA 1TOPA 2L50A 1SBJA 1SGDI 1CLMA 1XFZO 1IWQA 2KQ6A 1UHHA 2L5XB 4FQOA 4HRGA 2RGIA 5J3XA 3KHEA 3PM8A 4GNKB 2LLUA 4XJKA 3O78A 2L98A 1UHJA 4CPVA 4L9MA 3TJQA 1WDCB 3F45A 3VRNA 1QX5B 1FW4A 1OZOA 3ICBA 5KU1A 1SYMA 1OYVI 2KCXA 2KMQA 1TBQR 4PALA 1BT6A 1H0ZA 3BUOB 4TNCA 1PVBA 2KAVA 4GBAA 1IJ6A 1B1GA 2OPOA 3TUYC 1F8HA 1PJUA 1PCEA 2JXLA 2NU2I 2SGDI 2FJUB 1S5GZ 1YX8A 2LHLA 2GGMA 2WCEA 4AQIA 1OE9B 3NSLA 1TNQA 1AK8A 1PSBA 1GGZA 5AXIA 3DVEA 2LUXA 2MA2A 4GAOA 3DD4A 2KNEA 2MLEC 1KK7Y 4DIRA 3VGOA 1SKTA 1TIHA 2R2IA 1JC2A 1CT0I 3GK1A 5HKYA 2EC6C 1IGVA 1S6CA 1DS3I 3O4YA 1CTRA 1NCXA 4P5OE 4YBHB 1QX7A 1PALA 1CDPA 1QS7A 3H4SE 1V1GA 4C0KA 3FIAA 2BKIB 1GQMA 1J1DA 1KSMA 1WRKA 2B1UA 4AQJA 1UP5A 4MZKA 2F3YA 1CFCA 2SGFI 1GGWA 5JJGA 2I7AA 2LV7A 5HKZA 3EKJA 3TUYB 2K61A 2ZN9A 4CFRA 1KQVA 4GPLB 3AAJA 2H61A 1DGVA 5DKNA 2M49B 1LINA 3KO0A 4WRIA 1OSAA 1L2OC 3SG3A 1RJVA 4GGFA 2NU0I 1B7TY 2M7NA 1F55A 1MT1A 2EHBA 4D1EA 4XYNA 1F4OA 1RFJA 1WDCC 2LVJA 1WLMA 2L0PA 1H8BA 1UHIA 3SG2A 2KMPA 3BUMB 1EJ3A 4UPGA 1CMGA 3SEKC 1MR8A 3HX4A 1PRWA 2M5XA 3D0YA 3DVKA 1F54A 3TDIA 1S36A 4ZCUA 1NYAA 1Y1CA 3JTDB 1CDNA 2KHNA 3LCPC 2PSRA 1SCVA 2WORA 5CSFA 5IBWA 1PSRA 2AUCA 1M8CA 2K7DA 2ZRTA 3OX5A 1CE3A 1TCFA 4DUQA 2NU1I 2KFFA 4M2QA 1C07A 1CMFA 1DF0A 1NUBA 4M2OA 4PHNA 1DT7B 1GJYA 1BF5A 1HJAI 4ORAB 4N1GA 3SIBA 1R0RI 2FCDA 4IL1A 2GKVA 1QJTA 3SG6A 1NPQA 2BBMA 2EGDA 4XJKB 1UVGA 1S6JA 3BUWB 3NXAA 1IW4A 1PVAA 4N1FA 1KFXS 3I5IC 3SG5A 2DOQA 2KI4B 1SGPI 5BPJA 1QXPA 2KFGA 3PLFB 1XFWO 4YGDB 1XFVO 4HRHA 2JC2A 3CR4X 2QPTA 2LCPA 5CSJA 5DKQA 4MVFA 1BLQA 2JNXA 4SGBI 2VRGA 2ZKMX 3LLEA 3JVTB 3KF9A 1SY9A 5DKRA 2CCMA 2JXCA 3IQOA 4AOMA 3OB2B 3CR5X 3K21A 4R1EA 4CIDA 1B4CA 2JNFA 1S5GY 1JBAA 3EK7A 2K7BA 1LA0A 1PULA 1KSOA 3PN7B 1BG1A 2LC5A 1J7RA 3IQQA 1CGJI 1M31A 1TUSA 1K96A 1NX1A 1U5IB 1CDMA 5CSNA 4JQ0D 4HREE 4E68A 1K93D 3EK8A 1CNPA 4I5NB 3NSOA 1SGQI 1YVLA 1WY9A 1KWOB 1QVIY 2HF5A 1MHOA 1LXFC 1XVJA 3EVRA 1DJIA 1EG3A 3C1VA 2CBLA 2NU3I 3CS1A 3VRRA 4NDDA 2LLSA 1SCMC 2NZ0A 2WC8A 1DJZA 2JZIA 2MHHA 2O60A 2PALA 1G8IA 2HQWA 2Y1MA 2KAXA 2GKRI 2K7OA 1BR4B 1QLKA 3NSKA 2Y1NA 1CFDA 2K8MB 2O5GA 1DS2I 2M29A 2TN4A 1XFXO 2BCAA 4DS7A 5KSZA 4ICBA 1HPTA 3SIAA 1AVSA 3GK2A 2SGQI 4MZJA 4GGFC 4GUKA 2KGBC 1SPYA 3CLNA 2H61C 2MAZA 1YRUB 2GGZA 1S3PA 1SCMB 2M8UA 1BJFA 2M3WA 1YURA 1YRTB 2SASA 1RECA 3DVMA 1LVCD 1XO5A 1NX2A 2K0JA 3SG7A 2LP3A 1LR8A 1QASA 2Q4UA 1CLBA 4WQ2A 1CGII 1MUXA 1EL4A 2IS9A 5HYDA 4MZLA 2K2AA 5ER4X 1QTXA 2JWWA 4I5LB 1QATA 1OOJA 4YGAA 1EG4A 1K9UA 1J7OA 2M7LA 1DMOA 1JF0A 1ZUZA 2KBIA 1JF2A 1ODBA 2LLTA 3MSEB 1A4PA 2G2BA 4ZCVA 1CLLA 2P6AC 4JPZB 2I2RE 3IF7A 3SGQI 1NX3A 1J7PA 1BUSA 1NSHA 2BE4A 1ALVA 3CR2A 1VRKA 2ZFDA 1AJ4A 1SGRI 1UUSA 2WNDA 1S26D 3DVJA 1B47A 1JFKA 1IY6A 4P2YB 2F8PA 4QJ4B 4C0JA 1K9KA 1Z7KB 2LAPA 4YI9A 1OZSA 2WCYA 1CB1A 1FI5A 4YGCB 2SGEI 1DJYA 1YTZC 4U8DA 3EVUA 4CFQA 4MRXA 1OMUA 1Y1BA 2BCBA 4PCWA 2SCPA 2QQDA 2M0RA 1M39A 1NCYA 1W7JB 2E30A 4I5JA 1K2HA 3KPXA 3O6BA 1DTLA 2GV5A 5B8IB 1U5IA 1OMRA 1B8LA 2BKHB 3PSRA 4DRWA 1HQVA 1X02A 1OMDA 1DF0B 4M2PA 1B8RA 1SK6D 2BCXA 5PALA 2L2EA 2E6WA 3BOWB 5AANA 1RROA 1OVOA 4A4BA 1BU3A 3I5HC 1TTXA 2F3CI 2ZNDA 3ZNIA 2COLB 1A75A 1FPWA 3FS7A 2A4JA 5I2QA 3PFVA 2OVOA 3RM1A 1IKUA 1DJWA 2KGRA 1H4BA 1J7QA 3TDZA 3I5GC 3VROA 2SGPI 1S6IA 3LK1A 4MSPA 4OV2A 5CPVA 1YTPA 1HDLA 1IY5A 2QQCA 1QIWA 2JT3A 2BBNA 1LKJA 2KOTA 5G08A 3WNXB 4NQGA 2CTNA 4F0ZB 1ZOTB 2BL0C 2L4HA 3DF0A 1Y1XA 1CFFA 1ZFSA 2PVBA 4ETOA 1DVIA 5TNCA 1L2OB 3I5FB 4NDCA 1EXRA 1TGSI 1SMGA 2ZNEA 5K89A 1WRLA 1M63B 3A8RA 1J1EA 2WOSA 3B4VC 1QIVA 1BOCA 2FOTA 3CWGA 4JWQA 2JT0A 1HT9A 1YX7A 3TZ1A 3EKHA 5AFPA 1B9AA 2KYCA 2ERWA 1SR6B 1UVFA 1TIZA 1SNLA 4HGUA 2L4IA 1AHRA 2F2OA 1TNPA 1EH2A 2KFHA 3A4UB 2B0UC 4QJ3B 1RTP1 4OR9B 1L7ZA 1AN1I 2LEOA 1FYBA 2KI6D 3GOFA 3JTDC 3OP0A 1CM4A 4MLWA 1C7WA 3BUNB 3WHUB 3D10A 2KSPA 2NCPA 1RWYA 1JSAA 4N5XA 1UUCA 5FYXA 1CDLA 1LA3A 1TN4A 3BXKA 4PE4A 4OVOA 1IQ3A 1TCOB 1XA5A 1BODA 3LK0A 1IG5A 4MEWA 1MWNA 3EVVA 2P6BB 1MF8B 2JRFA 1Y6WA 2HPSA 3SG4A 4BY5A 1OQPA 1K8UA 3I5FC 4MBEA 2CT9A 1E8AA 3OVOA 1N0YA 2N52A 1AJ5A 1KK8B 1TRFA 2Y5IA 2FCEA 2JTZA 2LMVA 1SRAA 3HCMA 5ER5A 1A2XA 2JU0A 1CT4I 3SGBI 5KTYA 2H2KA 1XK4C 3CTNA 2MJWB 3I5GB 4GI3C 1Q80A 2K7CA 2LP2A 1G33A 1SGNI 1N2DA 3WXAA 4HSZA 2F3ZA 3ZWHA 2CXJA 2ISDA 1K95A 1J55A 3I5HB 2EC6B 2M97A 1N65A 1YUUA 4PE1A 2WCFA 1K94A 1UHNA 1SW8A 1IJ5A 1SR6C 1DJHA 3PALA 1JFJA 4GFTA 2M1KB 3AAKA 1BMOA 1UHKA 1KMAA 4USLA 1KFXL 1SGEI 1IRJA 3OHMB 5HKWA 1A29A 4CLNA 1SL9A 2AMIA 1C7VA 1F71A 4C0LA 2OTGC 3FWBA 2I94A 1F4QA 2KAYA 3RLZA 1JWDA 1QV0A 1S1EA 1CKKA 4YGBB 1V1FA 4NDBA 4PDZA 2LVIA 2BECA 2GKTI 2N17A 1SL8A 2BL0B
chains in the Genus database with same CATH superfamily
4WQ3A 1QLSA 5CSIA 1TBNA 1B8CA 3HH2C 1PK0D 2MLFC 1KWOC 1CHOI 3NGVA 3CZTX 1KQMB 2K9HA 3UEYA 1TBRR 2JOJA 2KQYA 2ZN8A 5I2LA 3BQ3A 1XFUO 3TS5B 3BYAA 2K2FA 3EK4A 1RK9A 3BOWA 1OMVA 2LMTA 4PE7A 5DICA 3FSYA 3PN7C 1WLZA 2ERBA 3S0DA 4QJ5B 2NU4I 1MXLC 1LR7A 3VB1A 1MQ1A 3LL8B 1X4SA 2GTEA 1QVIZ 1XYDA 2KDHA 1OMTA 4ORBB 1DJGA 3TS5C 1DC1A 2CNPA 2M9GA 3NHTA 3GK4X 5F6TA 4ORCB 1DGUA 1OOIX 1SGYI 3JVTC 2WCLA 4PHJA 2JQ6A 2MRDA 3UEJA 1DJXA 5JHWC 1UURA 4YI8A 2MBXA 3WHTB 2J9RA 3R5BA 4F7FA 1TNWA 1YUTA 4GGNA 5D69A 1FI6A 1P28A 1P9GA 2WCJA 5DAEA 1XFYO 2F33A 2QDIA 2JPTA 1B7TZ 2HQ8A 3D78A 5D7FA 5HL1A 5AERA 3GOXA 1A03A 3CABA 1M45A 2JYYA 1CT2I 1JUOA 1YUSA 2JTTA 2OTGB 1Y0VH 5HLOA 3TDUA 3UO9A 1IQ5A 1XK4A 2KI4C 4A4CA 5E3PA 2F2PA 2LM5A 1CFPA 2LE9B 1QV1A 2OS8B 1YU6C 1CSOI 2LVKA 2LMUA 2OS8C 3VRPA 2KPHA 1YR5A 4PE0A 1A75B 2J87A 2L5YA 3BUXB 4JD9A 2AAOA 2JULA 1XA6A 1NP8A 5CCMA 1XX6A 3QTLD 2BE6A 2XRCA 2LHIA 2LB7A 5HI7A 1CM1A 3VRQA 1ZMZA 2E73A 2V53A 4I5KA 1TURA 4E1RA 1OOGA 4PHMA 5D3OA 4Q04A 1LR9A 3L4LA 1R2UA 1NWDA 1Y1AA 4OKHA 2BUSA 3UOEA 2LNKA 3AKAA 3VDPA 1TOTA 2NCOA 1K90D 2LUCA 2WGCA 4AQIA 4OCIA 3UGLA 4BY4A 2KI6C 2L51A 2PMYA 3D0YB 2M1UA 3O2PA 1SL7A 4FQTA 3OB1B 1FBVA 1W7IB 2ZRSA 3NSIA 3AKBA 3PM2A 1Y1UA 2KYFA 2WCBA 3FWCA 1WGTA 4YRUA 3OX6A 1F70A 3DY9A 3FE8A 1NX0A 1U5KA 4PHKA 1KK8C 1ZACA 2PASA 1KK7Z 1NIWA 3OGNA 2OZUA 3QRXA 3SJSA 2Q91A 2WC5A 3B7AA 1KQMC 1YVHA 2Y4QA 4DCKA 3E3RA 1ALWA 2JT8A 3I5IB 5I8NA 1K9PA 1N13A 1M46A 1IH0A 3D00A 2LVVA 4MN0A 2LANA 4OVNF 1D1OA 2D8NA 1K7UA 3D77A 3SS4A 3TO9A 1PPFI 5HLVA 2ROWA 1IIOA 3R72A 5JOLA 7WGAA 3PATA 2NLNA 2QACA 3CZ1A 1G4YR 2PRUA 1R6PA 3CZ0A 5GQQC 1NCZA 2HETA 1WRZA 1X74A 2KMOA 1TNXA 2G9BA 1Z4HA 3CGAA 4FTGA 2ARPF 3M0WA 1UWOA 4MRYA 2JZMA 2JXDA 1SSEB 1FF1A 1KFUL 3DF0B 2KBMA 1AUIB 1KFUS 2N71A 4PT1A 2PYQA 3NHIA 1BR1B 5AEQA 1KCYA 4JCVE 2NXQA 3KEVA 1R79A 1MXEA 1QX2A 1Z2CB 2KMRA 2I18A 1TUJA 1AP4A 3R5CA 4YGEB 5I2OA 4DNCA 1M8BA 1TOPA 2L50A 1SBJA 1SGDI 5CCLA 1CLMA 1XFZO 1IWQA 1K7VA 2KQ6A 1UHHA 2L5XB 4FQOA 4HRGA 3R1OA 2RGIA 5J3XA 1XBTA 2FJYA 3KHEA 3PM8A 4GNKB 2LLUA 4XJKA 4B6DA 3O78A 2L98A 1ULNA 1UHJA 4CPVA 4L9MA 3TJQA 1WDCB 3F45A 2L7XA 2L8EA 3RZSA 3VRNA 1QX5B 3PDNA 1FW4A 1OZOA 3ICBA 2QPOA 5KU1A 1SYMA 1OYVI 2KCXA 2KMQA 1TBQR 4PALA 1BT6A 1H0ZA 3BUOB 4TNCA 1PVBA 2KAVA 4GBAA 1IJ6A 1B1GA 2OPOA 3TUYC 1F8HA 1PJUA 2YQPA 3DYEA 1PCEA 2JXLA 1KBEA 2NU2I 2SGDI 2FJUB 1S5GZ 1YX8A 2LHLA 2GGMA 2WCEA 2WCMA 3BFHA 1OE9B 3CYZA 3B86A 1TNQA 1DEKA 3BFBA 3NSLA 1PSBA 1GGZA 1AK8A 1W9ZA 3S0GA 5AXIA 2L2CA 3DVEA 2LUXA 2MA2A 3O4XA 3DD4A 2KNEA 2MLEC 4GAOA 4KYNA 1KK7Y 4DIRA 2ORVA 3QWPA 3VGOA 1RFHA 1SKTA 1TIHA 4INWA 2R2IA 1JC2A 1CT0I 3GK1A 5HKYA 2EC6C 1IGVA 1S6CA 1DS3I 3O4YA 1CTRA 2WCKA 1NCXA 4P5OE 4YBHB 2WVJA 5FUVA 1QX7A 1PALA 1CDPA 1QS7A 3H4SE 5EX0A 1V1GA 4C0KA 3FIAA 2BKIB 1GQMA 5E3RA 1J1DA 1KSMA 1WRKA 2B1UA 4AQJA 1UP5A 4MZKA 2F3YA 1CFCA 2SGFI 3VE5A 4UXJA 1GGWA 5JJGA 2I7AA 2LV7A 5HKZA 2W0TA 3EKJA 3TUYB 2K61A 2ZN9A 4CFRA 1KQVA 4GPLB 1FY7A 3AAJA 2H61A 1DGVA 5DKNA 2M49B 1LINA 3KO0A 4WRIA 1OSAA 1L2OC 3SG3A 1RJVA 4GGFA 2NU0I 2ELIA 1HEVA 1B7TY 2M7NA 1F55A 1MT1A 2EHBA 4D1EA 4XYNA 1F4OA 1RFJA 1WDCC 2LVJA 1WLMA 2L0PA 1H8BA 2UZ3A 1UHIA 3SG2A 2KMPA 3BUMB 1EJ3A 4UPGA 1CMGA 4AMLA 3SEKC 3FC3A 1MR8A 2BNXA 1PRWA 3HX4A 2M5XA 3D0YA 3DVKA 1F54A 1PTQA 3TDIA 1S36A 3QMEA 4ZCUA 1NYAA 1TUZA 5E3QA 3FE6A 3S0BA 2P71A 3N7HA 1Y1CA 3JTDB 1CDNA 2KHNA 3LCPC 2PSRA 1SCVA 2WORA 5CSFA 3K1EA 5IBWA 1PSRA 2AUCA 1M8CA 1NXUA 2K60A 2K7DA 2ZRTA 3OX5A 1CE3A 1TCFA 4DUQA 1DELA 2KFFA 4M2QA 2NU1I 1C07A 1CMFA 3KY9A 1DF0A 1NUBA 4M2OA 4PHNA 1DT7B 1GJYA 1BF5A 3DZTA 4ORAB 4N1GA 3SIBA 1HJAI 2FCDA 4IL1A 1R0RI 2GKVA 1QJTA 3SG6A 1NPQA 2BBMA 2EGDA 3DXLA 4XJKB 1UVGA 1S6JA 3BUWB 3NXAA 1IW4A 3D73A 1PVAA 4N1FA 1KFXS 3I5IC 3SG5A 2DOQA 2KI4B 1DQEA 1SGPI 5BPJA 1QXPA 2KFGA 3PLFB 2FNFX 1XFWO 4YGDB 1XFVO 4HRHA 2JC2A 1FAQA 3CR4X 2QPTA 2CWHA 2LCPA 5CSJA 5DKQA 4MVFA 1BLQA 1W3SA 2JNXA 3CDNA 2UVOA 2DIPA 4SGBI 2VRGA 2ZKMX 3LLEA 3JVTB 3KF9A 1SY9A 3TO6A 5DKRA 4A24A 2CCMA 2JXCA 1ULKA 3IQOA 4AOMA 4E1PA 3OB2B 3CR5X 4FKDA 3K21A 4R1EA 4CIDA 1B4CA 2A20A 2JNFA 1S5GY 1JBAA 3EK7A 2K7BA 1LA0A 4MPIA 1PULA 1KSOA 3PN7B 1BG1A 2LC5A 3FSXA 1J7RA 3IQQA 3B88A 1M31A 1CGJI 1TUSA 1K96A 1NX1A 1U5IB 1CDMA 5CSNA 4JQ0D 2V1CA 4HREE 4E68A 3VDUA 1K93D 2JPOA 3EK8A 5FUYA 1CNPA 4I5NB 3NSOA 1SGQI 1GM0A 1YVLA 1WY9A 1KWOB 1QVIY 2HF5A 1MHOA 2JW6A 1LXFC 1XVJA 3EVRA 3OXLA 1DJIA 2RIJA 1EG3A 3C1VA 2CBLA 2NU3I 3CS1A 3VRRA 4NDDA 2LLSA 5FI7A 1SCMC 2NZ0A 2WC8A 1DJZA 2JZIA 2MHHA 3BFAA 2O60A 4OZDA 2PALA 1G8IA 2HQWA 2Y1MA 1S20A 2KAXA 1ULMA 2GKRI 2K7OA 1BR4B 1QLKA 1T14A 3NSKA 1XFRA 2Y1NA 1CFDA 2K8MB 2O5GA 1DS2I 1V1IA 2M29A 2TN4A 1XFXO 2BCAA 4DS7A 5KSZA 4ICBA 3R1VA 3SIAA 1AVSA 3GK2A 1HPTA 2SGQI 4MZJA 2ORWA 2PQLA 1VDDA 4GGFC 5EX3A 4GUKA 2KGBC 1OW4A 4INXA 1W4RA 1SPYA 3CLNA 2H61C 4JKTA 2MAZA 1YRUB 2GGZA 1S3PA 1SCMB 2M8UA 1BJFA 2M3WA 1YURA 1YRTB 2SASA 5FI6A 3Q8IA 1RECA 3DVMA 1LVCD 1XO5A 1NX2A 2K0JA 3SG7A 2LP3A 1LR8A 2ODDA 1QASA 2Q4UA 1CLBA 4WQ2A 1CGII 1KBFA 1MUXA 1EL4A 2IS9A 5HYDA 4MZLA 2K2AA 5ER4X 1QTXA 3CZ2A 2JWWA 4I5LB 1QATA 1OOJA 5FI2A 4YGAA 1EG4A 1K9UA 1J7OA 2M7LA 1DMOA 1JF0A 2CWFA 1ZUZA 2KBIA 1JF2A 1ODBA 2LLTA 3MSEB 1A4PA 2G2BA 4ZCVA 1CLLA 1P9ZA 2P6AC 4JPZB 2I2RE 3IF7A 3SGQI 2PQ8A 1NX3A 4IJ7A 1J7PA 1BUSA 1NSHA 2BE4A 1ALVA 3CR2A 3S0FA 1VRKA 2ZFDA 1AJ4A 1SGRI 1UUSA 2WNDA 1S26D 3DVJA 1B47A 1JFKA 1IY6A 4P2YB 2F8PA 4QJ4B 4C0JA 1K9KA 1Z7KB 2LAPA 4YI9A 2N1AB 1OZSA 1TBOA 1HDLA 2WCYA 1CB1A 1FI5A 4YGCB 2SGEI 1DJYA 1YTZC 2YGUA 4U8DA 3EVUA 4CFQA 3D74A 4MRXA 1K7TA 1OMUA 1Y1BA 2BCBA 4PCWA 2SCPA 1WKXA 2ENZA 2QQDA 3E2IA 2M0RA 1M39A 1NCYA 1W7JB 2E30A 5EL2A 4I5JA 1K2HA 3KPXA 3O6BA 1DTLA 2GV5A 5B8IB 1U5IA 3L4AA 9WGAA 1OMRA 1B8LA 2BKHB 3PSRA 4DRWA 1HQVA 1X02A 1OMDA 1DF0B 4M2PA 1B8RA 1SK6D 2BCXA 5PALA 3CXLA 2L2EA 2DKVA 2E6WA 3BOWB 5AANA 1MJBA 3OXFA 1RROA 1OVOA 4A4BA 1BU3A 3I5HC 1TTXA 2F3CI 2ZNDA 3ZNIA 1UHAA 2COLB 1A75A 1FPWA 3FS7A 3OXGA 2A4JA 2ENNA 5I2QA 3PFVA 1Q9BA 2OVOA 3RM1A 1IKUA 1DJWA 2YUUA 2KGRA 1H4BA 1J7QA 3TDZA 3I5GC 3VROA 2SGPI 1S6IA 3LK1A 4MSPA 4OV2A 3BJHA 5CPVA 1YTPA 4UXHA 4WP4A 1IY5A 2QQCA 3D75A 1QIWA 2JT3A 2BBNA 1LKJA 2KOTA 5G08A 3WNXB 4NQGA 2CTNA 4F0ZB 2OD1A 1ZOTB 2BL0C 2L4HA 3OL0A 3TO7A 3MEKA 3DF0A 1Y1XA 1CFFA 1ZFSA 2VRWB 2PVBA 5I94A 4ETOA 1WTJA 1DVIA 5TNCA 1L2OB 3I5FB 3IVTA 1EXRA 4NDCA 1TGSI 2DB6A 1SMGA 2ZNEA 5K89A 1WRLA 3L47A 1M63B 3A8RA 1J1EA 2WOSA 1FARA 2X3TA 3B4VC 2CJSC 1QIVA 1BOCA 2FOTA 3CWGA 3SS3A 4JWQA 2JT0A 1HT9A 1LS8A 1YX7A 3TZ1A 3EKHA 5AFPA 1B9AA 2KYCA 2ERWA 1SR6B 2KLEA 1ORGA 1UVFA 1TIZA 1SNLA 2QEHA 4HGUA 1Y8FA 2L4IA 1AHRA 2F2OA 1TNPA 3B6XA 2KFHA 3A4UB 1EH2A 4QJ3B 3S0EA 1V1HA 2H8VA 2B0UC 1RTP1 3OBVA 2X52A 4OR9B 1L7ZA 1AN1I 2LEOA 1FYBA 2KI6D 3GOFA 3JTDC 3OP0A 5FUWA 1CM4A 4MLWA 1C7WA 3B87A 2QQEA 1WGCA 3BUNB 3WHUB 3D10A 2KSPA 2NCPA 1RWYA 1MJAA 2QEOA 1JSAA 4N5XA 2Y0MA 1UUCA 5FYXA 1CDLA 1LA3A 1TN4A 3BXKA 4PE4A 4OVOA 3V2LA 1IQ3A 1TCOB 1XA5A 1MJ9A 1BODA 2GVIA 3LK0A 1IG5A 4MEWA 2BAPA 1PTRA 3BJIA 1MWNA 3EVVA 2P6BB 3QAHA 2OU2A 1MF8B 2JRFA 1Y6WA 2HPSA 3SG4A 4BY5A 1OQPA 1K8UA 3I5FC 4MBEA 2CT9A 5HQ8A 1E8AA 3OVOA 3E59A 1N0YA 2N52A 1AJ5A 1KK8B 1TWOA 2E5RA 1TRFA 2Y5IA 2FCEA 3EG5B 3RU0A 2JTZA 2LMVA 2QEBA 1QWVA 1SRAA 3HCMA 1A2XA 2JU0A 5ER5A 1CT4I 5KTYA 3R5AA 3SGBI 2H2KA 1XK4C 2RC4A 3CTNA 2MJWB 3I5GB 3TOAA 4GI3C 1Q80A 3TOBA 2GIVA 2K7CA 2LP2A 2P70A 1G33A 1SGNI 1N2DA 3WXAA 4HSZA 3R5DA 2F3ZA 3FE9A 2CXJA 3ZWHA 2ISDA 1C3ZA 1K95A 1J55A 2KLDA 3D76A 2EC6B 2M97A 3I5HB 3UNWA 3UGDA 1OOFA 1N65A 1OOHA 1YUUA 4PE1A 2QQ0A 2B8TA 2WCFA 5FUXA 3S0AA 3UGIA 3SS5A 1K94A 1UHNA 2LUYA 1SW8A 1IJ5A 1SR6C 2CWGA 2V1CC 1DJHA 3PALA 1JFJA 3UFFA 4GFTA 2M1KB 3AAKA 2WC6A 1BMOA 1UHKA 1KMAA 2WCHA 4USLA 1KFXL 1SGEI 1IRJA 2QEVA 3OHMB 1A29A 5HKWA 4CLNA 1SL9A 2AMIA 1C7VA 1F71A 4C0LA 2OTGC 4UXIA 3FWBA 2I94A 1F4QA 2KAYA 3RLZA 1JWDA 1QV0A 1C3YA 2JA1A 5J8CA 3R1PA 1S1EA 1CKKA 4YGBB 1V1FA 4NDBA 4PDZA 2LVIA 2BECA 2GKTI 2N17A 1Z2IA 5J8FA 3PJIA 1SL8A 2BL0B
chains in the Genus database with same CATH topology
4WQ3A 1QLSA 5CSIA 1TBNA 1B8CA 3HH2C 1PK0D 2MLFC 1KWOC 1CHOI 2K9HA 3CZTX 1KQMB 3UEYA 1TBRR 2JOJA 2KQYA 2ZN8A 5I2LA 3BQ3A 1XFUO 3TS5B 3BYAA 2K2FA 3EK4A 1RK9A 3BOWA 1OMVA 2LMTA 4PE7A 3PN7C 1WLZA 4QJ5B 2NU4I 1MXLC 1LR7A 1MQ1A 3LL8B 1X4SA 1QVIZ 1XYDA 2KDHA 1OMTA 4ORBB 1DJGA 3TS5C 2CNPA 2M9GA 5F6TA 3GK4X 4ORCB 1DGUA 1SGYI 3JVTC 4PHJA 2JQ6A 2MRDA 3UEJA 1DJXA 5JHWC 1UURA 4YI8A 2MBXA 3WHTB 2J9RA 1TNWA 1YUTA 4GGNA 5D69A 1FI6A 5DAEA 1XFYO 2F33A 2JPTA 1B7TZ 2HQ8A 5D7FA 5AERA 3GOXA 1A03A 2JYYA 1M45A 1CT2I 1JUOA 1YUSA 2JTTA 2OTGB 1Y0VH 5HLOA 3TDUA 4A4CA 1IQ5A 1XK4A 2KI4C 1HDLA 2F2PA 2LM5A 1CFPA 2LE9B 1QV1A 2OS8B 1YU6C 1CSOI 2LVKA 2LMUA 2OS8C 3VRPA 2J87A 1YR5A 4PE0A 1A75B 3BUXB 2AAOA 2JULA 1XA6A 1NP8A 5CCMA 1XX6A 3QTLD 2BE6A 2XRCA 2LHIA 5HI7A 1CM1A 3VRQA 1ZMZA 2E73A 2V53A 4I5KA 1TURA 4E1RA 4PHMA 4Q04A 1LR9A 1R2UA 1NWDA 1Y1AA 4OKHA 2BUSA 2LNKA 3AKAA 3VDPA 1TOTA 2NCOA 1K90D 2LUCA 4OCIA 3UGLA 4BY4A 2KI6C 2L51A 2PMYA 3D0YB 2M1UA 3O2PA 1SL7A 3OB1B 1FBVA 1W7IB 2ZRSA 3NSIA 3AKBA 1Y1UA 2KYFA 2WCBA 3FWCA 4YRUA 3OX6A 1F70A 1NX0A 1U5KA 4PHKA 1KK8C 1ZACA 2PASA 1KK7Z 1NIWA 3QRXA 3SJSA 2Q91A 1KQMC 1YVHA 2Y4QA 4DCKA 3E3RA 1ALWA 2JT8A 3I5IB 5I8NA 1K9PA 1N13A 1M46A 1IH0A 3D00A 2LVVA 4MN0A 2LANA 4OVNF 1D1OA 2D8NA 1PPFI 5HLVA 2ROWA 5JOLA 3PATA 2NLNA 2QACA 5GQQC 1G4YR 2PRUA 1R6PA 1NCZA 2HETA 1WRZA 1X74A 2KMOA 1TNXA 2G9BA 3CGAA 4FTGA 2ARPF 3M0WA 1UWOA 4MRYA 2JZMA 2JXDA 1FF1A 1KFUL 3DF0B 2KBMA 1AUIB 1KFUS 2N71A 1BR1B 5AEQA 1KCYA 4JCVE 2NXQA 3KEVA 1MXEA 1QX2A 2KMRA 2I18A 1AP4A 4YGEB 5I2OA 1M8BA 1TOPA 2L50A 1SBJA 1SGDI 5CCLA 1CLMA 1XFZO 1IWQA 2KQ6A 1UHHA 2L5XB 4FQOA 4HRGA 2RGIA 5J3XA 1XBTA 3KHEA 3PM8A 4GNKB 2LLUA 4XJKA 4B6DA 3O78A 2L98A 1UHJA 4CPVA 4L9MA 3TJQA 1WDCB 3F45A 2L7XA 2L8EA 3VRNA 1QX5B 3PDNA 1FW4A 1OZOA 3ICBA 2QPOA 5KU1A 1SYMA 1OYVI 2KCXA 2KMQA 1TBQR 4PALA 1BT6A 1H0ZA 3BUOB 4TNCA 1PVBA 2KAVA 4GBAA 1IJ6A 1B1GA 2OPOA 3TUYC 1F8HA 1PJUA 2YQPA 1PCEA 2JXLA 1KBEA 2NU2I 2SGDI 2FJUB 1S5GZ 1YX8A 2LHLA 2GGMA 2WCEA 4AQIA 1OE9B 3NSLA 1TNQA 1AK8A 1PSBA 1GGZA 5AXIA 3DVEA 2LUXA 2MA2A 4GAOA 3DD4A 2KNEA 2MLEC 3QWPA 1KK7Y 4DIRA 2ORVA 3VGOA 1RFHA 1SKTA 1TIHA 2R2IA 1JC2A 1CT0I 3GK1A 5HKYA 2EC6C 1IGVA 1S6CA 1DS3I 3O4YA 1CTRA 1NCXA 4P5OE 4YBHB 2WVJA 5FUVA 1QX7A 1PALA 1CDPA 1QS7A 3H4SE 5EX0A 1V1GA 4C0KA 3FIAA 2BKIB 1GQMA 1J1DA 1KSMA 1WRKA 2B1UA 4AQJA 1UP5A 4MZKA 2F3YA 1CFCA 2SGFI 3VE5A 4UXJA 1GGWA 5JJGA 2I7AA 2LV7A 5HKZA 2W0TA 3EKJA 3TUYB 2K61A 2ZN9A 4CFRA 1KQVA 4GPLB 3AAJA 2H61A 1DGVA 5DKNA 2M49B 1LINA 3KO0A 4WRIA 1OSAA 1L2OC 3SG3A 1RJVA 4GGFA 2NU0I 2ELIA 1B7TY 2M7NA 1F55A 1MT1A 2EHBA 4D1EA 4XYNA 1F4OA 1RFJA 1WDCC 2LVJA 1WLMA 2L0PA 1H8BA 2UZ3A 1UHIA 3SG2A 2KMPA 3BUMB 1EJ3A 4UPGA 1CMGA 3SEKC 3FC3A 1MR8A 3HX4A 1PRWA 2M5XA 3D0YA 3DVKA 1F54A 1PTQA 3TDIA 1S36A 4ZCUA 1NYAA 1Y1CA 3JTDB 1CDNA 2KHNA 3LCPC 2PSRA 1SCVA 2WORA 5CSFA 5IBWA 1PSRA 2AUCA 1M8CA 2K7DA 2ZRTA 3OX5A 1CE3A 1TCFA 4DUQA 2NU1I 2KFFA 4M2QA 1C07A 1CMFA 3KY9A 1DF0A 1NUBA 4M2OA 4PHNA 1DT7B 1GJYA 1BF5A 1HJAI 4ORAB 4N1GA 3SIBA 1R0RI 2FCDA 4IL1A 2GKVA 1QJTA 3SG6A 1NPQA 2BBMA 2EGDA 4XJKB 1UVGA 1S6JA 3BUWB 3NXAA 1IW4A 1PVAA 4N1FA 1KFXS 3I5IC 3SG5A 2DOQA 2KI4B 1SGPI 5BPJA 1QXPA 2KFGA 3PLFB 2FNFX 1XFWO 4YGDB 1XFVO 4HRHA 2JC2A 1FAQA 3CR4X 2QPTA 2LCPA 5CSJA 5DKQA 4MVFA 1BLQA 1W3SA 2JNXA 2DIPA 4SGBI 2VRGA 2ZKMX 3LLEA 3JVTB 3KF9A 1SY9A 5DKRA 2CCMA 2JXCA 3IQOA 4AOMA 4E1PA 3OB2B 3CR5X 4FKDA 3K21A 4R1EA 4CIDA 1B4CA 2A20A 2JNFA 1S5GY 1JBAA 3EK7A 2K7BA 1LA0A 1PULA 1KSOA 3PN7B 1BG1A 2LC5A 1J7RA 3IQQA 1CGJI 1M31A 1TUSA 1K96A 1NX1A 1U5IB 1CDMA 5CSNA 4JQ0D 2V1CA 4HREE 4E68A 3VDUA 1K93D 3EK8A 5FUYA 1CNPA 4I5NB 3NSOA 1SGQI 1YVLA 1WY9A 1KWOB 1QVIY 2HF5A 1MHOA 2JW6A 1LXFC 1XVJA 3EVRA 3OXLA 1DJIA 1EG3A 3C1VA 2CBLA 2NU3I 3CS1A 3VRRA 4NDDA 2LLSA 1SCMC 2NZ0A 2WC8A 1DJZA 2JZIA 2MHHA 2O60A 2PALA 1G8IA 2HQWA 2Y1MA 2KAXA 2GKRI 2K7OA 1BR4B 1QLKA 3NSKA 2Y1NA 1CFDA 2K8MB 2O5GA 1DS2I 1V1IA 2M29A 2TN4A 1XFXO 2BCAA 4DS7A 5KSZA 4ICBA 1HPTA 3SIAA 1AVSA 3GK2A 2SGQI 4MZJA 2ORWA 1VDDA 4GGFC 5EX3A 4GUKA 2KGBC 1W4RA 1SPYA 3CLNA 2H61C 2MAZA 1YRUB 2GGZA 1S3PA 1SCMB 2M8UA 1BJFA 2M3WA 1YURA 1YRTB 2SASA 1RECA 3DVMA 1LVCD 1XO5A 1NX2A 2K0JA 3SG7A 2LP3A 1LR8A 2ODDA 1QASA 2Q4UA 1CLBA 4WQ2A 1CGII 1KBFA 1MUXA 1EL4A 2IS9A 5HYDA 4MZLA 2K2AA 5ER4X 1QTXA 2JWWA 4I5LB 1QATA 1OOJA 4YGAA 1EG4A 1K9UA 1J7OA 2M7LA 1DMOA 1JF0A 1ZUZA 2KBIA 1JF2A 1ODBA 2LLTA 3MSEB 1A4PA 2G2BA 4ZCVA 1CLLA 2P6AC 4JPZB 2I2RE 3IF7A 3SGQI 1NX3A 1J7PA 1BUSA 1NSHA 2BE4A 1ALVA 3CR2A 1VRKA 2ZFDA 1AJ4A 1SGRI 1UUSA 2WNDA 1S26D 3DVJA 1B47A 1JFKA 1IY6A 4P2YB 2F8PA 4QJ4B 4C0JA 1K9KA 1Z7KB 2LAPA 4YI9A 2N1AB 1OZSA 1TBOA 2WCYA 1CB1A 1FI5A 4YGCB 2SGEI 1DJYA 1YTZC 4U8DA 3EVUA 4CFQA 4MRXA 1OMUA 1Y1BA 2BCBA 4PCWA 2SCPA 2ENZA 2QQDA 3E2IA 2M0RA 1M39A 1NCYA 1W7JB 2E30A 4I5JA 1K2HA 3KPXA 3O6BA 1DTLA 2GV5A 5B8IB 1U5IA 1OMRA 1B8LA 2BKHB 3PSRA 4DRWA 1HQVA 1X02A 1OMDA 1DF0B 4M2PA 1B8RA 1SK6D 2BCXA 5PALA 3CXLA 2L2EA 2E6WA 3BOWB 5AANA 3OXFA 1RROA 1OVOA 4A4BA 1BU3A 3I5HC 1TTXA 2F3CI 2ZNDA 3ZNIA 2COLB 1A75A 1FPWA 3FS7A 3OXGA 2A4JA 2ENNA 5I2QA 3PFVA 2OVOA 3RM1A 1IKUA 1DJWA 2YUUA 2KGRA 1H4BA 1J7QA 3TDZA 3I5GC 3VROA 2SGPI 1S6IA 3LK1A 4MSPA 4OV2A 5CPVA 1YTPA 4UXHA 1IY5A 2QQCA 1QIWA 2JT3A 2BBNA 1LKJA 2KOTA 5G08A 3WNXB 4NQGA 2CTNA 4F0ZB 2OD1A 1ZOTB 2BL0C 2L4HA 3OL0A 3MEKA 3DF0A 1Y1XA 1CFFA 1ZFSA 2VRWB 2PVBA 4ETOA 1DVIA 5TNCA 1L2OB 3I5FB 4NDCA 1EXRA 1TGSI 2DB6A 1SMGA 2ZNEA 5K89A 1WRLA 1M63B 3A8RA 1J1EA 2WOSA 1FARA 3B4VC 2CJSC 1QIVA 1BOCA 2FOTA 3CWGA 4JWQA 2JT0A 1HT9A 1YX7A 3TZ1A 3EKHA 5AFPA 1B9AA 2KYCA 2ERWA 1SR6B 1UVFA 1TIZA 1SNLA 4HGUA 1Y8FA 2L4IA 1AHRA 2F2OA 1TNPA 1EH2A 2KFHA 3A4UB 1V1HA 4QJ3B 2B0UC 1RTP1 4OR9B 1L7ZA 1AN1I 2LEOA 1FYBA 2KI6D 3GOFA 3JTDC 3OP0A 5FUWA 1CM4A 4MLWA 1C7WA 2QQEA 3BUNB 3WHUB 3D10A 2KSPA 2NCPA 1RWYA 1JSAA 4N5XA 1UUCA 5FYXA 1CDLA 1LA3A 1TN4A 3BXKA 4PE4A 4OVOA 1IQ3A 1TCOB 1XA5A 2GVIA 1BODA 3LK0A 1IG5A 4MEWA 1PTRA 3BJIA 1MWNA 3EVVA 2P6BB 1MF8B 2JRFA 1Y6WA 2HPSA 3SG4A 4BY5A 1OQPA 1K8UA 3I5FC 4MBEA 2CT9A 5HQ8A 1E8AA 3OVOA 3E59A 1N0YA 2N52A 1AJ5A 1KK8B 2E5RA 1TRFA 2Y5IA 2FCEA 3RU0A 2JTZA 2LMVA 1R79A 1SRAA 3HCMA 5ER5A 1A2XA 2JU0A 1CT4I 3SGBI 5KTYA 3UFFA 2H2KA 1XK4C 3CTNA 2MJWB 3I5GB 4GI3C 1Q80A 2K7CA 2LP2A 1G33A 1SGNI 1N2DA 3WXAA 4HSZA 2F3ZA 3ZWHA 2CXJA 2ISDA 1K95A 1J55A 3I5HB 2EC6B 2M97A 3UGDA 1N65A 1YUUA 4PE1A 2QQ0A 2B8TA 2WCFA 5FUXA 3UGIA 1K94A 1UHNA 2LUYA 1SW8A 1IJ5A 1SR6C 2V1CC 1DJHA 3PALA 1JFJA 4GFTA 2M1KB 3AAKA 1BMOA 1UHKA 1KMAA 4USLA 1KFXL 1SGEI 1IRJA 3OHMB 5HKWA 1A29A 4CLNA 1SL9A 2AMIA 1C7VA 1F71A 4C0LA 2OTGC 4UXIA 3FWBA 2I94A 1F4QA 2KAYA 3RLZA 1JWDA 1QV0A 2JA1A 1S1EA 1CKKA 4YGBB 1V1FA 4NDBA 4PDZA 2LVIA 2BECA 2GKTI 2N17A 4A24A 1SL8A 2BL0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQ3 A;  1QLS A;  5CSI A;  1B8C A;  3HH2 C;  1PK0 D;  2MLF C;  1KWO C;  1CHO I;  3CZT X;  1KQM B;  1TBR R;  2JOJ A;  2KQY A;  2ZN8 A;  5I2L A;  3BQ3 A;  1XFU O;  3TS5 B;  3BYA A;  2K2F A;  3EK4 A;  1RK9 A;  3BOW A;  1OMV A;  2LMT A;  4PE7 A;  3PN7 C;  1WLZ A;  4QJ5 B;  2NU4 I;  1MXL C;  1LR7 A;  1MQ1 A;  3LL8 B;  1QVI Z;  1XYD A;  2KDH A;  1OMT A;  4ORB B;  1DJG A;  3TS5 C;  2CNP A;  2M9G A;  5F6T A;  3GK4 X;  4ORC B;  1DGU A;  1SGY I;  3JVT C;  4PHJ A;  2JQ6 A;  2MRD A;  1DJX A;  5JHW C;  1UUR A;  4YI8 A;  2MBX A;  3WHT B;  1TNW A;  1YUT A;  4GGN A;  5D69 A;  1FI6 A;  5DAE A;  1XFY O;  2F33 A;  2JPT A;  1B7T Z;  2HQ8 A;  5D7F A;  5AER A;  1A03 A;  2JYY A;  1M45 A;  1CT2 I;  1JUO A;  1YUS A;  2JTT A;  2OTG B;  1Y0V H;  5HLO A;  3TDU A;  4A4C A;  1IQ5 A;  1XK4 A;  2KI4 C;  2F2P A;  2LM5 A;  1CFP A;  2LE9 B;  1QV1 A;  2OS8 B;  1YU6 C;  1CSO I;  2LVK A;  2LMU A;  2OS8 C;  3VRP A;  1YR5 A;  4PE0 A;  1A75 B;  3BUX B;  2AAO A;  2JUL A;  1NP8 A;  3QTL D;  2BE6 A;  2XRC A;  2LHI A;  1CM1 A;  3VRQ A;  1ZMZ A;  2V53 A;  4I5K A;  1TUR A;  4PHM A;  4Q04 A;  1LR9 A;  1R2U A;  1NWD A;  1Y1A A;  4OKH A;  2BUS A;  2LNK A;  3AKA A;  2NCO A;  1K90 D;  2LUC A;  4OCI A;  4BY4 A;  2KI6 C;  2L51 A;  2PMY A;  3D0Y B;  2M1U A;  3O2P A;  1SL7 A;  3OB1 B;  1FBV A;  1W7I B;  2ZRS A;  3NSI A;  3AKB A;  1Y1U A;  2KYF A;  2WCB A;  3FWC A;  4YRU A;  3OX6 A;  1F70 A;  1NX0 A;  4PHK A;  1KK8 C;  1ZAC A;  2PAS A;  1KK7 Z;  1NIW A;  3QRX A;  3SJS A;  2Q91 A;  1KQM C;  1YVH A;  2Y4Q A;  4DCK A;  3E3R A;  1ALW A;  2JT8 A;  3I5I B;  5I8N A;  1K9P A;  1N13 A;  1M46 A;  1IH0 A;  2LVV A;  4MN0 A;  2LAN A;  4OVN F;  1D1O A;  2D8N A;  1PPF I;  5HLV A;  5JOL A;  3PAT A;  2NLN A;  2QAC A;  5GQQ C;  1G4Y R;  2PRU A;  1R6P A;  1NCZ A;  2HET A;  1WRZ A;  2KMO A;  1TNX A;  2G9B A;  3CGA A;  4FTG A;  2ARP F;  3M0W A;  1UWO A;  4MRY A;  2JZM A;  2JXD A;  1FF1 A;  1KFU L;  3DF0 B;  2KBM A;  1AUI B;  1KFU S;  2N71 A;  1BR1 B;  5AEQ A;  1KCY A;  2NXQ A;  3KEV A;  1MXE A;  1QX2 A;  2KMR A;  2I18 A;  1AP4 A;  4YGE B;  5I2O A;  1M8B A;  1TOP A;  2L50 A;  1SBJ A;  1SGD I;  1CLM A;  1XFZ O;  1IWQ A;  2KQ6 A;  1UHH A;  2L5X B;  4FQO A;  4HRG A;  2RGI A;  5J3X A;  3KHE A;  3PM8 A;  4GNK B;  2LLU A;  4XJK A;  3O78 A;  2L98 A;  1UHJ A;  4CPV A;  4L9M A;  3TJQ A;  1WDC B;  3F45 A;  3VRN A;  1QX5 B;  1FW4 A;  1OZO A;  3ICB A;  5KU1 A;  1SYM A;  1OYV I;  2KCX A;  2KMQ A;  1TBQ R;  4PAL A;  1BT6 A;  1H0Z A;  3BUO B;  4TNC A;  1PVB A;  2KAV A;  4GBA A;  1IJ6 A;  1B1G A;  2OPO A;  3TUY C;  1F8H A;  1PJU A;  1PCE A;  2JXL A;  2NU2 I;  2SGD I;  2FJU B;  1S5G Z;  1YX8 A;  2LHL A;  2GGM A;  2WCE A;  4AQI A;  1OE9 B;  3NSL A;  1TNQ A;  1AK8 A;  1PSB A;  1GGZ A;  5AXI A;  3DVE A;  2LUX A;  2MA2 A;  4GAO A;  3DD4 A;  2KNE A;  2MLE C;  1KK7 Y;  4DIR A;  3VGO A;  1SKT A;  1TIH A;  2R2I A;  1JC2 A;  1CT0 I;  3GK1 A;  5HKY A;  2EC6 C;  1IGV A;  1S6C A;  1DS3 I;  3O4Y A;  1CTR A;  1NCX A;  4P5O E;  4YBH B;  1QX7 A;  1PAL A;  1CDP A;  1QS7 A;  3H4S E;  1V1G A;  4C0K A;  3FIA A;  2BKI B;  1GQM A;  1J1D A;  1KSM A;  1WRK A;  2B1U A;  4AQJ A;  1UP5 A;  4MZK A;  2F3Y A;  1CFC A;  2SGF I;  1GGW A;  5JJG A;  2I7A A;  2LV7 A;  5HKZ A;  3EKJ A;  3TUY B;  2K61 A;  2ZN9 A;  4CFR A;  1KQV A;  4GPL B;  3AAJ A;  2H61 A;  1DGV A;  5DKN A;  2M49 B;  1LIN A;  3KO0 A;  4WRI A;  1OSA A;  1L2O C;  3SG3 A;  1RJV A;  4GGF A;  2NU0 I;  1B7T Y;  2M7N A;  1F55 A;  1MT1 A;  2EHB A;  4D1E A;  4XYN A;  1F4O A;  1RFJ A;  1WDC C;  2LVJ A;  1WLM A;  2L0P A;  1H8B A;  1UHI A;  3SG2 A;  2KMP A;  3BUM B;  1EJ3 A;  4UPG A;  1CMG A;  3SEK C;  1MR8 A;  3HX4 A;  1PRW A;  2M5X A;  3D0Y A;  3DVK A;  1F54 A;  3TDI A;  1S36 A;  4ZCU A;  1NYA A;  1Y1C A;  3JTD B;  1CDN A;  2KHN A;  3LCP C;  2PSR A;  1SCV A;  2WOR A;  5CSF A;  5IBW A;  1PSR A;  2AUC A;  1M8C A;  2K7D A;  2ZRT A;  3OX5 A;  1CE3 A;  1TCF A;  4DUQ A;  2NU1 I;  2KFF A;  4M2Q A;  1C07 A;  1CMF A;  1DF0 A;  1NUB A;  4M2O A;  4PHN A;  1DT7 B;  1GJY A;  1BF5 A;  1HJA I;  4ORA B;  4N1G A;  3SIB A;  1R0R I;  2FCD A;  4IL1 A;  2GKV A;  1QJT A;  3SG6 A;  1NPQ A;  2BBM A;  2EGD A;  4XJK B;  1UVG A;  1S6J A;  3BUW B;  3NXA A;  1IW4 A;  1PVA A;  4N1F A;  1KFX S;  3I5I C;  3SG5 A;  2DOQ A;  2KI4 B;  1SGP I;  5BPJ A;  1QXP A;  2KFG A;  3PLF B;  1XFW O;  4YGD B;  1XFV O;  4HRH A;  2JC2 A;  3CR4 X;  2QPT A;  2LCP A;  5CSJ A;  5DKQ A;  4MVF A;  1BLQ A;  2JNX A;  4SGB I;  2VRG A;  2ZKM X;  3LLE A;  3JVT B;  3KF9 A;  1SY9 A;  5DKR A;  2CCM A;  2JXC A;  3IQO A;  4AOM A;  3OB2 B;  3CR5 X;  3K21 A;  4R1E A;  4CID A;  1B4C A;  2JNF A;  1S5G Y;  1JBA A;  3EK7 A;  2K7B A;  1LA0 A;  1PUL A;  1KSO A;  3PN7 B;  1BG1 A;  2LC5 A;  1J7R A;  3IQQ A;  1CGJ I;  1M31 A;  1TUS A;  1K96 A;  1NX1 A;  1U5I B;  1CDM A;  5CSN A;  4JQ0 D;  4HRE E;  4E68 A;  1K93 D;  3EK8 A;  1CNP A;  4I5N B;  3NSO A;  1SGQ I;  1YVL A;  1WY9 A;  1KWO B;  1QVI Y;  2HF5 A;  1MHO A;  1LXF C;  1XVJ A;  3EVR A;  1DJI A;  1EG3 A;  3C1V A;  2CBL A;  2NU3 I;  3CS1 A;  3VRR A;  4NDD A;  2LLS A;  1SCM C;  2NZ0 A;  2WC8 A;  1DJZ A;  2JZI A;  2MHH A;  2O60 A;  2PAL A;  1G8I A;  2HQW A;  2Y1M A;  2KAX A;  2GKR I;  2K7O A;  1BR4 B;  1QLK A;  3NSK A;  2Y1N A;  1CFD A;  2K8M B;  2O5G A;  1DS2 I;  2M29 A;  2TN4 A;  1XFX O;  2BCA A;  4DS7 A;  5KSZ A;  4ICB A;  1HPT A;  3SIA A;  1AVS A;  3GK2 A;  2SGQ I;  4MZJ A;  4GGF C;  4GUK A;  2KGB C;  1SPY A;  3CLN A;  2H61 C;  2MAZ A;  1YRU B;  2GGZ A;  1S3P A;  1SCM B;  2M8U A;  1BJF A;  2M3W A;  1YUR A;  1YRT B;  2SAS A;  1REC A;  3DVM A;  1LVC D;  1XO5 A;  1NX2 A;  2K0J A;  3SG7 A;  2LP3 A;  1LR8 A;  1QAS A;  2Q4U A;  1CLB A;  4WQ2 A;  1CGI I;  1MUX A;  1EL4 A;  2IS9 A;  5HYD A;  4MZL A;  2K2A A;  5ER4 X;  1QTX A;  2JWW A;  4I5L B;  1QAT A;  1OOJ A;  4YGA A;  1EG4 A;  1K9U A;  1J7O A;  2M7L A;  1DMO A;  1JF0 A;  1ZUZ A;  2KBI A;  1JF2 A;  1ODB A;  2LLT A;  3MSE B;  1A4P A;  2G2B A;  4ZCV A;  1CLL A;  2P6A C;  4JPZ B;  2I2R E;  3IF7 A;  3SGQ I;  1NX3 A;  1J7P A;  1BUS A;  1NSH A;  2BE4 A;  1ALV A;  3CR2 A;  1VRK A;  2ZFD A;  1AJ4 A;  1SGR I;  1UUS A;  2WND A;  1S26 D;  3DVJ A;  1B47 A;  1JFK A;  1IY6 A;  4P2Y B;  2F8P A;  4QJ4 B;  4C0J A;  1K9K A;  1Z7K B;  2LAP A;  4YI9 A;  1OZS A;  2WCY A;  1CB1 A;  1FI5 A;  4YGC B;  2SGE I;  1DJY A;  1YTZ C;  4U8D A;  3EVU A;  4CFQ A;  4MRX A;  1OMU A;  1Y1B A;  2BCB A;  4PCW A;  2SCP A;  2QQD A;  2M0R A;  1M39 A;  1NCY A;  1W7J B;  2E30 A;  4I5J A;  1K2H A;  3KPX A;  3O6B A;  1DTL A;  2GV5 A;  5B8I B;  1U5I A;  1OMR A;  1B8L A;  2BKH B;  3PSR A;  4DRW A;  1HQV A;  1X02 A;  1OMD A;  1DF0 B;  4M2P A;  1B8R A;  1SK6 D;  2BCX A;  5PAL A;  2L2E A;  2E6W A;  3BOW B;  5AAN A;  1RRO A;  1OVO A;  4A4B A;  1BU3 A;  3I5H C;  1TTX A;  2F3C I;  2ZND A;  3ZNI A;  2COL B;  1A75 A;  1FPW A;  3FS7 A;  2A4J A;  5I2Q A;  3PFV A;  2OVO A;  3RM1 A;  1IKU A;  1DJW A;  2KGR A;  1H4B A;  1J7Q A;  3TDZ A;  3I5G C;  3VRO A;  2SGP I;  1S6I A;  3LK1 A;  4MSP A;  4OV2 A;  5CPV A;  1YTP A;  1HDL A;  1IY5 A;  2QQC A;  1QIW A;  2JT3 A;  2BBN A;  1LKJ A;  2KOT A;  5G08 A;  3WNX B;  4NQG A;  2CTN A;  4F0Z B;  1ZOT B;  2BL0 C;  2L4H A;  3DF0 A;  1Y1X A;  1CFF A;  1ZFS A;  2PVB A;  4ETO A;  1DVI A;  5TNC A;  1L2O B;  3I5F B;  4NDC A;  1EXR A;  1TGS I;  1SMG A;  2ZNE A;  5K89 A;  1WRL A;  1M63 B;  3A8R A;  1J1E A;  2WOS A;  3B4V C;  1QIV A;  1BOC A;  2FOT A;  3CWG A;  4JWQ A;  2JT0 A;  1HT9 A;  1YX7 A;  3TZ1 A;  3EKH A;  5AFP A;  1B9A A;  2KYC A;  2ERW A;  1SR6 B;  1UVF A;  1TIZ A;  1SNL A;  4HGU A;  2L4I A;  1AHR A;  2F2O A;  1TNP A;  1EH2 A;  2KFH A;  3A4U B;  2B0U C;  4QJ3 B;  1RTP 1;  4OR9 B;  1L7Z A;  1AN1 I;  2LEO A;  1FYB A;  2KI6 D;  3GOF A;  3JTD C;  3OP0 A;  1CM4 A;  4MLW A;  1C7W A;  3BUN B;  3WHU B;  3D10 A;  2KSP A;  2NCP A;  1RWY A;  1JSA A;  4N5X A;  1UUC A;  5FYX A;  1CDL A;  1LA3 A;  1TN4 A;  3BXK A;  4PE4 A;  4OVO A;  1IQ3 A;  1TCO B;  1XA5 A;  1BOD A;  3LK0 A;  1IG5 A;  4MEW A;  1MWN A;  3EVV A;  2P6B B;  1MF8 B;  2JRF A;  1Y6W A;  2HPS A;  3SG4 A;  4BY5 A;  1OQP A;  1K8U A;  3I5F C;  4MBE A;  2CT9 A;  1E8A A;  3OVO A;  1N0Y A;  2N52 A;  1AJ5 A;  1KK8 B;  1TRF A;  2Y5I A;  2FCE A;  2JTZ A;  2LMV A;  1SRA A;  3HCM A;  5ER5 A;  1A2X A;  2JU0 A;  1CT4 I;  3SGB I;  5KTY A;  2H2K A;  1XK4 C;  3CTN A;  2MJW B;  3I5G B;  4GI3 C;  1Q80 A;  2K7C A;  2LP2 A;  1G33 A;  1SGN I;  1N2D A;  3WXA A;  4HSZ A;  2F3Z A;  3ZWH A;  2CXJ A;  2ISD A;  1K95 A;  1J55 A;  3I5H B;  2EC6 B;  2M97 A;  1N65 A;  1YUU A;  4PE1 A;  2WCF A;  1K94 A;  1UHN A;  1SW8 A;  1IJ5 A;  1SR6 C;  1DJH A;  3PAL A;  1JFJ A;  4GFT A;  2M1K B;  3AAK A;  1BMO A;  1UHK A;  1KMA A;  4USL A;  1KFX L;  1SGE I;  1IRJ A;  3OHM B;  5HKW A;  1A29 A;  4CLN A;  1SL9 A;  2AMI A;  1C7V A;  1F71 A;  4C0L A;  2OTG C;  3FWB A;  2I94 A;  1F4Q A;  2KAY A;  3RLZ A;  1JWD A;  1QV0 A;  1S1E A;  1CKK A;  4YGB B;  1V1F A;  4NDB A;  4PDZ A;  2LVI A;  2BEC A;  2GKT I;  2N17 A;  1SL8 A;  2BL0 B; 
#chains in the Genus database with same CATH topology
 4WQ3 A;  1QLS A;  5CSI A;  1TBN A;  1B8C A;  3HH2 C;  1PK0 D;  2MLF C;  1KWO C;  1CHO I;  3NGV A;  3CZT X;  1KQM B;  2K9H A;  3UEY A;  1TBR R;  2JOJ A;  2KQY A;  2ZN8 A;  5I2L A;  3BQ3 A;  1XFU O;  3TS5 B;  3BYA A;  2K2F A;  3EK4 A;  1RK9 A;  3BOW A;  1OMV A;  2LMT A;  4PE7 A;  5DIC A;  3FSY A;  3PN7 C;  1WLZ A;  2ERB A;  3S0D A;  4QJ5 B;  2NU4 I;  1MXL C;  1LR7 A;  3VB1 A;  1MQ1 A;  3LL8 B;  1X4S A;  2GTE A;  1QVI Z;  1XYD A;  2KDH A;  1OMT A;  4ORB B;  1DJG A;  3TS5 C;  1DC1 A;  2CNP A;  2M9G A;  3NHT A;  3GK4 X;  5F6T A;  4ORC B;  1DGU A;  1OOI X;  1SGY I;  3JVT C;  2WCL A;  4PHJ A;  2JQ6 A;  2MRD A;  3UEJ A;  1DJX A;  5JHW C;  1UUR A;  4YI8 A;  2MBX A;  3WHT B;  2J9R A;  3R5B A;  4F7F A;  1TNW A;  1YUT A;  4GGN A;  5D69 A;  1FI6 A;  1P28 A;  1P9G A;  2WCJ A;  5DAE A;  1XFY O;  2F33 A;  2QDI A;  2JPT A;  1B7T Z;  2HQ8 A;  3D78 A;  5D7F A;  5HL1 A;  5AER A;  3GOX A;  1A03 A;  3CAB A;  1M45 A;  2JYY A;  1CT2 I;  1JUO A;  1YUS A;  2JTT A;  2OTG B;  1Y0V H;  5HLO A;  3TDU A;  3UO9 A;  1IQ5 A;  1XK4 A;  2KI4 C;  4A4C A;  5E3P A;  2F2P A;  2LM5 A;  1CFP A;  2LE9 B;  1QV1 A;  2OS8 B;  1YU6 C;  1CSO I;  2LVK A;  2LMU A;  2OS8 C;  3VRP A;  2KPH A;  1YR5 A;  4PE0 A;  1A75 B;  2J87 A;  2L5Y A;  3BUX B;  4JD9 A;  2AAO A;  2JUL A;  1XA6 A;  1NP8 A;  5CCM A;  1XX6 A;  3QTL D;  2BE6 A;  2XRC A;  2LHI A;  2LB7 A;  5HI7 A;  1CM1 A;  3VRQ A;  1ZMZ A;  2E73 A;  2V53 A;  4I5K A;  1TUR A;  4E1R A;  1OOG A;  4PHM A;  5D3O A;  4Q04 A;  1LR9 A;  3L4L A;  1R2U A;  1NWD A;  1Y1A A;  4OKH A;  2BUS A;  3UOE A;  2LNK A;  3AKA A;  3VDP A;  1TOT A;  2NCO A;  1K90 D;  2LUC A;  2WGC A;  4AQI A;  4OCI A;  3UGL A;  4BY4 A;  2KI6 C;  2L51 A;  2PMY A;  3D0Y B;  2M1U A;  3O2P A;  1SL7 A;  4FQT A;  3OB1 B;  1FBV A;  1W7I B;  2ZRS A;  3NSI A;  3AKB A;  3PM2 A;  1Y1U A;  2KYF A;  2WCB A;  3FWC A;  1WGT A;  4YRU A;  3OX6 A;  1F70 A;  3DY9 A;  3FE8 A;  1NX0 A;  1U5K A;  4PHK A;  1KK8 C;  1ZAC A;  2PAS A;  1KK7 Z;  1NIW A;  3OGN A;  2OZU A;  3QRX A;  3SJS A;  2Q91 A;  2WC5 A;  3B7A A;  1KQM C;  1YVH A;  2Y4Q A;  4DCK A;  3E3R A;  1ALW A;  2JT8 A;  3I5I B;  5I8N A;  1K9P A;  1N13 A;  1M46 A;  1IH0 A;  3D00 A;  2LVV A;  4MN0 A;  2LAN A;  4OVN F;  1D1O A;  2D8N A;  1K7U A;  3D77 A;  3SS4 A;  3TO9 A;  1PPF I;  5HLV A;  2ROW A;  1IIO A;  3R72 A;  5JOL A;  7WGA A;  3PAT A;  2NLN A;  2QAC A;  3CZ1 A;  1G4Y R;  2PRU A;  1R6P A;  3CZ0 A;  5GQQ C;  1NCZ A;  2HET A;  1WRZ A;  1X74 A;  2KMO A;  1TNX A;  2G9B A;  1Z4H A;  3CGA A;  4FTG A;  2ARP F;  3M0W A;  1UWO A;  4MRY A;  2JZM A;  2JXD A;  1SSE B;  1FF1 A;  1KFU L;  3DF0 B;  2KBM A;  1AUI B;  1KFU S;  2N71 A;  4PT1 A;  2PYQ A;  3NHI A;  1BR1 B;  5AEQ A;  1KCY A;  4JCV E;  2NXQ A;  3KEV A;  1R79 A;  1MXE A;  1QX2 A;  1Z2C B;  2KMR A;  2I18 A;  1TUJ A;  1AP4 A;  3R5C A;  4YGE B;  5I2O A;  4DNC A;  1M8B A;  1TOP A;  2L50 A;  1SBJ A;  1SGD I;  5CCL A;  1CLM A;  1XFZ O;  1IWQ A;  1K7V A;  2KQ6 A;  1UHH A;  2L5X B;  4FQO A;  4HRG A;  3R1O A;  2RGI A;  5J3X A;  1XBT A;  2FJY A;  3KHE A;  3PM8 A;  4GNK B;  2LLU A;  4XJK A;  4B6D A;  3O78 A;  2L98 A;  1ULN A;  1UHJ A;  4CPV A;  4L9M A;  3TJQ A;  1WDC B;  3F45 A;  2L7X A;  2L8E A;  3RZS A;  3VRN A;  1QX5 B;  3PDN A;  1FW4 A;  1OZO A;  3ICB A;  2QPO A;  5KU1 A;  1SYM A;  1OYV I;  2KCX A;  2KMQ A;  1TBQ R;  4PAL A;  1BT6 A;  1H0Z A;  3BUO B;  4TNC A;  1PVB A;  2KAV A;  4GBA A;  1IJ6 A;  1B1G A;  2OPO A;  3TUY C;  1F8H A;  1PJU A;  2YQP A;  3DYE A;  1PCE A;  2JXL A;  1KBE A;  2NU2 I;  2SGD I;  2FJU B;  1S5G Z;  1YX8 A;  2LHL A;  2GGM A;  2WCE A;  2WCM A;  3BFH A;  1OE9 B;  3CYZ A;  3B86 A;  1TNQ A;  1DEK A;  3BFB A;  3NSL A;  1PSB A;  1GGZ A;  1AK8 A;  1W9Z A;  3S0G A;  5AXI A;  2L2C A;  3DVE A;  2LUX A;  2MA2 A;  3O4X A;  3DD4 A;  2KNE A;  2MLE C;  4GAO A;  4KYN A;  1KK7 Y;  4DIR A;  2ORV A;  3QWP A;  3VGO A;  1RFH A;  1SKT A;  1TIH A;  4INW A;  2R2I A;  1JC2 A;  1CT0 I;  3GK1 A;  5HKY A;  2EC6 C;  1IGV A;  1S6C A;  1DS3 I;  3O4Y A;  1CTR A;  2WCK A;  1NCX A;  4P5O E;  4YBH B;  2WVJ A;  5FUV A;  1QX7 A;  1PAL A;  1CDP A;  1QS7 A;  3H4S E;  5EX0 A;  1V1G A;  4C0K A;  3FIA A;  2BKI B;  1GQM A;  5E3R A;  1J1D A;  1KSM A;  1WRK A;  2B1U A;  4AQJ A;  1UP5 A;  4MZK A;  2F3Y A;  1CFC A;  2SGF I;  3VE5 A;  4UXJ A;  1GGW A;  5JJG A;  2I7A A;  2LV7 A;  5HKZ A;  2W0T A;  3EKJ A;  3TUY B;  2K61 A;  2ZN9 A;  4CFR A;  1KQV A;  4GPL B;  1FY7 A;  3AAJ A;  2H61 A;  1DGV A;  5DKN A;  2M49 B;  1LIN A;  3KO0 A;  4WRI A;  1OSA A;  1L2O C;  3SG3 A;  1RJV A;  4GGF A;  2NU0 I;  2ELI A;  1HEV A;  1B7T Y;  2M7N A;  1F55 A;  1MT1 A;  2EHB A;  4D1E A;  4XYN A;  1F4O A;  1RFJ A;  1WDC C;  2LVJ A;  1WLM A;  2L0P A;  1H8B A;  2UZ3 A;  1UHI A;  3SG2 A;  2KMP A;  3BUM B;  1EJ3 A;  4UPG A;  1CMG A;  4AML A;  3SEK C;  3FC3 A;  1MR8 A;  2BNX A;  1PRW A;  3HX4 A;  2M5X A;  3D0Y A;  3DVK A;  1F54 A;  1PTQ A;  3TDI A;  1S36 A;  3QME A;  4ZCU A;  1NYA A;  1TUZ A;  5E3Q A;  3FE6 A;  3S0B A;  2P71 A;  3N7H A;  1Y1C A;  3JTD B;  1CDN A;  2KHN A;  3LCP C;  2PSR A;  1SCV A;  2WOR A;  5CSF A;  3K1E A;  5IBW A;  1PSR A;  2AUC A;  1M8C A;  1NXU A;  2K60 A;  2K7D A;  2ZRT A;  3OX5 A;  1CE3 A;  1TCF A;  4DUQ A;  1DEL A;  2KFF A;  4M2Q A;  2NU1 I;  1C07 A;  1CMF A;  3KY9 A;  1DF0 A;  1NUB A;  4M2O A;  4PHN A;  1DT7 B;  1GJY A;  1BF5 A;  3DZT A;  4ORA B;  4N1G A;  3SIB A;  1HJA I;  2FCD A;  4IL1 A;  1R0R I;  2GKV A;  1QJT A;  3SG6 A;  1NPQ A;  2BBM A;  2EGD A;  3DXL A;  4XJK B;  1UVG A;  1S6J A;  3BUW B;  3NXA A;  1IW4 A;  3D73 A;  1PVA A;  4N1F A;  1KFX S;  3I5I C;  3SG5 A;  2DOQ A;  2KI4 B;  1DQE A;  1SGP I;  5BPJ A;  1QXP A;  2KFG A;  3PLF B;  2FNF X;  1XFW O;  4YGD B;  1XFV O;  4HRH A;  2JC2 A;  1FAQ A;  3CR4 X;  2QPT A;  2CWH A;  2LCP A;  5CSJ A;  5DKQ A;  4MVF A;  1BLQ A;  1W3S A;  2JNX A;  3CDN A;  2UVO A;  2DIP A;  4SGB I;  2VRG A;  2ZKM X;  3LLE A;  3JVT B;  3KF9 A;  1SY9 A;  3TO6 A;  5DKR A;  4A24 A;  2CCM A;  2JXC A;  1ULK A;  3IQO A;  4AOM A;  4E1P A;  3OB2 B;  3CR5 X;  4FKD A;  3K21 A;  4R1E A;  4CID A;  1B4C A;  2A20 A;  2JNF A;  1S5G Y;  1JBA A;  3EK7 A;  2K7B A;  1LA0 A;  4MPI A;  1PUL A;  1KSO A;  3PN7 B;  1BG1 A;  2LC5 A;  3FSX A;  1J7R A;  3IQQ A;  3B88 A;  1M31 A;  1CGJ I;  1TUS A;  1K96 A;  1NX1 A;  1U5I B;  1CDM A;  5CSN A;  4JQ0 D;  2V1C A;  4HRE E;  4E68 A;  3VDU A;  1K93 D;  2JPO A;  3EK8 A;  5FUY A;  1CNP A;  4I5N B;  3NSO A;  1SGQ I;  1GM0 A;  1YVL A;  1WY9 A;  1KWO B;  1QVI Y;  2HF5 A;  1MHO A;  2JW6 A;  1LXF C;  1XVJ A;  3EVR A;  3OXL A;  1DJI A;  2RIJ A;  1EG3 A;  3C1V A;  2CBL A;  2NU3 I;  3CS1 A;  3VRR A;  4NDD A;  2LLS A;  5FI7 A;  1SCM C;  2NZ0 A;  2WC8 A;  1DJZ A;  2JZI A;  2MHH A;  3BFA A;  2O60 A;  4OZD A;  2PAL A;  1G8I A;  2HQW A;  2Y1M A;  1S20 A;  2KAX A;  1ULM A;  2GKR I;  2K7O A;  1BR4 B;  1QLK A;  1T14 A;  3NSK A;  1XFR A;  2Y1N A;  1CFD A;  2K8M B;  2O5G A;  1DS2 I;  1V1I A;  2M29 A;  2TN4 A;  1XFX O;  2BCA A;  4DS7 A;  5KSZ A;  4ICB A;  3R1V A;  3SIA A;  1AVS A;  3GK2 A;  1HPT A;  2SGQ I;  4MZJ A;  2ORW A;  2PQL A;  1VDD A;  4GGF C;  5EX3 A;  4GUK A;  2KGB C;  1OW4 A;  4INX A;  1W4R A;  1SPY A;  3CLN A;  2H61 C;  4JKT A;  2MAZ A;  1YRU B;  2GGZ A;  1S3P A;  1SCM B;  2M8U A;  1BJF A;  2M3W A;  1YUR A;  1YRT B;  2SAS A;  5FI6 A;  3Q8I A;  1REC A;  3DVM A;  1LVC D;  1XO5 A;  1NX2 A;  2K0J A;  3SG7 A;  2LP3 A;  1LR8 A;  2ODD A;  1QAS A;  2Q4U A;  1CLB A;  4WQ2 A;  1CGI I;  1KBF A;  1MUX A;  1EL4 A;  2IS9 A;  5HYD A;  4MZL A;  2K2A A;  5ER4 X;  1QTX A;  3CZ2 A;  2JWW A;  4I5L B;  1QAT A;  1OOJ A;  5FI2 A;  4YGA A;  1EG4 A;  1K9U A;  1J7O A;  2M7L A;  1DMO A;  1JF0 A;  2CWF A;  1ZUZ A;  2KBI A;  1JF2 A;  1ODB A;  2LLT A;  3MSE B;  1A4P A;  2G2B A;  4ZCV A;  1CLL A;  1P9Z A;  2P6A C;  4JPZ B;  2I2R E;  3IF7 A;  3SGQ I;  2PQ8 A;  1NX3 A;  4IJ7 A;  1J7P A;  1BUS A;  1NSH A;  2BE4 A;  1ALV A;  3CR2 A;  3S0F A;  1VRK A;  2ZFD A;  1AJ4 A;  1SGR I;  1UUS A;  2WND A;  1S26 D;  3DVJ A;  1B47 A;  1JFK A;  1IY6 A;  4P2Y B;  2F8P A;  4QJ4 B;  4C0J A;  1K9K A;  1Z7K B;  2LAP A;  4YI9 A;  2N1A B;  1OZS A;  1TBO A;  1HDL A;  2WCY A;  1CB1 A;  1FI5 A;  4YGC B;  2SGE I;  1DJY A;  1YTZ C;  2YGU A;  4U8D A;  3EVU A;  4CFQ A;  3D74 A;  4MRX A;  1K7T A;  1OMU A;  1Y1B A;  2BCB A;  4PCW A;  2SCP A;  1WKX A;  2ENZ A;  2QQD A;  3E2I A;  2M0R A;  1M39 A;  1NCY A;  1W7J B;  2E30 A;  5EL2 A;  4I5J A;  1K2H A;  3KPX A;  3O6B A;  1DTL A;  2GV5 A;  5B8I B;  1U5I A;  3L4A A;  9WGA A;  1OMR A;  1B8L A;  2BKH B;  3PSR A;  4DRW A;  1HQV A;  1X02 A;  1OMD A;  1DF0 B;  4M2P A;  1B8R A;  1SK6 D;  2BCX A;  5PAL A;  3CXL A;  2L2E A;  2DKV A;  2E6W A;  3BOW B;  5AAN A;  1MJB A;  3OXF A;  1RRO A;  1OVO A;  4A4B A;  1BU3 A;  3I5H C;  1TTX A;  2F3C I;  2ZND A;  3ZNI A;  1UHA A;  2COL B;  1A75 A;  1FPW A;  3FS7 A;  3OXG A;  2A4J A;  2ENN A;  5I2Q A;  3PFV A;  1Q9B A;  2OVO A;  3RM1 A;  1IKU A;  1DJW A;  2YUU A;  2KGR A;  1H4B A;  1J7Q A;  3TDZ A;  3I5G C;  3VRO A;  2SGP I;  1S6I A;  3LK1 A;  4MSP A;  4OV2 A;  3BJH A;  5CPV A;  1YTP A;  4UXH A;  4WP4 A;  1IY5 A;  2QQC A;  3D75 A;  1QIW A;  2JT3 A;  2BBN A;  1LKJ A;  2KOT A;  5G08 A;  3WNX B;  4NQG A;  2CTN A;  4F0Z B;  2OD1 A;  1ZOT B;  2BL0 C;  2L4H A;  3OL0 A;  3TO7 A;  3MEK A;  3DF0 A;  1Y1X A;  1CFF A;  1ZFS A;  2VRW B;  2PVB A;  5I94 A;  4ETO A;  1WTJ A;  1DVI A;  5TNC A;  1L2O B;  3I5F B;  3IVT A;  1EXR A;  4NDC A;  1TGS I;  2DB6 A;  1SMG A;  2ZNE A;  5K89 A;  1WRL A;  3L47 A;  1M63 B;  3A8R A;  1J1E A;  2WOS A;  1FAR A;  2X3T A;  3B4V C;  2CJS C;  1QIV A;  1BOC A;  2FOT A;  3CWG A;  3SS3 A;  4JWQ A;  2JT0 A;  1HT9 A;  1LS8 A;  1YX7 A;  3TZ1 A;  3EKH A;  5AFP A;  1B9A A;  2KYC A;  2ERW A;  1SR6 B;  2KLE A;  1ORG A;  1UVF A;  1TIZ A;  1SNL A;  2QEH A;  4HGU A;  1Y8F A;  2L4I A;  1AHR A;  2F2O A;  1TNP A;  3B6X A;  2KFH A;  3A4U B;  1EH2 A;  4QJ3 B;  3S0E A;  1V1H A;  2H8V A;  2B0U C;  1RTP 1;  3OBV A;  2X52 A;  4OR9 B;  1L7Z A;  1AN1 I;  2LEO A;  1FYB A;  2KI6 D;  3GOF A;  3JTD C;  3OP0 A;  5FUW A;  1CM4 A;  4MLW A;  1C7W A;  3B87 A;  2QQE A;  1WGC A;  3BUN B;  3WHU B;  3D10 A;  2KSP A;  2NCP A;  1RWY A;  1MJA A;  2QEO A;  1JSA A;  4N5X A;  2Y0M A;  1UUC A;  5FYX A;  1CDL A;  1LA3 A;  1TN4 A;  3BXK A;  4PE4 A;  4OVO A;  3V2L A;  1IQ3 A;  1TCO B;  1XA5 A;  1MJ9 A;  1BOD A;  2GVI A;  3LK0 A;  1IG5 A;  4MEW A;  2BAP A;  1PTR A;  3BJI A;  1MWN A;  3EVV A;  2P6B B;  3QAH A;  2OU2 A;  1MF8 B;  2JRF A;  1Y6W A;  2HPS A;  3SG4 A;  4BY5 A;  1OQP A;  1K8U A;  3I5F C;  4MBE A;  2CT9 A;  5HQ8 A;  1E8A A;  3OVO A;  3E59 A;  1N0Y A;  2N52 A;  1AJ5 A;  1KK8 B;  1TWO A;  2E5R A;  1TRF A;  2Y5I A;  2FCE A;  3EG5 B;  3RU0 A;  2JTZ A;  2LMV A;  2QEB A;  1QWV A;  1SRA A;  3HCM A;  1A2X A;  2JU0 A;  5ER5 A;  1CT4 I;  5KTY A;  3R5A A;  3SGB I;  2H2K A;  1XK4 C;  2RC4 A;  3CTN A;  2MJW B;  3I5G B;  3TOA A;  4GI3 C;  1Q80 A;  3TOB A;  2GIV A;  2K7C A;  2LP2 A;  2P70 A;  1G33 A;  1SGN I;  1N2D A;  3WXA A;  4HSZ A;  3R5D A;  2F3Z A;  3FE9 A;  2CXJ A;  3ZWH A;  2ISD A;  1C3Z A;  1K95 A;  1J55 A;  2KLD A;  3D76 A;  2EC6 B;  2M97 A;  3I5H B;  3UNW A;  3UGD A;  1OOF A;  1N65 A;  1OOH A;  1YUU A;  4PE1 A;  2QQ0 A;  2B8T A;  2WCF A;  5FUX A;  3S0A A;  3UGI A;  3SS5 A;  1K94 A;  1UHN A;  2LUY A;  1SW8 A;  1IJ5 A;  1SR6 C;  2CWG A;  2V1C C;  1DJH A;  3PAL A;  1JFJ A;  3UFF A;  4GFT A;  2M1K B;  3AAK A;  2WC6 A;  1BMO A;  1UHK A;  1KMA A;  2WCH A;  4USL A;  1KFX L;  1SGE I;  1IRJ A;  2QEV A;  3OHM B;  1A29 A;  5HKW A;  4CLN A;  1SL9 A;  2AMI A;  1C7V A;  1F71 A;  4C0L A;  2OTG C;  4UXI A;  3FWB A;  2I94 A;  1F4Q A;  2KAY A;  3RLZ A;  1JWD A;  1QV0 A;  1C3Y A;  2JA1 A;  5J8C A;  3R1P A;  1S1E A;  1CKK A;  4YGB B;  1V1F A;  4NDB A;  4PDZ A;  2LVI A;  2BEC A;  2GKT I;  2N17 A;  1Z2I A;  5J8F A;  3PJI A;  1SL8 A;  2BL0 B; 
#chains in the Genus database with same CATH homology
 4WQ3 A;  1QLS A;  5CSI A;  1TBN A;  1B8C A;  3HH2 C;  1PK0 D;  2MLF C;  1KWO C;  1CHO I;  2K9H A;  3CZT X;  1KQM B;  3UEY A;  1TBR R;  2JOJ A;  2KQY A;  2ZN8 A;  5I2L A;  3BQ3 A;  1XFU O;  3TS5 B;  3BYA A;  2K2F A;  3EK4 A;  1RK9 A;  3BOW A;  1OMV A;  2LMT A;  4PE7 A;  3PN7 C;  1WLZ A;  4QJ5 B;  2NU4 I;  1MXL C;  1LR7 A;  1MQ1 A;  3LL8 B;  1X4S A;  1QVI Z;  1XYD A;  2KDH A;  1OMT A;  4ORB B;  1DJG A;  3TS5 C;  2CNP A;  2M9G A;  5F6T A;  3GK4 X;  4ORC B;  1DGU A;  1SGY I;  3JVT C;  4PHJ A;  2JQ6 A;  2MRD A;  3UEJ A;  1DJX A;  5JHW C;  1UUR A;  4YI8 A;  2MBX A;  3WHT B;  2J9R A;  1TNW A;  1YUT A;  4GGN A;  5D69 A;  1FI6 A;  5DAE A;  1XFY O;  2F33 A;  2JPT A;  1B7T Z;  2HQ8 A;  5D7F A;  5AER A;  3GOX A;  1A03 A;  2JYY A;  1M45 A;  1CT2 I;  1JUO A;  1YUS A;  2JTT A;  2OTG B;  1Y0V H;  5HLO A;  3TDU A;  4A4C A;  1IQ5 A;  1XK4 A;  2KI4 C;  1HDL A;  2F2P A;  2LM5 A;  1CFP A;  2LE9 B;  1QV1 A;  2OS8 B;  1YU6 C;  1CSO I;  2LVK A;  2LMU A;  2OS8 C;  3VRP A;  2J87 A;  1YR5 A;  4PE0 A;  1A75 B;  3BUX B;  2AAO A;  2JUL A;  1XA6 A;  1NP8 A;  5CCM A;  1XX6 A;  3QTL D;  2BE6 A;  2XRC A;  2LHI A;  5HI7 A;  1CM1 A;  3VRQ A;  1ZMZ A;  2E73 A;  2V53 A;  4I5K A;  1TUR A;  4E1R A;  4PHM A;  4Q04 A;  1LR9 A;  1R2U A;  1NWD A;  1Y1A A;  4OKH A;  2BUS A;  2LNK A;  3AKA A;  3VDP A;  1TOT A;  2NCO A;  1K90 D;  2LUC A;  4OCI A;  3UGL A;  4BY4 A;  2KI6 C;  2L51 A;  2PMY A;  3D0Y B;  2M1U A;  3O2P A;  1SL7 A;  3OB1 B;  1FBV A;  1W7I B;  2ZRS A;  3NSI A;  3AKB A;  1Y1U A;  2KYF A;  2WCB A;  3FWC A;  4YRU A;  3OX6 A;  1F70 A;  1NX0 A;  1U5K A;  4PHK A;  1KK8 C;  1ZAC A;  2PAS A;  1KK7 Z;  1NIW A;  3QRX A;  3SJS A;  2Q91 A;  1KQM C;  1YVH A;  2Y4Q A;  4DCK A;  3E3R A;  1ALW A;  2JT8 A;  3I5I B;  5I8N A;  1K9P A;  1N13 A;  1M46 A;  1IH0 A;  3D00 A;  2LVV A;  4MN0 A;  2LAN A;  4OVN F;  1D1O A;  2D8N A;  1PPF I;  5HLV A;  2ROW A;  5JOL A;  3PAT A;  2NLN A;  2QAC A;  5GQQ C;  1G4Y R;  2PRU A;  1R6P A;  1NCZ A;  2HET A;  1WRZ A;  1X74 A;  2KMO A;  1TNX A;  2G9B A;  3CGA A;  4FTG A;  2ARP F;  3M0W A;  1UWO A;  4MRY A;  2JZM A;  2JXD A;  1FF1 A;  1KFU L;  3DF0 B;  2KBM A;  1AUI B;  1KFU S;  2N71 A;  1BR1 B;  5AEQ A;  1KCY A;  4JCV E;  2NXQ A;  3KEV A;  1MXE A;  1QX2 A;  2KMR A;  2I18 A;  1AP4 A;  4YGE B;  5I2O A;  1M8B A;  1TOP A;  2L50 A;  1SBJ A;  1SGD I;  5CCL A;  1CLM A;  1XFZ O;  1IWQ A;  2KQ6 A;  1UHH A;  2L5X B;  4FQO A;  4HRG A;  2RGI A;  5J3X A;  1XBT A;  3KHE A;  3PM8 A;  4GNK B;  2LLU A;  4XJK A;  4B6D A;  3O78 A;  2L98 A;  1UHJ A;  4CPV A;  4L9M A;  3TJQ A;  1WDC B;  3F45 A;  2L7X A;  2L8E A;  3VRN A;  1QX5 B;  3PDN A;  1FW4 A;  1OZO A;  3ICB A;  2QPO A;  5KU1 A;  1SYM A;  1OYV I;  2KCX A;  2KMQ A;  1TBQ R;  4PAL A;  1BT6 A;  1H0Z A;  3BUO B;  4TNC A;  1PVB A;  2KAV A;  4GBA A;  1IJ6 A;  1B1G A;  2OPO A;  3TUY C;  1F8H A;  1PJU A;  2YQP A;  1PCE A;  2JXL A;  1KBE A;  2NU2 I;  2SGD I;  2FJU B;  1S5G Z;  1YX8 A;  2LHL A;  2GGM A;  2WCE A;  4AQI A;  1OE9 B;  3NSL A;  1TNQ A;  1AK8 A;  1PSB A;  1GGZ A;  5AXI A;  3DVE A;  2LUX A;  2MA2 A;  4GAO A;  3DD4 A;  2KNE A;  2MLE C;  3QWP A;  1KK7 Y;  4DIR A;  2ORV A;  3VGO A;  1RFH A;  1SKT A;  1TIH A;  2R2I A;  1JC2 A;  1CT0 I;  3GK1 A;  5HKY A;  2EC6 C;  1IGV A;  1S6C A;  1DS3 I;  3O4Y A;  1CTR A;  1NCX A;  4P5O E;  4YBH B;  2WVJ A;  5FUV A;  1QX7 A;  1PAL A;  1CDP A;  1QS7 A;  3H4S E;  5EX0 A;  1V1G A;  4C0K A;  3FIA A;  2BKI B;  1GQM A;  1J1D A;  1KSM A;  1WRK A;  2B1U A;  4AQJ A;  1UP5 A;  4MZK A;  2F3Y A;  1CFC A;  2SGF I;  3VE5 A;  4UXJ A;  1GGW A;  5JJG A;  2I7A A;  2LV7 A;  5HKZ A;  2W0T A;  3EKJ A;  3TUY B;  2K61 A;  2ZN9 A;  4CFR A;  1KQV A;  4GPL B;  3AAJ A;  2H61 A;  1DGV A;  5DKN A;  2M49 B;  1LIN A;  3KO0 A;  4WRI A;  1OSA A;  1L2O C;  3SG3 A;  1RJV A;  4GGF A;  2NU0 I;  2ELI A;  1B7T Y;  2M7N A;  1F55 A;  1MT1 A;  2EHB A;  4D1E A;  4XYN A;  1F4O A;  1RFJ A;  1WDC C;  2LVJ A;  1WLM A;  2L0P A;  1H8B A;  2UZ3 A;  1UHI A;  3SG2 A;  2KMP A;  3BUM B;  1EJ3 A;  4UPG A;  1CMG A;  3SEK C;  3FC3 A;  1MR8 A;  3HX4 A;  1PRW A;  2M5X A;  3D0Y A;  3DVK A;  1F54 A;  1PTQ A;  3TDI A;  1S36 A;  4ZCU A;  1NYA A;  1Y1C A;  3JTD B;  1CDN A;  2KHN A;  3LCP C;  2PSR A;  1SCV A;  2WOR A;  5CSF A;  5IBW A;  1PSR A;  2AUC A;  1M8C A;  2K7D A;  2ZRT A;  3OX5 A;  1CE3 A;  1TCF A;  4DUQ A;  2NU1 I;  2KFF A;  4M2Q A;  1C07 A;  1CMF A;  3KY9 A;  1DF0 A;  1NUB A;  4M2O A;  4PHN A;  1DT7 B;  1GJY A;  1BF5 A;  1HJA I;  4ORA B;  4N1G A;  3SIB A;  1R0R I;  2FCD A;  4IL1 A;  2GKV A;  1QJT A;  3SG6 A;  1NPQ A;  2BBM A;  2EGD A;  4XJK B;  1UVG A;  1S6J A;  3BUW B;  3NXA A;  1IW4 A;  1PVA A;  4N1F A;  1KFX S;  3I5I C;  3SG5 A;  2DOQ A;  2KI4 B;  1SGP I;  5BPJ A;  1QXP A;  2KFG A;  3PLF B;  2FNF X;  1XFW O;  4YGD B;  1XFV O;  4HRH A;  2JC2 A;  1FAQ A;  3CR4 X;  2QPT A;  2LCP A;  5CSJ A;  5DKQ A;  4MVF A;  1BLQ A;  1W3S A;  2JNX A;  2DIP A;  4SGB I;  2VRG A;  2ZKM X;  3LLE A;  3JVT B;  3KF9 A;  1SY9 A;  5DKR A;  2CCM A;  2JXC A;  3IQO A;  4AOM A;  4E1P A;  3OB2 B;  3CR5 X;  4FKD A;  3K21 A;  4R1E A;  4CID A;  1B4C A;  2A20 A;  2JNF A;  1S5G Y;  1JBA A;  3EK7 A;  2K7B A;  1LA0 A;  1PUL A;  1KSO A;  3PN7 B;  1BG1 A;  2LC5 A;  1J7R A;  3IQQ A;  1CGJ I;  1M31 A;  1TUS A;  1K96 A;  1NX1 A;  1U5I B;  1CDM A;  5CSN A;  4JQ0 D;  2V1C A;  4HRE E;  4E68 A;  3VDU A;  1K93 D;  3EK8 A;  5FUY A;  1CNP A;  4I5N B;  3NSO A;  1SGQ I;  1YVL A;  1WY9 A;  1KWO B;  1QVI Y;  2HF5 A;  1MHO A;  2JW6 A;  1LXF C;  1XVJ A;  3EVR A;  3OXL A;  1DJI A;  1EG3 A;  3C1V A;  2CBL A;  2NU3 I;  3CS1 A;  3VRR A;  4NDD A;  2LLS A;  1SCM C;  2NZ0 A;  2WC8 A;  1DJZ A;  2JZI A;  2MHH A;  2O60 A;  2PAL A;  1G8I A;  2HQW A;  2Y1M A;  2KAX A;  2GKR I;  2K7O A;  1BR4 B;  1QLK A;  3NSK A;  2Y1N A;  1CFD A;  2K8M B;  2O5G A;  1DS2 I;  1V1I A;  2M29 A;  2TN4 A;  1XFX O;  2BCA A;  4DS7 A;  5KSZ A;  4ICB A;  1HPT A;  3SIA A;  1AVS A;  3GK2 A;  2SGQ I;  4MZJ A;  2ORW A;  1VDD A;  4GGF C;  5EX3 A;  4GUK A;  2KGB C;  1W4R A;  1SPY A;  3CLN A;  2H61 C;  2MAZ A;  1YRU B;  2GGZ A;  1S3P A;  1SCM B;  2M8U A;  1BJF A;  2M3W A;  1YUR A;  1YRT B;  2SAS A;  1REC A;  3DVM A;  1LVC D;  1XO5 A;  1NX2 A;  2K0J A;  3SG7 A;  2LP3 A;  1LR8 A;  2ODD A;  1QAS A;  2Q4U A;  1CLB A;  4WQ2 A;  1CGI I;  1KBF A;  1MUX A;  1EL4 A;  2IS9 A;  5HYD A;  4MZL A;  2K2A A;  5ER4 X;  1QTX A;  2JWW A;  4I5L B;  1QAT A;  1OOJ A;  4YGA A;  1EG4 A;  1K9U A;  1J7O A;  2M7L A;  1DMO A;  1JF0 A;  1ZUZ A;  2KBI A;  1JF2 A;  1ODB A;  2LLT A;  3MSE B;  1A4P A;  2G2B A;  4ZCV A;  1CLL A;  2P6A C;  4JPZ B;  2I2R E;  3IF7 A;  3SGQ I;  1NX3 A;  1J7P A;  1BUS A;  1NSH A;  2BE4 A;  1ALV A;  3CR2 A;  1VRK A;  2ZFD A;  1AJ4 A;  1SGR I;  1UUS A;  2WND A;  1S26 D;  3DVJ A;  1B47 A;  1JFK A;  1IY6 A;  4P2Y B;  2F8P A;  4QJ4 B;  4C0J A;  1K9K A;  1Z7K B;  2LAP A;  4YI9 A;  2N1A B;  1OZS A;  1TBO A;  2WCY A;  1CB1 A;  1FI5 A;  4YGC B;  2SGE I;  1DJY A;  1YTZ C;  4U8D A;  3EVU A;  4CFQ A;  4MRX A;  1OMU A;  1Y1B A;  2BCB A;  4PCW A;  2SCP A;  2ENZ A;  2QQD A;  3E2I A;  2M0R A;  1M39 A;  1NCY A;  1W7J B;  2E30 A;  4I5J A;  1K2H A;  3KPX A;  3O6B A;  1DTL A;  2GV5 A;  5B8I B;  1U5I A;  1OMR A;  1B8L A;  2BKH B;  3PSR A;  4DRW A;  1HQV A;  1X02 A;  1OMD A;  1DF0 B;  4M2P A;  1B8R A;  1SK6 D;  2BCX A;  5PAL A;  3CXL A;  2L2E A;  2E6W A;  3BOW B;  5AAN A;  3OXF A;  1RRO A;  1OVO A;  4A4B A;  1BU3 A;  3I5H C;  1TTX A;  2F3C I;  2ZND A;  3ZNI A;  2COL B;  1A75 A;  1FPW A;  3FS7 A;  3OXG A;  2A4J A;  2ENN A;  5I2Q A;  3PFV A;  2OVO A;  3RM1 A;  1IKU A;  1DJW A;  2YUU A;  2KGR A;  1H4B A;  1J7Q A;  3TDZ A;  3I5G C;  3VRO A;  2SGP I;  1S6I A;  3LK1 A;  4MSP A;  4OV2 A;  5CPV A;  1YTP A;  4UXH A;  1IY5 A;  2QQC A;  1QIW A;  2JT3 A;  2BBN A;  1LKJ A;  2KOT A;  5G08 A;  3WNX B;  4NQG A;  2CTN A;  4F0Z B;  2OD1 A;  1ZOT B;  2BL0 C;  2L4H A;  3OL0 A;  3MEK A;  3DF0 A;  1Y1X A;  1CFF A;  1ZFS A;  2VRW B;  2PVB A;  4ETO A;  1DVI A;  5TNC A;  1L2O B;  3I5F B;  4NDC A;  1EXR A;  1TGS I;  2DB6 A;  1SMG A;  2ZNE A;  5K89 A;  1WRL A;  1M63 B;  3A8R A;  1J1E A;  2WOS A;  1FAR A;  3B4V C;  2CJS C;  1QIV A;  1BOC A;  2FOT A;  3CWG A;  4JWQ A;  2JT0 A;  1HT9 A;  1YX7 A;  3TZ1 A;  3EKH A;  5AFP A;  1B9A A;  2KYC A;  2ERW A;  1SR6 B;  1UVF A;  1TIZ A;  1SNL A;  4HGU A;  1Y8F A;  2L4I A;  1AHR A;  2F2O A;  1TNP A;  1EH2 A;  2KFH A;  3A4U B;  1V1H A;  4QJ3 B;  2B0U C;  1RTP 1;  4OR9 B;  1L7Z A;  1AN1 I;  2LEO A;  1FYB A;  2KI6 D;  3GOF A;  3JTD C;  3OP0 A;  5FUW A;  1CM4 A;  4MLW A;  1C7W A;  2QQE A;  3BUN B;  3WHU B;  3D10 A;  2KSP A;  2NCP A;  1RWY A;  1JSA A;  4N5X A;  1UUC A;  5FYX A;  1CDL A;  1LA3 A;  1TN4 A;  3BXK A;  4PE4 A;  4OVO A;  1IQ3 A;  1TCO B;  1XA5 A;  2GVI A;  1BOD A;  3LK0 A;  1IG5 A;  4MEW A;  1PTR A;  3BJI A;  1MWN A;  3EVV A;  2P6B B;  1MF8 B;  2JRF A;  1Y6W A;  2HPS A;  3SG4 A;  4BY5 A;  1OQP A;  1K8U A;  3I5F C;  4MBE A;  2CT9 A;  5HQ8 A;  1E8A A;  3OVO A;  3E59 A;  1N0Y A;  2N52 A;  1AJ5 A;  1KK8 B;  2E5R A;  1TRF A;  2Y5I A;  2FCE A;  3RU0 A;  2JTZ A;  2LMV A;  1R79 A;  1SRA A;  3HCM A;  5ER5 A;  1A2X A;  2JU0 A;  1CT4 I;  3SGB I;  5KTY A;  3UFF A;  2H2K A;  1XK4 C;  3CTN A;  2MJW B;  3I5G B;  4GI3 C;  1Q80 A;  2K7C A;  2LP2 A;  1G33 A;  1SGN I;  1N2D A;  3WXA A;  4HSZ A;  2F3Z A;  3ZWH A;  2CXJ A;  2ISD A;  1K95 A;  1J55 A;  3I5H B;  2EC6 B;  2M97 A;  3UGD A;  1N65 A;  1YUU A;  4PE1 A;  2QQ0 A;  2B8T A;  2WCF A;  5FUX A;  3UGI A;  1K94 A;  1UHN A;  2LUY A;  1SW8 A;  1IJ5 A;  1SR6 C;  2V1C C;  1DJH A;  3PAL A;  1JFJ A;  4GFT A;  2M1K B;  3AAK A;  1BMO A;  1UHK A;  1KMA A;  4USL A;  1KFX L;  1SGE I;  1IRJ A;  3OHM B;  5HKW A;  1A29 A;  4CLN A;  1SL9 A;  2AMI A;  1C7V A;  1F71 A;  4C0L A;  2OTG C;  4UXI A;  3FWB A;  2I94 A;  1F4Q A;  2KAY A;  3RLZ A;  1JWD A;  1QV0 A;  2JA1 A;  1S1E A;  1CKK A;  4YGB B;  1V1F A;  4NDB A;  4PDZ A;  2LVI A;  2BEC A;  2GKT I;  2N17 A;  4A24 A;  1SL8 A;  2BL0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...