5FUWA

Catalytic domain of thymidine kinase from trypanosoma brucei with dtmp or dthd
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
168
Chain Sequence
b'AHGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTGDTLTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 53
structure length 168
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuwA01
3K9HA 4TYYA 4NCJA 2F55A 3K70B 4D81A 2FPLA 2NIPA 1J8MF 4IHQA 3ZS8A 3EPJA 1EGAA 3KUCA 3E2IA 2R44A 4V0KA 3QSYA 2ZU6A 2FFBA 4LOAA 3Q72A 1PVOA 1KI8A 3NVAA 4UNSA 4GSYA 4AKEA 3QG1A 2XEXA 1G7CA 1JB1A 1W5SA 2P65A 3IEVA 2JJ8A 1NJFA 3R8CA 3B1ZA 1G3IA 2WWYA 2W83A 4I1VA 4UQOA 3R7WB 1FAQA 2DFTA 2PMDA 4R98A 2RKOA 1E99A 3I8XA 2GJSA 2ZETA 2AWOA 2XITA 3DHWC 3OAAD 1XNJA 1GFIA 4C0LA 2O8EA 1T6NA 4AWXA 5K8LA 1MOZA 2GXSA 1QHHA 2GF0A 3LW7A 1U0LA 4JKYA 3ZS9A 3K70D 1M8PA 3RRYA 2DWQA 2A30A 4PO8A 2ANCA 4A36A 4M1WA 2JATA 4J0QA 1BS1A 1MABA 2JLWA 2C96A 4RJLA 1G41A 4JT2A 4WZ6A 4V03A 2QE7A 4BRWA 3THWB 3GLHE 5G3ZA 3U3MA 2WTUA 3BH0A 2ZANA 5A5GA 1FMJA 4Q1BA 3QIAA 3BS4A 2F9MA 3SQXA 3ICEA 4L9SA 1T3LA 4BGDA 1ZNZA 2ZJ2A 3NC0C 4AYXA 1R0YA 3TUJC 3GJXC 2NZJA 1FARA 4PC6A 3L0IB 2QAGB 5CM9C 5C1BA 1ZIPA 2ZJYA 1NIJA 1P7CA 2YOHA 2WICA 2PT7A 4NCKA 2A78A 3K0AB 4RKEA 2ZSAA 3FFBA 3B1XA 1M7GA 1ZCAA 2ZUDA 3F3YA 4A0GA 4M4SA 3RNLA 2VRWB 1KI9A 3EWSA 3L8ZA 2IL1A 4RY2A 5JCZA 1OT3A 5B30A 1NF3A 1FP7A 3UIEA 3P26A 3A58B 1I4LD 4X8MA 1SULA 4I81A 1OB5A 1NN3A 1Z06A 4TZ6A 3KTAA 5JWHA 5TXGA 4PO1A 4QGFA 4FCTA 5FTJA 3ADKA 1F6BA 1WCV1 4KFUA 1OKKA 2PT5A 4XOIA 3NC1C 1N5IA 4IRUB 1T8TA 4EJSA 2FE4A 3AB3A 3VHXA 3W8NA 4PHFA 4CRWB 121PA 1R4AA 4NE2A 4M1YA 1JALA 1MO5A 2ZJAA 3DMDA 4PC2A 2QZ4A 3B13B 2FFQA 3TVTA 1T9HA 1EFRD 4LYHA 4C2UA 4H9GA 1XEXA 4YMSA 5KSOA 1X1RA 3KKQA 3QXXA 3VR4A 3SFVA 1UKEA 3ONWA 1WXQA 4X8LA 5EZ5A 3U6KA 4LJ8A 3RDPA 3GLIB 3A36A 4A8JA 4QOSA 1GIAA 5F9FA 2JLQA 2WWFA 5DO9A 5EXXA 3LNCA 3C15C 2GCPA 3QKRA 4KFSA 2JIZD 4RVCA 2OBNA 1KBFA 2JJ2D 1K5DA 4GPTA 2HF9A 4PPGA 4O25A 3F5FA 2IWHA 1LFDB 3C7KA 3Q5DA 4Q48A 4Q4HB 1R0WA 2R62A 2RB4A 3TAHA 4DLSA 1AZSC 2ZR7A 3VHLB 4LRWA 4LSGA 4WXRA 2P3SA 3VR3A 3GLGB 2CJWB 1ZM7A 1V5WA 4Q19A 4LHWA 5KSZA 3CF0A 3THXA 1SXJB 1DE0A 4LGMA 4AKGA 3A1TA 3AF4A 4LJ4A 2IUTA 2Z0MA 2V54A 3MJRA 3T1QA 1W4BA 2X8AA 2BMEA 2O0KA 3LVQE 2VLIA 1ANKA 3FKSA 1XB2A 1GSIA 2WKQA 1AQUA 2PZEA 4BLSA 3OESA 3SQWA 2A5DA 2ZJZA 1ONBA 1DAHA 2WSSA 1OHHA 4QHSA 3WYAA 5LDDC 1R8SA 1YU9A 3CF6R 4RCYA 1UBGA 1W0KD 2BJWA 3A4MA 5D3MA 1J70A 4HYYA 3CBQA 3IQXA 3WNCA 2ZYWX 1CXZA 4EDHA 2CHGA 1LNZA 4QJ5A 1GDDA 4TWZA 3PFIA 1AGPA 1SXJD 1VCOA 2WBLC 2AD5A 1SZPA 3X1DA 3FMPB 2B7CA 1XD2A 5EUMA 3VR2A 2F3TA 1E9CA 2F9LA 3D3QA 3U44B 1JQLB 1GKIA 2BBTA 3GJ7A 1MO3A 3ND8A 2ZE6A 4G01B 4PTLA 3AVXA 4XTCS 4EPYA 2JAQA 3QY0A 5K8IA 1BIFA 2OBLA 1LY1A 4TQAA 2RHDA 4US1R 3SBDA 2YUUA 4A0RA 1SVMA 4WIAA 3U7EB 1NBME 3AVOA 4QBFA 3EASA 5H1YA 1T0JB 1H8ED 3ZQ6A 1KTVA 5E7MA 4POAA 4URWR 5JZVA 5GJBA 3RRMA 1MRNA 3FTQA 2XNSA 3LX8A 5JMTA 2IYXA 3HJNA 2BEKA 1HT2E 2OO7A 5LB2A 1ZINA 3FHTA 1XTKA 4FI3C 3GLFA 4C0KA 4DIEA 2BHRA 4PC1A 1CULC 5EXPA 3U3JA 3GJ4A 1M1YE 2IEYA 3K0CC 1OIXA 3AGQA 3U3KA 5KO2A 2B7BA 4PAQA 3Q5EA 4I99A 4NYMR 3TNFA 1CR4A 4K8OA 4QC2A 2YVUA 2A9KA 1GNPA 1I2MA 2XTZA 4RD1A 1E9EA 5E4FA 4W7SA 2E73A 1CJTC 3EA5A 1E2DA 4XVUA 1P2VA 1YR9A 2BEJA 2W6IA 3LWNA 3ZYCA 3EA0A 1TMKA 1W4CA 1OE0A 1YZNA 4ZIRB 3EIEA 2J5XA 1N25A 2FU5C 1E79D 5FPSA 2ZREA 4E5UA 1N6IA 1PUJA 2FFAA 5J4VA 2DBYA 4DLUA 1DO0A 4BLRA 1Q1ZA 5EXSA 3BXZA 4KBFA 2BCGY 1E0KA 2HXSA 2ZVPX 3HPRA 4G5RA 1E9RA 2F3RA 2F43A 3BB1A 4MGIR 4P4TA 2YC2C 2WJGA 4D4KA 2L0XA 4ZCIA 2FV8A 2CLDX 2PJZA 4DT1B 1O87A 3PG5A 4GOJA 3WYGA 1NMXA 5EE3A 4M9SA 3BIFA 2QENA 1QHNA 4M1TA 1TUIA 3QVVA 3VTKA 4ARZA 4KHZA 721PA 1ZC4A 5EE5B 3H1TA 1G64A 1NKTA 1ZVQA 2CVHA 2F7SA 2Z4RA 3IO3A 2ZI9A 4YMWA 1R5BA 2X2FA 1G16A 3PVSA 4LJ5A 4LJ7A 3VKWA 1LW7A 3LX5A 3U2QA 2NGRA 2JLZA 1QF9A 4UXIA 1F5NA 1IJEA 5FL7A 3UKDA 4QM6A 3CNNA 3HPQA 3QENA 5LD2C 4URZR 2BOVA 1P2SA 3WNDA 2QN6A 3EXAA 3RS3A 3EPLA 4ERNA 1X8JA 2IHBA 4HZUA 2V55B 1Z29A 5AJWA 5L3QA 5AJYA 1JAHA 2ZRGA 1QHIA 1Z6XA 2GJ8A 2V7QA 2ZR0A 3GLHB 5DI3A 2QP9X 4AURA 1CR1A 4BFTA 4TLEA 3SJCA 3AEZA 1U90A 2REOA 3O8CA 2X19A 3HP1A 4YONB 5JEDA 3SN6A 1WBBA 1SQ5A 4AI6A 3P4XA 2GZHA 4FXPA 4V0OA 3EPHA 1YJ5A 1AZTA 1COWA 2OFWA 2PEZA 2O0JA 2WOOA 2Z6VA 2C9OA 3D8BA 3ZVRA 3TR0A 4E07A 1JXOA 3I5XA 5FBQB 2QP4A 4LJAA 4DUGD 3GD7A 3O47A 4IOLA 1XX6A 1RJ9A 2FPMA 1Q3HA 2C9CA 2HT6A 5FOXA 1N5KA 5JSZB 1EESA 4TT3A 1T91A 3U7FB 3TLXA 3DEFA 2UZ3A 4JLOA 1AN0A 2MMGA 1KI2A 4B71A 2NMVA 2F1HA 4MUAA 4BZQA 3WYFA 1Z0FA 3OEHD 3CRRA 3Q9LA 4A15A 3VMFA 4TN1A 2ORWA 2HUPA 3L0SA 3IDQA 1LF0A 5JI3E 5FPTA 1F48A 3X1XA 3QXSA 4LZZA 1ESMA 2GBLC 2B8TA 4BASA 2CK3A 2JGNA 2ZSDA 4MGYR 5EP2A 5BWMA 1G21E 5FOSA 4F4CA 3U5ZB 4JBWA 1Q21A 2IS1A 3WHLA 4ON9A 2V1UA 1GL9B 2AHOA 5LBIA 4B2LA 4JVNA 1I4DD 4M1SA 4LJ6A 1WQ1R 2X1VA 2XGJA 3AP3A 2VEDA 4DXAA 3UXMA 2FNAA 1KSHA 2G0NA 2XNDD 4PPQA 1E0SA 1G6HA 2AFIE 4Z8YA 4AC9A 1E0AA 3CB4A 1W36B 1Z2AA 4GOKA 1BYIA 2JDID 2F1IA 3M4YA 4D2IA 2X2EA 1KJZA 2ZUCA 2PEYA 3HR7A 4URXR 1CP2A 3LY5A 2F1RA 5DN6D 5L3RA 4ZPXA 1N0VC 3M0EA 3AM1A 4JSYA 5C4GB 3GJ3A 3DOEA 1HTWA 1Z83A 3K53A 4L16A 3CR7A 5HCIA 2C03A 4WBSA 1TL7C 3Q7QA 1SVKA 2KB0A 2ATXA 2J41A 2NTYC 5FTLA 4NBSA 4OHXA 1GL7A 1W44A 2W6JA 5L8VA 5CM8B 4QNMA 2DFNA 1UEIA 1FZQA 4JIMA 4EFMA 2Q21A 4L8GA 1SKYE 1W36D 2RGDA 1GUAA 4TMZA 3UEJA 4IDQA 2IS2A 1KO8A 1IM2A 4OYHA 4DEYA 2ZRHA 2Q3HA 1LB1B 3KKMA 4B34A 1E1QD 1XMIA 2C8VA 1FNMA 3LQQA 1EFCA 1KMHB 1T0HB 4XD7A 4D4MA 2CCKA 5JRZA 2NO7A 3ZD6A 4RKFA 5TY0A 2DHRA 2UKDA 1KBEA 4C30A 1OB2A 4KVGA 1NNEA 1ZM3A 2QTHA 3D6TB 3A4LA 5KPJA 1UKVY 1TADA 1T3SA 1RW4A 4U5XA 3H2YA 2DYKA 1TU3A 4NU0A 1UBCA 4F4JA 4M9ZA 1R0ZA 4QJ4A 2RAPA 2HDNB 3GJ5A 1EXMA 4C9BA 4KU4A 5BYKA 4DZZA 2B6HA 1KSGA 4MDEA 3Q7PA 1K5GA 1EFUA 2QT1A 4LBYA 1N2CE 4II7A 2ZYVX 4JLNA 2BV3A 5CIWA 4Z54A 4CEHB 1VKJA 3WHKA 2G9NA 2FF7A 1SVSA 4MGZR 4OK3A 2GVIA 5FTNA 4HDOB 1JECA 4WXPA 5EE9A 2QBYA 3CF2A 2YWHA 2WAYA 2WWHA 4MGKR 3VX3A 5KHOC 1SVWA 1IN5A 3L0PA 4AD8A 1QRAA 1DEKA 3PUXA 5H70A 2EU8A 1KO4A 1P2TA 2ZJ8A 2YINC 5CDFE 3I72A 4N1AA 2OEPA 5FFMA 4OI2A 2BBSA 1DAGA 3OEED 2XSZA 1E2JA 4E22A 4FINA 1NBMD 1B23P 3OAAA 1HUQA 1B0UA 1U81A 2ZRBA 4LK2A 2PBRA 4LWZA 3I1FA 4TL8A 3ZGXA 5B64A 3KQNA 1GOTA 1JQJC 2QY9A 5JJLA 2PMKA 3W3ZB 4URUR 4YMUA 4MYUA 1TEVA 1VCMA 1KNXA 2OSBA 4US2R 4G5GA 4DJTA 4EPRA 4ASUD 3W6PA 3RRZA 5FUWA 4WW0A 3DZ8A 4L5BA 1N0UA 4ILEA 3UPUA 1TQ4A 1QG4A 3K9GA 4JLAA 3PXGA 2ANBA 4MYCA 3EZ9A 5KDOA 5HE9A 2KSQA 3OF5A 4PZLA 3BJIA 4IKEA 1EWQA 1MO6A 4QBGB 3A37A 4EJSC 2IF2A 3VQTA 4CZ2A 1NN5A 3K0FB 4ESVA 4LV8B 2IYUA 3TMKA 4NH0A 1YZKA 5DHAA 1Z0KA 1Y8FA 3LRPA 1U0HC 3I61A 5HKKA 2VHQA 3W5JA 3WMFA 2D3WA 2KWIA 1N6NA 4LV6A 1IHUA 2C95A 2IWRA 4A8JC 3K09A 1G8YA 3TGPA 2CMKA 3KY9A 5J40A 4TTRA 3CONA 4GI7A 1OJLA 3NWJA 4HAXA 3SYNA 3THWA 3QPVA 2OBMA 1XP8A 1QHGA 1WE2A 3VFDA 2ZSBA 4XTRA 1KGDA 3T61A 2QQ0A 2PZFA 3I5YA 5KNBA 4HDQB 3IIJA 1A82A 2R6FA 5IK2D 1NY6A 1P75A 1W0JD 4CDGA 5FOUA 3BWDD 1VIYA 2QAGA 4BWYA 2ODBA 2CNWD 2FOLA 5L3VA 4EPTA 2BVNA 2ZJ5A 1U9IA 3AF0A 3BFKA 2R6CA 4B32A 3N2EA 3I8SA 3K0AA 1HQYE 4DSUA 1US8B 1JJVA 3R9XA 2B92A 2VRWA 4LPSA 1GG2A 3GFOA 1C4OA 1E4VA 1VG0B 4XWAA 2KE5A 4KLZA 5AR1A 3HR8A 5CJ2A 3H0KA 3VNUA 1NLYA 2W0MA 4XWKA 1ZM4A 3KUDA 4RCZA 4LC0A 1P9RA 1C1YA 4BFSA 4D4JA 1GILA 1E2NA 3CPJB 2ZJBA 1UAAA 1E69A 1ZM2A 5CITA 5BYJA 5F3WB 1UJ2A 1NJGA 4UJ5A 3KXKA 4BQSA 1P6XA 5JLJA 1G5PA 3KFXA 2VQSA 2AXPA 1Q12A 1KK3A 1YHNA 5JHGB 2VHTA 4D6PA 2OCAA 1FX0A 5JFGA 3AVVA 4M1MA 5F2EA 5KDLA 4C2TA 2VHJA 2WWWA 4IEIA 4DWJA 5JRJA 4XWOA 3PEVA 4ACBA 1GWNA 3NDBB 3BGWA 2ZM5A 1UKZA 5P21A 4M53A 3PUZA 1YZLA 2WWGA 1YR7A 4O2LA 1NSFA 4PX9A 2QMHA 3RVBA 3P20A 3GLGA 4FCVA 3BK7A 3QI2A 4BEJA 2CJWA 2EYQA 2C5LA 4Q1FA 2FGJA 2QRZA 4NCIA 4DCVA 4RD6A 3O8BA 1S4QA 5TB5A 4DCNA 4IVPA 2XXAA 1HH4A 4UNRA 4O2RA 1E0JA 1OW3B 2QGZA 4FIDA 3NXSA 4RFSA 3C5CA 4KFTA 1VYVA 3LXRA 1E1RD 3EX7C 1ZUNB 2J59A 5GJWC 3RS4A 3E5HA 1RFLA 1NVWQ 2V6IA 2P67A 3QG5A 5GJCA 3PENA 1DAIA 1OYYA 3C4JA 4BFXA 2G6BA 2QP3A 3HU2A 2ZS7A 1S9HA 3L43A 2Z4SA 1SKYB 1TX4B 4Q7JB 2GILA 2EW1A 2BMJA 2YHSA 2JA1A 4EKDA 2O8DB 5FTMA 4C3ZA 4EAQA 1N6PA 5DHFA 2RMKA 4JLMA 2GZAA 4Z8XA 3MWJA 2D2EA 4Q4AB 3KKPA 3X1WA 1GAJA 1L4UA 3WBKA 1W7AA 1JPJA 2CCJA 1NY5A 4A82A 2DPXA 4C4PA 2IYZA 1TBOA 2CE2X 2YZ2A 1WP9A 3FHOA 1JR3A 3U44A 2OCPA 4B3CA 3AUYA 1OFTA 2ZYUX 3UGDA 1XPOA 5EXTA 5FI0B 1XPRA 1P3JA 2WJHA 4YXWD 4GDFA 2GWHA 3NEJA 1JR6A 4A6XA 2FEMA 2FSGA 1RC8A 1ZYUA 1Q44A 2GKSA 4HAUA 1D9ZA 1OH6A 1M6NA 1XZPA 1XEFA 2NO6A 1JXMA 2A7QA 4OJQA 4Q9IA 2HF8A 5JECA 1XJCA 4B3XA 3H84A 3QUSA 2IYVA 2FX3A 3G82C 1IXZA 3E1SA 4TLDA 4D80A 1KK2A 3AP1A 2W0SA 1N6RA 3KDSE 2V3CC 4GBMA 4NCHA 5FUVA 3K0EA 1F2UA 4TL9A 3U4QA 1Z08A 4DKXA 2HEIA 4C0HA 3VU9B 4CF7A 3SHWA 4X8HA 2DFKB 2CVFA 1Q20A 4LBVA 4CVNA 1U99A 1ZJ6A 4EPWA 1ZAKA 2G88A 4JT4A 2OZEA 3I32A 1GKUB 3WRYC 4OI1A 3REGA 1U8YA 3B1WA 6Q21A 5E7JA 1XXHA 2HLDA 3AVYA 2OESA 2PL3A 3AVUA 3A1VA 1X8KA 5FPYA 2A5GA 1Z6GA 5E3HA 4ZIRA 3DO6A 2J7PA 4DLTA 2OFOA 1ZUHA 5TMPA 1JAIA 2ZXUA 2RGEA 1RZ3A 1XTQA 3JZAA 4L9MA 1WBDA 5EP1A 5EUQB 3RC3A 2D2FA 4F91B 3DL0A 5FOWA 1D2MA 1KZGB 3WP1B 5AUPB 3RWMB 2B8WA 3U3RA 2ZAMA 1D5CA 3Q85A 2AKAB 3PUWA 1IY2A 1LS6A 1NSTA 4PAOA 3RAPR 4F4IA 1KOFA 3EIQA 2BCJQ 2GZDA 4D25A 2QNRA 3I4LA 3CRVA 5HPYB 2CDNA 2JJ1D 2I1QA 1LTQA 1QVRA 2WIBA 2ZRIA 2QRNA 4P3YA 3VR1A 2GDJA 3AVQA 2XAUA 4Q9KA 5DISB 4OHYA 1OV4A 2VIIA 3UANA 5LB4A 4B6DA 3VKHA 3GEHA 2KBFA 3ZVMA 4KLNA 2NPFA 4AYWA 4Q00A 2OILA 4DCUA 4BLQA 2IYSA 3NHAA 4RSGA 3CX6A 2H92A 1XFAA 4DBLC 4EPXA 4TZ0A 1F3OA 3WBJA 1M34E 4B3DA 3PIRA 2WV9A 4F93B 4CEJB 5TDHA 3SC3A 3EC1A 2IX3A 3THYB 3BE4A 2IUSA 2AN9A 2IYYA 3A1UA 4G5OA 4DRZA 3CH5A 3W34A 1RRCA 1G7RA 4DCSA 3OE7D 2A3RA 2OE2A 1A4RA 4HUQB 1R5NA 4CT5A 3BERA 3GFTA 3SS8A 4JYCA 2ZIAA 2ODEA 1DTSA 1W5TA 1XF9A 1EFHA 4A4DA 2QT0A 2CL6X 3IKJA 3W6NA 2V1XA 4NYMQ 3ADBA 2DWOA 3MWLA 3AP2A 2IYQA 3CWZA 2H8KA 3ZD7A 1X86B 3QQ5A 3QXHA 2OLKA 3GFPA 4JBXA 4LY6A 3NG1A 3L82B 4ZKEA 3JVUA 3C41J 3LBIA 5GVRA 2JCSA 1SVLA 4I1UA 1X6VA 3FMFA 5GJVC 3I92A 2VP2A 3BFVA 1Z47A 3KQLA 5EZ6B 2BDTA 1Q1EA 4OHVA 4WVFA 1YRBA 3B9PA 4K81B 4A9AA 4NKRA 5CYPA 3CLVA 1R5OA 2ATVA 4NTZA 1L8QA 3QF4B 4ESHA 3LDAA 4JBYA 2Q0HA 4U00A 4AG5A 1OXVA 5FR1A 1IXSB 4TMVA 3X1YA 4PSKA 3B8HA 5ELXA 4LHZA 1G5TA 1XU4A 3CX7A 4U02A 5KNDA 1NLFA 5HZHA 1Z0AA 1RIFA 4OI0A 1R2QA 4D4LA 5K8TA 3ADCA 1FP6A 2IW3A 4B73A 1VTKA 2WJVA 1UADA 5B57C 2NO9A 3PEWA 4HLQB 3LXXA 1AS3A 1KAOA 2IK8A 4PC3A 2RGXA 1CJKC 1Z2CA 2WPDD 3RWOA 1G9XA 3CRQA 3B82A 1FMLA 1XD8A 4HATA 1G8PA 3UGIA 1KKMA 1I2DA 2F6RA 2C98A 4FW9A 5J47A 4PHGA 1YZUA 5HZKA 4JVLA 2WWXA 2ZRNA 2D74A 1E1QA 1PTQA 5J4HA 3EPKA 4I1OA 3EW9A 1RVDA 4JLPA 3ZDQA 4DDWA 1Y3AA 4JS0A 4MUBA 3KTAB 1H8HA 3CX8A 1S1CA 2ZS8A 1TEXA 1OF1A 2QPAA 3GMTA 3N70A 1GRQA 3OIWA 4BE7B 3PITA 4D26A 1T5LA 1VG9B 2IXFA 4DEXA 5EE1A 4CEIB 4IFBA 2IUUA 2FSHA 3QPUA 3BB3A 5EJEA 1XEXB 4PPNA 1KI7A 2P6RA 4XIGS 5E7IA 4FWIB 3TW4A 1S3GA 1P72A 4BFUA 4QBHA 1HE8B 5DLQC 2YC4C 4OQLA 1KMHA 1GNQA 3NBFA 1E32A 1MRSA 3QKRB 4Z1MA 1ZNWA 3TUIC 4ACAA 1E2IA 4A0HA 4R71A 3V4RA 1HQCA 2NZ8A 3SE0A 4Q21A 2WVJA 2GVDC 2HXYA 1II8B 2GJ9A 1Z6TA 4C0JA 3ZZ0A 1OKKD 3MWKA 2VYFA 4OQMA 4TTQA 1E4YA 3SDZA 1NG9A 4B3BA 3CWQA 2W00A 3HYRA 4M22A 2ZE5A 3DZDA 2J9RA 3SHFA 1S2MA 3C14C 1OYWA 4GP7A 1S8FA 4JL6A 2H1LA 3BJIC 3BB4A 3G5UA 4XSHA 3B2EA 1SHKA 2J46A 2ORIA 3KL4A 5J4LA 1A7JA 4HAZA 3GPLA 1HY3A 2EFDB 3OEEA 4Z51A 2MMCA 1G7TA 4CEHA 1G20E 2IT1A 4PR0A 3CO5A 5DI9A 2RHMA 2FH5B 3OIVA 1JI0A 1ZU4A 5C18A 2JASA 1E2PA 4DDUA 4YDHB 3UATA 3K09C 1DO2A 3T34A 1Q1BA 2WM9B 3I3SR 4V02A 3BH7A 1F2TA 2VP6A 2ENZA 2REBA 5C2JB 1NRJB 3WMGA 4YC7A 1XMSA 5FUYA 5BN5A 3VNVA 4F92B 2GHIA 2GCNA 2R9VA 4IOKA 1I4TD 4HB3A 5A4JA 2VSFA 3QXCA 2ODWA 3DMNA 5E95A 3IEUA 3C5HA 2GAAA 4OI4A 4IDPA 4KI0A 4U7DA 2ODNA 1WB9A 3B1YA 1U2RA 4NYIR 3SYLA 4MKHA 2QAGC 2DFLA 2QM8A 4BLTA 1JJ7A 2Q9BA 1TUEA 3FKSD 4WOPA 5FH9A 5CLQA 5KTYA 1SVIA 1U9IC 4B3GA 4NHOA 3SEAA 2QMOA 4G3XA 4HB0A 5FBRB 2FPKA 1RE0A 3EIHA 1OHHD 3DVLA 2O8CA 4TMTA 4YMTA 4IDOA 2WKPA 5G3YA 3KXLA 3U61B 1T8UA 5LPNA 1MV5A 3DPUA 4LYFA 2YNMA 4JLKA 3UMFA 4HLDA 1Z0DA 1ZC3A 3OZXA 4G5QA 3TJZA 5BN3A 2ZR9A 4TQ9A 1GP2A 4ZCLA 1ZD8A 4LHVA 2QAJA 1N6KA 2C04A 4PZZA 3RS0A 3KXIA 2ZITA 1ODFA 1DG1G 3K0FA 3W3AA 5JCPA 2W2XA 2HV8A 3R20A 4TL6A 3ASZA 4UNPA 3UMSA 2W2TA 5M04A 1GM5A 2CNWA 5AJZA 2VHCA 3ZIAA 4B33A 4B76A 2O8FB 1W49A 4PQFA 4KBGA 1NN1A 2JLSA 5J4YA 1HV8A 1U0JA 2XX3A 5DYIA 4B2PA 2FSIA 1GRNA 3BORA 2O8BB 4F38A 1V43A 3TK1A 3KQUA 1TQ2A 1RFHA 3JVVA 4Q7LA 2V4ZA 5FBLB 4Q47A 2AL7A 2IS4A 1ZCBA 4PFSA 3CM0A 4UXJA 1E2FA 1ZBDA 2AWNA 2EYUA 2GXUA 2BJVA 1CR2A 2WJIA 4ZI3A 3FYHA 3KFVA 1ZM9A 2ROWA 1G4UR 3D31A 1YZGA 2GF9A 3HDTA 3LQRA 2WHXA 1AA9A 3TH5A 4W5JA 1KI1A 4Q18A 2WMNB 1D9XA 3A1WA 4JVMA 3ETLA 3QBTA 2W6ID 1US8A 3Q8XB 1G17A 5DSZA 3AVTA 3VR6A 2IHYA 4W9MC 1VCIA 4TSFD 1EFTA 1TF7A 521PA 4ARZB 1DOAA 2WZQA 1ZNYA 2WAXA 4PXAA 1XWIA 1DVRA 2QPOA 2AK2A 2XOKA 2J0UB 2TMKA 3FGNA 4HAYA 4Y0AA 2DWPA 3CH4B 4LYJA 5JWRA 3KJEA 4V0MA 3ZLJA 4K46A 4KODA 2CLCX 3C8UA 2LWIA 3SJAA 1KK1A 1AGRA 5EP4A 4DDVA 3OFNA 1VCNA 2G1JA 4QKQA 1W4RA 1TQ6A 2ZRMA 3BOSA 1ZUIA 1W2HA 2QI9C 1SGWA 2WJJA 4M9QA 1DAMA 2GESA 4RZ2A 1FL9A 1Z28A 4JLBA 5JWOA 3K1JA 1Z8FA 3AKCA 1W4AA 4CT4B 4DLRA 4BFYA 2PLFA 5G41A 2ORVA 1L2TA 2QTVB 2Y8EA 4FMBB 4A92A 3EG5A 1TTTA 3EZ2A 3PUYA 3RSOA 1XBTA 1E9DA 1IXRC 1KKLA 821PA 3THOA 1OH7A 3SR0A 3AKYA 2I1VB 4TYQA 4XH9B 3KQKA 4GT1A 4EQ6B 4BPBA 4UKDA 2N46A 2G0TA 2ZUBA 3NH6A 4FD2A 1E2LA 4D0GA 2XTNA 3MD0A 4RD2A 3P27A 3IIMA 4PQRA 2ZI5A 1CF4A 5JEEA 3NBZC 4G5SA 1VHTA 4WZAE 1E98A 1RJ9B 2GJKA 2YOFA 1M2OB 4BEBA 1MO4A 3QF7A 2GTPA 1QBKC 4OHZA 2YWFA 5L3SB 2QUZA 3A1SA 3DKPA 4URVR 2H57A 1D8TA 5FL3A 5FOVA 4BECA 1XCGB 2A5FA 4GOXA 3QBVA 1AM4D 2E87A 4BFWA 2D7DA 1COWD 3R7WA 1GRRA 1N5LA 2IYWA 4P31A 1VPLA 2QEQA 2JLYA 3QPWA 1IY1A 4YXWA 2VSOA 4YQFA 3K0SA 1NLZA 3CW2A 4LBWA 1K8RA 3SOPA 4Q4JB 1DG3A 4B3FX 1FUUA 1U98A 2H5EA 3PR1A 4EPVA 5KNCA 4OQXA 4FMCF 4NZYA 2BKEA 2DCUA 3H86A 3LV8A 3K8YA 3OIUA 2O8DA 2ZRFA 3H4MA 3TBKA 4TTPA 4M0LA 5J5CA 3AF2A 1TNDA 1PZNA 3FMOB 1OIWA 1VG8A 1TF2A 3LH5A 4Q4AA 4AK9A 4BFZA 4FMDB 4OHWA 1P5ZB 3LFUA 4H1VA 2QG6A 3MWYW 1X8LA 3B7GA 1RRPA 2CCGA 3R9IA 4W5WA 3CXLA 1TF5A 4Q1DA 2OAQ1 1QHSA 4KSCA 4B6FA 2V9PA 3S1AB 4ABYA 1NVUQ 2QSYA 3PEUA 1QDEA 4P0TA 3FFAA 2GCOB 1NN0A 4ITRC 3GJ8A 4Q02A 3CRW1 5GADl 2XB2A 1J99A 2ZRPA 2CK3D 1XJQA 3MGCA 3VR5A 3T12A 2ZI3A 2GA8A 4UNQA 1ZU5A 4FKDA 2XJ9A 3IPYA 1ZIOA 2ZRAA 4Q7MB 3ICQB 1EFRA 1D2EA 4AY2A 3TVDA 4LDJA 4RD0A 4QGGA 1PLLA 2FJUA 3AH8A 4MYHA 1J2JA 4NYJQ 3AUXA 4QGHA 4PZYA 2FA9A 4MRVA 3UK6A 1TBNA 3CNOA 4UJ3A 4HAWA 1KJYA 5DIFA 2VA8A 3F8TA 4TYNA 4QG7A 4Q01A 2JIZA 1AS0A 4C0BA 1UDXA 3QEOA 2JJ2A 5CDFA 1NVVR 3WY9A 3RS5A 1VECA 3P1JA 1XEWX 3AF3A 3LW8A 4DVGA 1JR3E 4S35A 4JL5A 2ZJOA 5F98A 2I4IA 1Z3IX 2QA5A 4LHXA 2W6JD 3NEYA 1KDPA 4RD3A 2ZI4A 4MKFA 3T5GA 1P9NA 2RGNA 4DLXA 2QGNA 4XJXA 1UF9A 4Q66C 2WKRA 2R2AA 1N6LA 4IDHA 1VHLA 3ASYA 4P4SB 3T06B 1U94A 1ZD9A 4JSTA 3GLIA 4IDNA 1BH2A 3IILA 2LCFA 1AKYA 3RRNA 3UEYA 1FNNA 1YZTA 1Z0JA 2ASEA 1Z0IA 1W2GA 1DELA 1AJEA 4DHEA 2C2HA 2X77A 4QM7A 1WRBA 5JHHB 1XMVA 2N1BA 3FMIA 3LBNA 3OE7A 4TLCA 4OJKA 3REFA 3V4FA 5G53C 3QOFA 1E3MA 1OXTA 1W0KA 1N6OA 1YRAA 2FMXA 2VH5R 2C77A 3CIOA 4NYJR 3EC2A 4Q4HA 2NPIA 3K9LA 4MRPA 3BBPA 2ZRKA 1UKYA 4RZ3A 1EG7A 1KI6B 1SXJA 3AV0B 1CTQA 5UKDA 4KSBA 4CEJA 1XXHE 4C7OB 4IJMA 1XZQA 3THYA 1XTJA 1CS4C 1FQJA 1OSNA 2AKYA 4KCGA 3SNHA 1L7VC 3MCAA 4GMXA 3B1VA 3B6EA 1RKBA 4JLVA 1OPXA 2FNFX 2P6UA 4RZUA 4HUQA 5AJXA 3ZZTA 2WJYA 5AWFC 1P60A 5IRCD 1S9DA 1XEWY 1W36C 4IXNA 2O5VA 1NMZA 1WMSA 3RABA 2QSZA 1E2HA 1G5RA 3U3OA 5FPKA 4JYBA 1H8EA 4Q1AA 5LD2B 1KY3A 1NVXQ 1QG2A 3A6PC 1XMJA 1PLKA 3IUYA 621PA 2G83A 3ADDA 5GVSA 1Q57A 1IY0A 3SYKA 1GTVA 3GQBA 2XSZD 4GL2A 4UXHA 3RS2A 2QQEA 1EX7A 1T4GA 4XVQA 2GEVA 2AD1A 3W5IA 3ECCA 4TMKA 4NPHA 2FDCA 3LBHA 2PJRA 5SZJA 1E6CA 3MG9A 4B2IA 2BBOA 2WPDA 2OG2A 1OIVA 4RD4A 5KOYA 3O8RA 4IVQA 2R8RA 3QF4A 5CYOA 2IA5A 2YWEA 4BZPA 1KNQA 1ZW6A 2C78A 1ZD1A 5HCNA 2VP4A 1G4AE 1PLJA 1ZRHA 2AXNA 2ZAOA 3E70C 3LLMA 1G3MA 1N0WA 1JEDA 4PO9A 4G1UC 4O0MA 4URYR 4DCTA 4MQBA 1E79A 4LC1A 5B2ZA 3HU3A 3TSZA 1J8YF 4JVSB 4JJKA 4GP6A 2OHFA 2OT3B 4BLOA 3VAAA 1LV7A 1Q3TA 3U6BA 1G291 3AVPA 2ZQ5A 4DB4A 1MH1A 2FWRA 4HLUA 4IW3B 3LA6A 5IF9A 2YKGA 3IO5A 1KMQA 1CJUC 3QVUA 5HKKD 1IBRA 2A2ZA 4W5HA 1SHZA 3ZH9B 3FOZA 2GRJA 2VL7A 4PAMA 2C9YA 1OLOA 5JS7A 3SFZA 1KK0A 5KUTA 4CGZA 1FTSA 1VDZA 1R79A 3LO5A 1G3UA 1E2MA 3MJHA 4C0AC 1S96A 1PJRA 3UG7A 2AX4A 4DDTA 2HCJB 2QMUA 2UVQA 3OHMA 3QJYA 5FBWB 1BYUA 1XJ0A 2GJAA 3M1IA 2WIAA 4OBEA 2P6NA 4RZXA 3IBYA 1YZQA 1KI3A 5CK5A 2XZPA 2EWWA 1YQTA 4M1OA 4Q03A 5BN4A 1KDRA 2ZRLA 3TIFA 3AKEA 4DLYA 2GAOA 1AS2A 2G77B 3TQFA 1K6MA 3ZVLA 4AG6A 4CEIA 4PC7A 4DT1A 1ZMXA 4GRAA 3GLFE 3DM5A 1IOZA 5CK4A 3L2OB 2ZYTX 2FG5A 3T5DA 5A0FA 1KO5A 5B58C 1IJFA 5AJVB 1G8HA 3TKLA 4B44A 3FKQA 1YE8A 4DSOA 2W2VA 5HTKA 2ZEJA 4JJZA 1N5JA 4F7WA 2IEZA 3QKSB 1E2KA 4S2EA 1EX6A 4OKSA 4GMDA 1KJWA 3EZ6A 2H7VA 2KI5A 1FX0B 4WZBE 2ZRDA 3CUEF 2IXEA 1DADA 4M1KA 2NQ2C 2R65A 2PCJA 2HCBA 3AF1A 1II8A 2REXB 4LHYA 1CJMA 2E9SA 3FPAA 3I73A 4LUCA 4DLWA 3KKOA 2CEAA 2FFHA 2G1KA 2J0VA 4DUGA 4C0SA 2EFHB 3GLHA 4JZKA 1KZ7B 1MKYA 2VP5A 8OHMA 2YOGA 2OCBA 2MSCB 1CBUA 2XXAB 1TPZA 2G3YA 1BMFD 4RFSB 3PEYA 4C0QC 1M74A 4MRNA 3OEHA 3U60B 4B75A 1NL3A 1OXXK 1N6HA 3TUZC 2PCLA 3AVWA 1XA6A 2J1LA 3TR5A 2YWGA 4EFNA 3TSOA 1GITA 2O8EB 4B47A 5KDDA 1KSJA 5D3QA 3QE0A 1E9BA 3BAFA 4LBZA 2OCYC 2XB4A 4HI0E 2H16A 1E9AA 1KDTA 1QHHB 1E2QA 4MITA 4LV5B 2Z5FA 2Q9CA 3W9YA 4IXMA 3MRSA 4ZO4A 5JSZA 1IQPA 3UG6A 3AQ4A 4BFVA 2JLUA 1N3BA 3KJHA 3L0OA 4RFVA 1EK0A 2FZ4A 2XNDA 1CU1A 1MABB 2RGAA 4QBIA 2VF8A 3AGPA 1DAEA 2H17A 2JDIA 2PX0A 3QKUA 4HUTA 1RPZA 4PSVA 2QROA 3NDPA 5DN6A 3KB2A 2Z43A 2ZE8A 2PLRA 4LPKA 1IN7A 1ETUA 1A1VA 1P73A 2MSEB 5FBVB 3U7HB 5EP3A 4EIWA 1G6OA 2YYZA 1TQDA 2CHVA 4US0R 1JEEA 3OIYA 1Z5ZA 3LD9A 2ECKA 1L4YA 2CLSA 3W8RA 4OK6A 4A2PA 3VKGA 2LKDA 2ZSEA 1BOFA 1XD9A 4X8OA 4CIDA 3F0TA 1UBEA 1CRQA 2BWJA 2Q3MA 4DB2A 1F2UB 1QVAA 1E2EA 1JR3D 3U4QB 1U8ZA 2QE7D 1UDWA 2K5UA 3NBXX 3TSWA 1UM8A 1X3SA 2BM0A 3EARA 1D6JA 2ONJA 2ZROA 1NIPA 3W90A 1IN4A 3SJBA 1CLUA 1AKEA 2O8FA 3GEEA 3AKDA 1KDOA 3TW8B 4ZDWA 1A5TA 1XXHB 2GEUA 4B43A 1P62B 4QGAA 1XDBA 3KQHA 4HB4A 4HEJA 5AK0A 4EJSB 2O8BA 3BFXA 1W46A 3HYTA 4NONA 2IF0A 4TSFA 1AK2A 2IYTA 5SZHB 3DOFA 2RGBA 1KI4A 1P4SA 4N0EA 4ZDJA 2VPPA 4D82A 1II0A 3R8FA 3RHFA 2Q9AA 4H1UA 3NH9A 3SBEA 2NO1A 5JBQA 1CRPA 4A8JB 2QPTA 1G8GA 2QU8A 1KYIA 3K70C 3CPHA 2ENNA 1S0UA 2JLXA 1JBKA 1OXSC 2R6GA 2GK7A 4NYIQ 2QL6A 1S1MA 2HLDD 4ZDIA 3SU8A 4Q5IA 4IFEA 2HYIC 5JI2E 3CRMA 1VG1A 4Q7KA 3CKLA 5SZIA 4GNKA 5BQ5A 1A2KC 2J7PD 2OFXA 3CR8A 2ELIA 1FTNA 2OM2A 3B5JA 4OQFA 4R2IA 2DY1A 2P5TB 5AUOB 1DAKA 1R0XA 2J0UA 3WNBA 5KU1A 5JJIA 1XTRA 4CYMA 3THXB 1FFHA 2IBMA 5EQTA 4CW7A 4KVAA 1VIAA 4KITB 2BBWA 1NBMA 3MFYA 2NG1A 4D0NA 5H8WA 4A1FA 4UNNA 2N42A 3QEJA 4ZCMA 3RSLA 1NKSA 2E1RA 2GETA 4BLPA 3NHBA 3UGLA 3P4YA 4Q9LA 3IHLA 1NP6A 2EFEB 3HWSA 1E96A 2A5JA 2GVZC 4QL3A 4ZDKA 4KYUA 2AK3A 2WOJA 1O3YA 2DR3A 2EQBA 4IOJA 5TVKA 1II9A 5D3MB 1TAGA 2C99A 4GFDA 4Q4LA 4MKIA 1UEJA 4I4LA 4JLDA 4ASUA 4QRHA 3CNLA 4OK5A 1R10A 2D06A 2OUKA 2ERYA 4BUJA 2CL7X 4HSEA 2NOAA 3K9NA 1GVNB 1GNRA 1FUKA 1KO1A 4MYTA 3TRFA 1CKEA 3LLUA 1XD2B 4Q1EA 1HT1E 2ZU0C 5FTKA 3JZMA 2VF7A 2ZRJA 4EQ6A 1E9SA 1KY2A 2V8OA 3V9PA 2CE7A 1GKYA 1KO7A 1AQYA 5H68A 4JMPA 5CB8A 3CPEA 4M9XA 1NI3A 5C46F 2RGGA 1E94E 2IC5A 1Q1QA 2AR7A 1HA3A 2EFGA 2WSSD 3WP0A 4GZLA 4V0ME 1EWRA 2EWVA 1CEEA 5IDVA 3X2SA 2O0HA 2OAP1 5L3SA 4LI0A 2RH5A 3M6AA 4BRUA 3HU1A 3T15A 5SZKB 1IONA 1CIPA 1J7KA 2BM1A 2Q3FA 4HZIA 4IVRA 4PSAA 4I1SA 2CL0X 2B21A 5JJKA 4DIDA 3GLFB 2A5YB 1P2UA 2VHUA 2H18A 3B60A 1FPMA 2QM7A 2BIFA 3LVRE 1E2GA 1OH8A 4Q4JA 1Z07A 1RRFA 4E03A 4M8NE 3IQWA 5IK2A 1UFQA 1W0JA 2O52A 4R7ZA 5HE8A 2RGNC 1A2BA 2VTKA 1HEIA 3SJZA 1KHTA 3IIKA 3UWKA 3X1ZA 1MR3F 3D7MA 3TAUA 1WF3A 5FOTA 1OXUA 3Q3JB 1T5IA 5FPHA 2PZGA 4OL0A 1IN6A 4A2WA 1FOEB 2OLJA 4YMVA 2IS6A 1KIMA 2AFHE 5EE0A 4QFMA 3W6OA 1SVOA 1XRJA 4TQUS 3T35A 5KSYA 4R9UC 3S1AA 3FDIA 4M21A 3MAAC 1X1SA 2D7CA 2GCOA 4O3MA 3G0HA 4Q1CA 2DB3A 2VP0A 3UFFA 1R8QA 4E09A 3T1TA 4B35A 1IAQA 1XCPA 1XTIA 2F43B 1W1WA 3B78A 4QJ3A 1ESNA 4MH0R 421PA 1P61B 2JLRA 3GJ6A 4Q9HA 1U8AA 2ZS9A 2XZOA 5F9HA 2EVWX 1JNYA 3BC1A 4KAXA 4PPFA 3ZJYA 2DB6A 1LVGA 1QZXA 1SXJC 3GEIA 5DH9A 4EUNA 5CJPA 2FN4A 2P5SA 3EZ7A 2HJGA 3UMRA 3MMPA 1D2NA 4NDZA 3B85A 4YLGA 2WWIA 1DARA 1YR6A 3N5CA 4LYAA 5FI1B 3QXJA 2VBCA 2ERXA 4KYIB 3SZRA 3PJRA 4QHTA 1W48A 1QHXA 1XCMA 2P0EA 2ZE7A 3BD9A 3J81k 2I3BA 1G8FA 2ZI6A 1SKQA 5DGXA 1H8HD 4PHTA 2F1JA 5IHPA 4MA4A 1G3RA 2D4HA 1PTRA 4N3NA 4DSNA 4QHYA 4L15A 3FVQA 1UPTA 1LS1A 3K0CA 3NBYC 4HZUB 1YR8A 5L3QB 3KJGA 3QKTA 3RS7A 2SHKA 5DI3B 4HLCA 4KJZA 2FSFA 3MSXA 1LF5A 1FQKA 4P4SA 4AYTA 2BKUA 4Q9JA 4B6EA 2J45A 4LJ9A 2RGCA 1G3QA 4MRSA 1S3SA 4G0NA 1E1RA 1G19A 4DSTA 4N0DA 3RYTC 1OFUX 4Z1MD 1DBSA 5DYGA 5FL7D 3NKVA 3L8YA 3N2IA 1T3HA 4NP6A 1M7BA 5HR5A 5TV2A 3RANA 4MRRA 5K8UA 3KX2A 1F2TB 2RCNA 3GCGA 4LCBA 4LX0A 4QNRA 4DLZA 4AKHA 1RYFA 3T1VA 3KKNA 1Z63A 1RYHA 4JKIA 1DS6A 2KBEA 2V7QD 2ZI7A 1IN8A 1G1MA 4L9WA 4ZKDA 1HYQA 4R2HA 2IYLD 3SI7A 5DNYB 2BMFA 4V0LA 3A4NA 3PCRB 1Z6YA 2MSDB 3GJ0A 4PQYA 4WAUA 5CB6A 1GZSA 1KI6A 1HE1C 2W58A 5KSPA 1QHYA 2LKCA 3FWYA 4D0LB 2YJTD 5JS8A 4C7OA 2XTMA 5BXQC 3O8DA 4DLVA 4Y0VA 2R6AA 3DKVA 3TQCA 1HURA 4HLUC 1H65A 2EFCB 1KSFX 221PA 3EAQA 3A8TA 2FZLA 4FMDF 2HJVA 3FHCB 4MKGA 2GXAA 1CJVC 1J90A 3CZQA 4QXAA 5KPDA 2O8CB 2D62A 1NMYA 5KYKA 1Y63A 3GLIE 2GK6A 5G40A 3VX4A 4TMWA 1FW6A 4DC9A 2J3EA 3RC8A 2JLVA 2VO1A 3PQCA 4M2LA 3MLEA 4TT3D 3R9WA 2OXRA 1AIPA 2KJQA 3IPXA 4WA7A 4YDSA 5FR2A 4EFLA 3U7GA 2Q6TA 2XZLA 1NVVQ 2YV5A 4HAVA 1Q22A 2CBZA 3EZFA 4TYPA 2FGKA 1BO6A 3LAWA 5TARA 1YKSA 2ZVQX 4B74A 4FCWA 4FN5A 4B48A 4GZMA 2J87A 3MUFA 3GLGE 4MDFA 1W47A 2WSMA 3GP8A 2VSXA 1VMAA 4PHHA 2QTFA 2VP9A 3V00A 1KAGA 2QMEA 3UWOA 4AKIA 3WRXC 1SXJE 1ZP6A 4JLJA 1UBFA 1TU4A 2ZTSA 4JL8A 1GL6A 3IHWA 2HYDA 4TL7A 4TMXA 3KB1A 2QORA 3NIBA 4KO8A 2HT1A 2BC9A 3FB4A 4TYWA 4KFRA 2J0SA 3FE2A 3ZZUA 4FMCB 4OQNA 2ZPTX 3IGFA 4ZI2A 2BMDA 4IEEA 3VU9A 2J0QA 3CZPA 2PX3A 1PUIA 4L4UA 3RLFA 5J4KA 4ZV4A 2JJ1A 3KZ1E 4TLAA 5BW8A 1R6BX 2CXXA 4IOMA 3ZIAD 1NG1A 4A6PA 5DE3A 4A2QA 3ZVNA 1DPFA 3ZQJA 4FWTA 2GBLA 1XTSA 2IXGA 5C4MA 1OFIA 1CR0A 3QNUA 3KJIA 4XSGA 2CHQA 3EWAA 4A0FA 1OFHA 2UZIR 5AUQA 5CLLA 3WMEA 1OH5A 3T1OA 4AIIA 2WMOB 4V0NA 1VYTA 4P32A 1RRGA 3BRWD 1BKDR 1P9WA 1Z6AA 4KXFB 3C16C 4P4UA 4XD7D 3NTUA 3DDCA 1MT0A 2OV2A 1F60A 2NO0A 1Z22A 3PUVA 5FUXA 2XJ4A 4NL4H 2ZRCA 3DM9B 3WXMA 2IYRA 2QBYB 2PH1A 5AUNB 3IBGA 1XPUA 1ELOA 2J7KA 4P33A 2Z83A 3PV0A 1M7HA 1WDTA 1JPNA 2R6DA 1BMFA 4XVRA 1YVDA 4KV9A 1C9KA 3QKSA 5CIQA 1PV4A 2XOKD 3TE6A 2OXCA 2FEOA 2GNOA 2P2LA 4NMMA 2JEOA 4LJYA 3I62A 5ANRB 1G7SA 3B9QA 4NCNA 1R7RA 1G18A 1ZNXA 3BH6A 2ONKA 1Q0UA 1WA5A 2GEDA 2V6JA 1DAFA 4PANA 5IT5A 1E9FA 3OFND 3ND9A 1VYUA 4TLBA 4BZXA 4HDCA 3P32A 2ZSFA 4HB2A 2GXQA
chains in the Genus database with same CATH superfamily
1RJWA 2JK1A 1A2QA 1WGCA 4ZEOA 1RC1A 3S2UA 2C9BA 2F55A 3EPJA 3S7ZA 4YIHA 4XI9A 1ZBQA 1EGAA 5JNUA 3QSYA 1OU0A 3KVYA 4V0KA 3BWEA 3DOCA 2FFBA 1WKVA 3NVAA 5K0FA 2VAWA 4GSYA 3VU3A 4B4WA 2O2YA 5DTIA 1G7CA 1VOTA 2I6FA 4BO8A 3T94A 2WT8A 1KVRA 1T0PA 2JJ8A 2WILA 3PB3A 5CVCA 3IVCA 2WWYA 3GPDG 3IJPA 2H4WA 3LS2A 1PJCA 4CKCB 1Z13A 1SCKA 2DFTA 3CVOA 4R98A 5C1OA 1PGOA 1P9OA 2RKOA 4GHWA 3KETA 3DHWC 2B4TO 2QSJA 3GT4A 2P27A 3P2YA 2AW3A 3X44A 1NLUA 4AWXA 1MOZA 4UD2A 1OZ0A 3O73A 3D6FA 4EMTA 1EVJA 4AS3A 3RGGA 4GBED 1MEEA 1M8PA 3OQIA 4J7AA 2ARKA 4JA0A 5FQOA 2A30A 2Y77A 1ZQ9A 2R4UA 2EKZA 4PO8A 2ANCA 4KH1A 2RHWA 3L7DA 1I1NA 4ZZ1A 5DMHA 1YNOA 2FB9A 2JLWA 3P9NA 2Z9CA 3OOWA 5EUBA 4U2BA 2NNWB 4YRDA 2XKJE 4JT2A 1JIUA 4WZ6A 1XT6A 1T5DX 3A6FA 2JANA 1BAPA 5CFZA 4RF4A 1ZD4A 3MERA 1VMDA 1VCHA 4NAVA 3RHTA 2VHXA 4FFMA 4JI1B 1NW5A 1TZCA 2CSUA 3GGSA 3PQFA 4K8RB 4Q1BA 3UN1A 2PKCA 4SGBI 1ZNZA 2CUKA 2ZJ2A 3H99A 3NC0C 4HQ0A 1G2QA 3SS7X 2EHJA 1ONSA 1VKOA 1ZJ5A 3QWFA 3NORA 2FDRA 3E23A 4P8RA 4UM7A 4HQLA 3PPWA 4W1PA 5B6JA 3HCRA 4LF9B 1VBFA 5C1BA 1QONA 3G2NA 1Q7BA 1L1QA 3ID6C 4OB7A 3ESBA 2B3DA 4LNAA 1FJGB 3TQQA 2RHGB 4IFIA 1NBWB 4IAOA 4RKEA 1WGTA 2HWWA 2Q1TA 3GGOA 1P2DA 4A0GA 3RNLA 3A31A 5CB4B 4XCXA 5AVTA 4RY2A 1FLVA 1GDTA 5EQJB 3ZBUA 1OT3A 2XGMA 1SUFA 5KYGA 5C1IA 2NTNA 3AYZB 3WLLA 1B8UA 1IHPA 4PINA 1CJCA 3LYLA 4X8MA 1SCUB 1SULA 2WINI 1MX9A 3SEQA 3ENVA 4H0NA 1Z9BA 1L5HB 1XROA 2OGUA 3H4IA 3KTAA 4M7WA 5TXGA 4BV3A 1UPBA 9MHTA 4FHCA 2BGIA 4MVWA 4ARCA 3OOJA 3DAOA 5A04A 2VTVA 1R8JA 2NYUA 2VPTA 3CEAA 1T8TA 3LPLA 4G36A 1GYQA 3PTLA 4TTAA 4C76A 1VSQA 4HL6A 3TDNA 3VHXA 3W8NA 4CRWB 4PX3A 3IKMB 3IH5A 3EMVA 3DMDA 1AN9A 4I6EA 4PC2A 5C8DA 3B13B 1UL1X 3GDGA 1D4OA 1RLIA 1SC3A 1SCAA 2SNIE 2XCLA 1R4ZA 4PY2A 1XEXA 4WOJA 4YMSA 4P82A 5KSOA 1ZK0A 3QXXA 2OVFA 2JA2A 3S5UA 3SFVA 3N2YA 5CT5A 2VZLA 1KZYC 5U4QA 3U6KA 2FWBA 4A10A 3VO1A 4KX5A 4B84A 3VR0A 2WWFA 4KGVA 4XUEA 5EXXA 1SKBA 2Z6UA 2JXDA 2GCPA 5ALYA 1CVRA 2Z2YA 3QA3E 5LQNA 3IERA 4B17A 1WHSB 4H3KB 1EG2A 1Q91A 2A94A 2HF9A 1IG0A 3QWAA 1CY1A 1A9OA 4QEZA 2IWHA 1N75A 4Q48A 1P1CA 1KPIA 3EQ2A 3RQIA 3TAHA 2VZ9A 1FLAA 1MUUA 3VHLB 4NH4A 4R5MA 3PZBA 2P3SA 4NSNA 4F9TA 4MV4A 1V5WA 3E0QA 3OFJA 4Q19A 2FSUA 3AUFA 4UFPA 2G9ZA 5KSZA 1ZGZA 5T7BA 3ESZA 2MU1A 3JAWA 2HA4A 2D1TA 4BXOB 1C4KA 1KJQA 2YFQA 4LJ4A 2Q4DA 2IUTA 4MW5A 1KETA 2ODDA 1PJBA 2BEWB 2JJQA 3EVAA 2VJYA 2J31A 3ET4A 2WU1A 1XB2A 2EBHX 1AUVA 1QFSA 2WKQA 3FKSA 3DAGA 4HCJA 1U0FA 4HGOA 4OBXA 3TKAA 4YCLA 1GPNA 1LR9A 4BO1A 4PZPA 2VP3A 2DPLA 4RK4A 2JGEA 3F7OA 4Y7DA 1OHHA 1E3IA 1UIRA 3CU5A 1R8SA 3WYAA 1HO3A 1RYNA 1NHWA 4YRJA 4WASA 3AU8A 1IY5A 1XDSA 5EWLB 3VO9A 1BD4A 2OFFA 4BOYA 5ARCA 3D6NB 1Z35A 2CHGA 5LYJA 1LNZA 3DC2A 1GDDA 4TWZA 1U6KA 3CLSD 1SXJD 5DT2A 1T4MA 1MC1A 5G4KB 2OAGA 2B7CA 4KQEA 4JFAA 3RSZA 2G5GX 2A86A 2AOTA 5DLEA 2OQIA 2VC2B 3UUFA 1JQLB 1RRMA 1VIVA 5DTJA 3U44B 1EFAA 1GKIA 3GJ7A 3WLFA 4V38A 1LXCA 3WGTA 3DL2A 1RHRA 2ZE6A 4OSPA 2CL5A 1FYXA 4MV5A 2PUVA 5JRDS 5G0WA 2CMHA 3AVXA 2HTEA 3ZQUA 2ZJ3A 3UHFA 5KYXB 2V7GA 4QSMA 2OBLA 1LZLA 2F4NA 3QQPA 1Z5PA 2EJVA 1X0VA 2QL9A 1NUUA 2XF8A 2ZIUB 3HZZA 1R8YA 1B8OA 4QE3A 1EAMA 2AN4A 1DAPA 4AJLA 4YP6A 1Q3KA 5F3DA 1QKIA 2WB2A 4MVJI 2PUWA 2XLCA 3TTXA 2YS6A 4POAA 1R0RI 5IG2A 1PVDA 4RMGA 5EKTA 3GRPA 2FZWA 2JFYA 4ZQFA 1T8SA 3UXEA 2WA1A 3HLTA 1HT2E 1C7RA 3DAPA 2OO7A 3MJVA 5D5PA 5TMDA 3GLFA 4RVOA 4YECA 4OVOA 3W3AH 2AXQA 5IX8A 2NXJA 5EXPA 3FSGA 1AKWA 3GJ4A 1C0PA 3U3JA 2QJOA 1K8XB 1OIXA 3AGQA 3QYAA 4RY9A 5CYGA 2ACVA 3QU4A 2OY0A 3E9ZA 1N5DA 4R1LA 4C06A 3H9BA 3MLBA 4LCEA 2D54A 4NYMR 3L02A 3IE1A 5K3AA 4IRMA 4FNMA 4EO7A 2UXBB 4HGUA 3LWBA 5KREA 1GNPA 5J63A 5TIIA 2B3TA 4FYMA 3VPCA 3ZH2A 2H7CA 3BJZA 5E4FA 1NNSA 1JTVA 2NTVA 1RPNA 2VG8A 4W7SA 4XVUA 3KV1A 3PWSA 4DJFC 2WZBA 2Z58A 2W6IA 3LWNA 3PFWO 4ZREA 1TMKA 1EQAA 1P5HA 1T35A 1YZNA 4UTOA 4ZIRB 2ZUSA 3GGGA 3STHA 2I7CA 4E5UA 1N6IA 1O97C 2DBYA 3O3OB 2HIGA 4DLUA 1KBQA 4B83A 1DO0A 2V6MA 3OPYB 4BLRA 2SGQI 1YQUA 2NVWA 2XUZA 1RVV1 1UP4A 3R0QA 2ZVPX 4WY2A 3S29A 4XB6B 4Q34A 1UMDA 2F43A 2QUHA 1X7YB 3GNSA 3PUIA 4ZO7A 4BKMA 3NAQA 1A7UA 4TWAA 2QD3A 3GLKA 4OMUA 2XQFA 3L1VA 1QGUA 2QZZA 4UCXA 1MZPA 3EF0A 3ORRA 5BP7A 3PQDA 4KXXA 1BHSA 2WAAA 1RBZA 4G4JA 5BQXA 5FDFA 2XT0A 5IEJA 1R37A 4DT1B 1MQ9A 1KY4A 5HYVA 4M9SA 5A02A 2D8MA 3BIFA 3HXLA 3KE8A 4RTKA 4F5DA 1EP3B 4NOJA 1YQWA 5BWCA 4K9KA 1DTWB 3IO3A 3IDSA 2D8AA 1E2UA 4HNVA 1R5BA 1WZNA 2O0LA 3QE2A 1XRRA 4HDSB 5CR9A 5A2GA 3BTSA 1MIOB 3CMMA 3T4EA 4IYRA 3U2QA 2NGRA 3QTLA 4RJ2A 5CNJA 2XUDA 4UXIA 1U2TA 3AR7A 1EUCB 4X85A 1BVYF 3CNNA 3HPQA 3UV7A 4URZR 4W5QA 2BOVA 2KQUA 1KAMA 2VDJA 1N2SA 3ZGLA 5LD2C 2VA9A 1DEHA 2QD4A 3EXAA 3QUQA 4F2WA 3FDFA 1BWRA 2Y92A 3GIDA 5LYJF 3NT5A 4KIUA 5AJWA 1VPDA 1Z29A 2V55B 3GDOA 1V95A 1JIIA 3JS5A 1BOOA 3H17A 1E5TA 2GJ8A 1Y3IA 4R2XA 4RLQA 5DMXA 4ZYXA 1I3CA 2GOYA 1EP1B 4FEEA 5KAPA 4TLEA 2QX6A 2EG5A 3W1EA 1VPWA 3AHHA 3AEZA 4DWOA 1U90A 1UBKS 1WBBA 4ZXPA 2XE6A 2YZMA 3P4XA 4HEA1 4OH1A 4XDHA 1OLXB 1QOPB 1JF8A 2GKRI 3QKWA 1P1RA 2RHHA 4J4HA 2JLCA 2OFWA 1JG2A 5IKEA 4PNHA 4IO0A 2ZCJA 1XZGA 2Z6VA 1EVIA 3DBRA 4IGKA 1FBNA 3LCVB 3LUBA 4QUAA 4AQDA 2R7MA 4C0JA 1TXGA 3CYFA 1Z2EA 3DDNA 4LJAA 4DUGD 2KPOA 3O47A 4D9IA 2FPMA 2HT6A 1EESA 3DPIA 1EZ1A 4TT3A 1YB7A 5ADHA 3HJFA 4J76A 2Q3DA 3TLXA 4L08A 3DEFA 1DJOA 4JLOA 1J8FA 3NTOA 2WVGA 4ZZ3A 3SX4A 1F4VA 4YJ3A 4HTFB 3Q9LA 5EIAA 3UT5B 5GZ6A 4G25A 4YBZA 2OC9A 2GLXA 3R3SA 2ORWA 3QX9A 5KWEA 4CQLA 1V8BA 1JKMA 3IDQA 3TL6A 3ESXA 5FPTA 5BNWA 1VB5A 3JSXA 4PYOA 3HKEA 3BUSA 4OUDB 5EFZA 4CDMA 4E2XA 2B2CA 5JBIA 4UE2A 3L01A 3UGJA 4RTJA 3JQAA 1NRIA 1S3IA 3U5ZB 4CM5A 1G21E 3MINA 2Q2WA 4GI3A 1Q21A 3VM6A 3ESDA 4HY3A 4M38A 5IUKC 3WHLA 2AHOA 5IULC 1MU0A 4C4OA 1I4DD 1O9BA 1FY7A 1GPDG 3A9RA 3OE5A 4LVNA 4A2CA 2GX6A 5HZMA 1KJIA 3V46A 2XGJA 3R44A 4CTOA 2ZDGA 2GUWA 5TQ2A 3PQ8A 3UXMA 2BP7A 4Z0HO 4FUQA 2JGDB 3LQ1A 1FFAA 1KSHA 3E61A 4MI6A 4UOEA 1AH2A 1K63A 4Z4FA 4AC9A 3PNYA 4DARA 1XQXA 5KX5F 3ON5A 2XTAA 3L06A 4P5PA 1Z2AA 3TG8A 1IBCA 3D6AA 4GOKA 4BWGA 5J23A 4D2IA 1DMSA 1KJZA 3TRHA 5H82A 4BP1A 1T15A 1X15A 1RKQA 3IV7A 2NX2A 3LY5A 1XWWA 2F1RA 1STOA 5DN6D 2W4IA 4IYJA 5BORA 1B26A 2WEKA 1N0VC 4KXVA 2R1ZA 4TM8A 1CE8A 2B1QA 4N8EA 1MDFA 5C4GB 3GJ3A 3N0VA 3K53A 1PU2A 3A6ZA 4CTMA 4FCCA 4XLLA 4M0PA 5KTPA 1TL7C 4DNPA 2HK6A 4IQGA 3TLGB 4EFDA 2ATXA 4ZZ2A 4KQKA 4EB6B 1G20A 3I0NA 4QU9A 5AIAA 1PHPA 2W6JA 2X5OA 1QYCA 3AV3A 3PGA1 1ATZA 5CM8B 3ZWDA 4AF6A 4BVEA 4EHIA 4I5IA 1DLJA 1JLSA 4EHJA 3SF0A 4JP5A 4JIMA 3HEAA 2BFBB 3QY9A 3NOXA 1L5OA 3O82A 3ZWPA 1D03A 3KYDA 3OTHA 1LRKA 4DEYA 1DQPA 2IEBA 3VDRA 3VJRA 4B34A 3TFWA 1XMIA 3T1YB 1L4MA 2XR1A 4DQVA 3JD2A 4OX9B 2RGRA 5IW8A 1PGPA 4A6EA 4RKFA 5TY0A 1WSDA 2UKDA 3NFRA 2FXIA 2W9XA 1SAYA 1ZM3A 4WK2B 3D6TB 3ZWAA 1TZ2A 1UKVY 4PGFA 1TADA 1F0YA 1RW4A 2GVNA 2IOHA 1SHUX 3U4CA 3NCHA 3RPEA 1U2QA 4F4JA 4QJ4A 1K3FA 2RAPA 2HDNB 4GX0A 4RTRA 5C8ZA 1C0LA 1ZIYA 4B6OA 1ECGA 3ZDRA 3SLGA 4HGZA 1YZYA 4GC9A 2BF4A 3R5HA 1U80A 1KSGA 4RBNA 1K5GA 1IZYA 3T3GA 4QQFA 1HJAI 3AHJA 4II7A 1YACA 2BEVA 4JLNA 1BMQA 4YAEA 5KCZA 4AZWA 4YTEA 2BEUB 5HS4A 1JR2A 3IA2A 3LM8A 2ACKA 1QMPA 4EVIA 2XCIA 3M34A 1JVSA 3U56A 1JECA 4WXPA 4YAFA 5EE9A 2DR2A 4NY1A 3CF2A 4JITA 4J91A 1FNBA 2HRBA 4G8BA 4YJ3F 2WAYA 1F8FA 1TJ4A 2C9ZA 2FK8A 3JZIA 1JHXA 4Y3UA 1NDHA 3DXFA 2VBGA 4F1WA 1AU9A 1E7RA 1PWEA 1SVWA 2V3VA 4LK3A 1RLMA 1ZISA 4LX8A 1T5OA 1PR6A 1DEKA 3C3YA 4UHCA 5AJHA 4AECA 3K73O 3OCWA 2IHNA 1WW8A 1BE0A 2O59A 2BW0A 4W5RA 1JXAA 3SQDA 3VZRA 1PZFA 2HK9A 5CDFE 1D0SA 1GAEO 3G2PA 4R8VA 4OI2A 5EVCA 5FFMA 3U7QA 2XSZA 3RUPA 1BDIA 1E2JA 5FWNA 3PWKA 4FINA 2QN7A 1B23P 3L6BA 1CZLA 2A9VA 3E8XA 1JIKA 3OAAA 3VPAA 4J2HA 2PL5A 3U3ZA 1E7YA 3ZGXA 4LK2A 3DV0B 3TKYA 1MJGA 2O7RA 4S3MA 2G17A 3P0EA 2FUEA 2X4GA 2V53A 2QY9A 2WLTA 5JJLA 3W3ZB 5JHWC 2XRZA 1VDDA 3G8YA 1NYLA 4YMUA 4ZJZA 2J08A 2C8JA 1LVHA 4MYUA 2D59A 5KWVA 5DTQA 2OSBA 4KLAA 3DMPA 4DJTA 4EPRA 2C61A 5KIAA 2FWPA 2BY4A 1JSLA 1ZD5A 1SEPA 2YQZA 3D8UA 3F4LA 4MJ7A 4O5OA 5FIUA 4EKGA 3ZY2A 5DNDA 4IJ5A 4LXIA 4ESEA 1ZHOA 2IY7A 4IDGA 3O9ZA 2X5XA 4OQ4A 2AE2A 4CR6A 3UPUA 3GA7A 3HO1A 4KWIA 4JLAA 3PXGA 4CKCA 3HXTA 2ANBA 2LIPA 4MYCA 4X61A 3TOAA 2EATA 5HE9A 3WNVA 4PZLA 1EWQA 1WG8A 2XY4A 3P94A 4FONA 1H0SA 1MO6A 3GFGA 9LDTA 3VQTA 3GH3A 4PXYA 3K0FB 4ESVA 4YP7A 3DG9A 4FKBA 5KQGA 2N1MA 4UM9D 3DBVO 3LFHA 2YIJA 4PQGA 2ODAA 4KIFA 4LJLA 3I61A 1P91A 2QMYA 4GW3A 3WMFA 2D3WA 2KWIA 4LV6A 4N9WA 1IHUA 2IWRA 3ZQKA 1EJBA 1E6LA 1X87A 1CETA 3K09A 4QGSA 1BU5A 1XAGA 2CMKA 1NDQA 2I54A 2WC1A 4F5EA 1Y8CA 4OJYA 5G0VA 1TD1A 5BV0A 2ZYGA 1CUZA 1GFZA 4MMXB 2XMQA 3SYNA 4HAXA 2CXUA 4WINA 1MD9A 3QPVA 1Q0TA 4FW8A 1XP8A 4C22A 1FVFA 5AKKA 4K9DA 1HMYA 1B74A 3MCZA 3N2LA 1KGDA 4ZCSA 2HBZA 3L6DA 4Q9DA 2IUYA 3PNQA 3MS4A 4HDQB 3JD1A 3ECSA 4JJ7A 3L7YA 3VJMA 5E2BA 4MCJA 1VIYA 3K35A 4FGLA 3WICA 4PV7A 4TXJA 2CNWD 4D8XA 1ECPA 2FOLA 2W6PA 3O8QB 4EPTA 2ZJ5A 4LWQA 1K0UA 2W0TA 4WGGA 5MN4A 1YE5A 3JRNA 1TKCA 3C5EA 4B32A 3VZSA 3BQMB 1P81A 1HQYE 4DSUA 3MCWA 4N5IX 1KIAA 3ZI0A 3V1NA 2BGJA 1SUAA 4HSGA 5ECGC 5CB4A 3VSBA 3GFOA 2V7VA 3IRVA 4MVJM 2KE5A 4NBRA 4NX2A 4U2DA 2JZMA 4XWAA 3VU0A 1IPEA 1M0EA 1PW5A 1NPYA 3K31A 5JU6A 2I9KA 2GAIA 2Z09A 1TYDE 2BFFB 3HR8A 1Z73A 4J0FA 4LHSA 3GBVA 5AR1A 1SCUA 3H0KA 5HTOA 4M89A 4Y2HA 5K9ZA 5EERA 1L5HA 1VXRA 4BO3A 1Z0ZA 1COZA 1XG5A 1RRKA 4XYBA 1E8DA 1BJKA 2R47A 2H0QA 2H4YA 1DC6A 2QTCA 1GILA 3PGXA 5D85A 4DCCA 5DNCA 3T7KA 2O5RA 2W11A 2XQVA 2YMQA 1CT2I 5BR8B 1U8TA 1WXGA 1ZM2A 3H4TA 4HYQA 1YXMA 4AN4A 4BEWA 4MCHA 3EVGA 1GN9A 3IIEA 3VPFA 5CT6A 3COWA 3L4SO 3MNFA 1SUEA 2M9MA 1NJGA 4G0XA 3VR6D 1MC8A 1G5PA 3UT6A 3T54A 4G86A 2RDMA 1Q12A 4R9RA 1KK3A 3WLSA 4DRXB 1UOQA 4K6CA 3WWYA 2VHTA 1UFOA 3D9QX 1K86A 1U7DA 1WCIB 1ZI6A 2HDOA 1FX0A 2AOUB 3KAQA 3ZK8A 3AVVA 1KP3A 1PFWA 4N65A 4C2TA 3KZXA 1XQ9A 1WHSA 3O74A 4ETIA 1U0TA 3HRIA 2FRDC 1KFCB 2XQGA 2HSGA 3I6MA 4ACBA 1GT91 1Y1RA 3KQWA 1GWNA 1AUPA 2YWJA 3E58A 1JG6A 1JJIA 3BGWA 3NM4A 4PVDA 1SN7A 4R4JA 1X70A 1ENOA 4M53A 3X1MA 4BVKA 2AMVA 3PUZA 2WWGA 4X93A 2ZB4A 5E7QA 2OMKA 2IPMA 4PX9A 3VI3B 5JZ9A 5CGZA 1IPHA 4UUQA 4RH1A 3P20A 5FQNA 2JW5A 4U7TB 3EPRA 3ZE7A 2VNAA 3V33A 1DKRA 4DAEA 1ULUA 1BG6A 3FVWA 1VMIA 1RWPA 3OL0A 2OD2A 1S4QA 2VWGA 5CUQA 4RS3A 4MRMB 3GJQA 1M5UA 2DHDA 2O7NA 2YCBA 3PICA 4FIDA 3E9QA 5AJTA 3UOEA 1C9EA 1C0IA 3LXRA 3OCZA 1E1RD 2BEWA 4RV4A 3EX7C 1QGOA 4FR0A 1JMYA 3O84A 5AVOA 3E5HA 2QUJA 5GJWC 5I7RA 3L49A 2PXCA 4MP6A 4DUZB 4YP5A 5GJCA 1O97D 1DAIA 4Q3CA 1OYYA 5E6RA 4BFXA 2EL9A 1PR9A 3F5MA 4FQ7A 3HU2A 4YUYA 2ZS7A 2CF6A 4IL5A 1TX4B 2GILA 4EZBA 3HJCA 5JXGA 5DSXA 1I3OA 4EAQA 1H5UA 5EWLA 1N6PA 1RWMA 4YCDA 4FSHA 1DC7A 3KO8A 5DHFA 4IIGA 4NULA 4C89A 4KQ9A 2GZAA 5JDCC 1XKXA 4EX7A 3SVLA 3MWJA 2HK7A 2I33A 3B51X 3PGVA 1JQEA 4FQ5A 3HJRA 3VHRA 2GR9A 1ONPA 2PS0A 4ODIA 4F3CA 2P1RA 2V6GA 3FCYA 2CCJA 1NY5A 1JG3A 1PI3A 4IBOA 4LECA 1TBOA 2CE2X 3MAGA 3U44A 3EEFA 1W5EA 2JGFA 2X1HA 2DKFA 3OKAA 3QLVA 3FFXA 1THTA 4BNLA 1XPRA 3INNA 4L5YA 1JHAA 1XJ5A 2GWHA 3HXMA 4LMAA 2FSGA 4MQ6A 1UC9A 1RC8A 1ZYUA 4HP8A 5CB4F 1PZMA 1T4CB 4ZGGA 1YCFA 4CL3A 5I3CA 2IBTA 2Y0DA 1OQAA 1TI7A 2PZLA 3UJDA 2QUAA 2PNFA 5K6AA 4NESA 2O5CA 5D2CA 2OXFA 2XECA 2CLMB 1ZSVA 4BO4A 1XJCA 4G07A 4B3XA 4RV5A 4EGQA 4EZIA 1PEAA 3GAAA 4MWSA 3FPEA 1WZ2A 1JDBB 3H4VA 3OOHA 3E1SA 1BEEA 4C6RA 2G70A 2W0SA 3KDSE 1CUVA 4AJPA 3G17A 2XVXA 4GBMA 4NCHA 1MEJA 3K0EA 4TL9A 2DWUA 2O06A 2QN3A 3U4QA 4OEHA 1ZMOA 2OL4A 1YB1A 3KTFA 1ULNA 2DFKB 1PS0A 3FF4A 2C07A 3TLKA 2P35A 3FROA 2PKYX 3CEHA 3ELDA 4JT4A 4LNUB 3UAGA 2B4QA 2FN9A 2EDCA 1NOIA 3D4PA 2G6TA 3REGA 3TDMA 3VR5D 3LDFA 1SNYA 5AKEA 5AM4A 1JE1A 4L51A 2QTZA 2WSIA 1L5FA 1BC5A 3OXGA 3AVYA 3I23A 1HG0A 4GYYA 5DYWA 1AUXA 3ZWWA 3JYPA 2I1LA 3CGWA 1V5EA 3FNBA 1PW7A 4OBWA 4ZIRA 5ARDA 1RRVA 4MIKA 5TMPA 1L6IA 1JAIA 1URPA 2HJWA 4H59A 4J75A 1RZ3A 4WXHA 1XTQA 3JZAA 3R74A 2JFXA 3HR4A 2PSFA 5EUQB 5J2TB 3H8VA 5IDYA 3B36A 3OPYA 3V8NA 5JXJA 1KHHA 4DY6A 3PXUA 3DL0A 5FOWA 1KZGB 4ZD6A 1VSVA 3RWMB 4KE7A 4BV8A 4ZU3A 1X7YA 3FG9A 2XRCA 1LS6A 3PUWA 1UBTS 4HJRA 3EXG2 4RPGA 1KOFA 3GFRA 4R9SA 2ZW9A 4D25A 2GN9A 3EXEB 2BD0A 4JJ6A 1LTQA 4ND5A 4P3YA 5NULA 3JCZA 4AJ9A 2HA5A 3NTQA 4QRIA 1I1HA 1LDMA 1PHRA 1U4NA 2VAPA 3BXHA 5DISB 3SEFA 1F12A 5A1JA 2HX1A 3QPAA 4DBVO 1V37A 4H7EA 2VIIA 3UANA 5LB4A 3D0KA 2HN9A 4RW0A 3K6SB 3VPBA 5KC9A 1L7QA 1U7HA 1CX9B 2I1WA 2RG1A 1DTWA 4HAOA 4WK6A 4BNJA 4PPYA 5L6LB 3I2GA 1U2SA 3ODGA 3ZDYB 3ABZA 3BCRA 2H92A 3JRXA 4DBLC 2Y1KA 1MIOA 4Z99A 5K1ZA 1M34E 3Q7SA 2WV9A 2HO4A 5TDHA 3SC3A 4YV1A 1EUCA 1YVPA 1M6EX 1YBHA 4D7AA 4EI8A 1KMMA 4UZFA 1Z8NA 2FZKA 1M2KA 5D3ZA 3FW1A 3A2NA 3I4FA 1G7RA 2ZIVB 2OE2A 1A4RA 3CINA 1LI7A 4HUQB 1K2WA 5KZMB 4RIEA 3GFTA 3G79A 2NU2I 2CNKA 1DTSA 1W5TA 2GN8A 2OHXA 1A9XA 4A4DA 1KZ1A 1A9YA 2P8SA 3T9CA 4DYVA 3DUWA 5IARA 3NOVA 4MAMA 3WZMA 3U16A 3AP2A 2HV9A 1J0DA 2V74B 3OUTA 1WOYA 2HPHA 1H5QA 3QQ5A 4MW2A 3SIXA 4E31A 1OLXA 3GFPA 4LRQA 5SYNA 2ZUEA 1MN6A 2NTJA 3L82B 3TNDA 3D0OA 3RAEC 4IMJB 1J5XA 3JVUA 3KLBA 3RK0A 1YIDA 1TM4E 3WSTA 2W2PA 4C0WA 4DLBA 8AT1A 1PR5A 1XELA 4I1UA 5GJVC 5AOAA 4N76A 5FXMA 1YQEA 2HM7A 4S1TA 5K3EA 3D6UA 2AFVA 2BDTA 5MDHA 2VPZA 5AHRA 3PQEA 4REQB 3B9PA 3V1LA 2OECA 4NPAA 4CQJA 1TCAA 3RHZA 2Z8YA 1GGKA 5L7YA 3W2HA 3OSZA 4FS8A 2GFHA 2X3YA 2AZXA 2TMGA 2JIDA 3FPBA 2ZJFA 3IDAA 1W34A 4ESHA 1QGZA 4NAHA 4EH1A 4A23A 1WXHA 3KAKA 5BNZA 4YJHB 4U00A 3RTAA 5FFFA 5JCJD 4ZMSA 2QLJA 1RR6A 2ZDQA 4MS4B 2CZGA 4PSKA 5JISA 3SXJA 4AMYA 5ELXA 3UT5A 1JA0A 1SUCA 1CDOA 1CUEA 1YMQA 1XU4A 1WSAA 2RI6A 1NLFA 3ESQA 4O4HB 4EBFA 5A1TA 1TKRA 5AKIA 3S2GA 3RJZA 1PJ4A 3L3BA 1EPUA 1JZSA 3ADCA 2H4HA 3T9AA 1A5BB 3UJ7A 1FP6A 2A88A 1ISJA 1VL8A 1A7KA 3BTOA 1VTKA 4MIEA 3LC7O 5B57C 1JYSA 3A4IA 4XZ3A 4UHFA 4HLQB 1QGDA 5DXJA 5GAJA 2ZIXB 2V9CA 3KR2A 4P7GA 4ZT5A 2RGXA 3RROA 4C0XA 3BN3A 2X9QA 3RWOA 1G9XA 3I4CA 4I14A 3RK4A 3STTA 1QQBA 1X1BA 3IJ5A 3CRQA 5JAHA 3MCTA 3UXYA 3W06A 3B82A 1JHZA 2LUOA 2JGDA 4HATA 4RK7A 2HU2A 3WWPA 4CN9A 1Y7TA 2QS9A 2GZ3A 5B36A 2AYYA 3NRCA 3OKFA 4B7ZA 4D4GA 4HS9A 3H0CA 3ZXYA 4MSUA 4JVLA 2VXOA 4ZYZA 1P5JA 1B8VA 3RWBA 4V0QA 5JI3E 4WZZA 1Q0PA 2D74A 5IVIA 2QTNA 3C43A 5J4HA 5K0SA 4I1OA 3EPKA 2WWTA 3BRCA 3UOAB 3WOHA 1GCGA 3ZIDA 4CL2A 1E5DA 2F3PA 5DP2A 3IAM6 3JZFA 4MUBA 1H8HA 1E92A 1IRIA 3I30X 3UHJA 3ZOKA 2VF5X 3K9FC 2QPAA 1MPTA 3GMTA 3N70A 2DUNA 3TLGA 3ZNQA 4Z3DA 1CF9A 4B45A 2ORYA 4UM5A 4B0OA 1G8JA 2VUIB 3BK2A 3L4KA 1ZH2A 4C6HA 3CR3C 1LJUA 3BB3A 4INPA 5EJEA 5K3BA 2X0EA 1GTSA 2HHLA 3GW8A 4AX4A 1BDJA 4WBXC 2FEAA 2PU7A 3HV2A 3D7RA 1UDRA 3NWEA 4UHHA 3W7AA 1FDSA 1GZUA 1ODTC 1Z4JA 3GA5A 3N7AA 4PNEA 4HRXA 5JS6A 1P72A 3O8NA 4QBHA 1PR3A 5BMOA 3KSMA 2PRIA 5I9LA 3LDHA 4FHDA 5DLQC 4UC0A 4JBGA 5D7NA 1E32A 1MRSA 2PWZA 4JP2A 4ZAVA 4Z1MA 4IH4A 4R71A 1OAOA 4AY6A 1HQCA 2NZ8A 3SE0A 1U3FA 2WVJA 1H9BA 1LI5A 2FLKA 3Q2IA 1Z6TA 4G0PA 3ULKA 1QKKA 3SKYA 3ZZ0A 2WYVA 1H1TA 1TW3A 4OGGA 1FYVA 5LQUA 3GA0A 3HM2A 4OQMA 4DA6A 1E4YA 3P2OA 3DVSX 4B3BA 2BSQA 2OQ2A 3CX4A 3AI3A 5ICSA 4B81A 2YWXA 3BL8A 4L4ZA 4DILA 4GP7A 1O57A 2H1LA 3BJIC 4DNXA 1H0RA 1FYFA 3I9V1 4XSHA 3QVJA 3KL4A 2ORIA 5AKLA 2L17A 5ALTA 1A7JA 4QDOA 3DYBA 3OEEA 5DGTA 1Q7GA 2CYCA 3WISA 3A7EA 1PR0A 2BR4A 2J4FA 3EIWA 3HWWA 1YIAA 4DCJA 5IDWA 3U0BA 3UMMA 2CDBA 4DDUA 2FOXA 2QRHA 4FHZA 3EFEA 3UATA 4D96A 5IVDA 3D54D 4LZAA 4U6SA 2R1TA 1UBOS 2B9EA 2QJFA 2WM9B 3AT1A 3OJLA 4E46A 3BH7A 5BOSA 1S2DA 4GMHA 2JFOA 5C2JB 5EMKA 5JNVA 4K6OA 3WMGA 3SZGA 3VR3D 4I9UA 3CMCO 2R84A 4WT7A 3EUWA 2NWQA 4PYLA 4XFKA 3PR3A 4W4TA 5JV5A 5DBOA 2UVDA 4IOKA 1I4TD 1UJBA 2VSFA 4BO9A 3BA6A 4XB2A 2WUVA 5IT4A 4B6PA 5E95A 2FQYA 3UMYA 4OI4A 2ODNA 4ALIA 2Y0PA 1PDWA 5C7IO 4R8KA 2QAGC 4HDAA 2DFLA 2C58A 4H7HA 4AMGA 4WOPA 4BAGA 4ND4A 3A2KA 2PNJA 1SVIA 3ENZA 2CD9A 1Y1LA 1XE3A 2EF1A 3GRKA 3SEAA 3TD6A 4GKAA 4OHMA 4FFNA 5FBRB 2FPKA 3CKKA 5AM2A 3O8OB 3QZUA 1KMNA 4TMTA 3SFTA 4PRLA 3SX2A 4BQFA 4M54A 1OXMA 4F86A 1FFDA 1U5CA 1BGWA 1DL5A 2X0IA 4QT4A 3F9IA 3KSRA 4AZ0B 4QGBA 1T8UA 1MV5A 3DPUA 4BNFA 2YNMA 3TVYA 3WYBA 3UMFA 1XFDA 2WNHA 3DXYA 3WA6A 4AUEA 1ADCA 1QH8B 1ZC3A 3OZXA 2H0RA 1KPGA 2G8LA 2NU7B 3NVDA 3QUCA 2RARA 3PYLA 4G41A 4OLHA 3AFMA 2M1ZA 3WKCA 2ZXFA 3VR2D 4ZCLA 3T52A 1DC4A 4JVOA 4HQ6A 5IHXA 3DF9A 2QAJA 4DR2B 1N6KA 3HJHA 4K88A 4PZZA 1K8QA 4WV3A 3OH8A 5DV9A 4Q3KA 5JR3A 3R3YA 2GNPA 3C98A 1EIZA 3K0FA 4JOBA 1THGA 1ZKDA 4U9IS 2Q8NA 1JH8A 3L5KA 1ZK3A 3ZGZA 2WI8A 4WLFA 5AJZA 4BJ5A 3ZIAA 2LDXA 3OECA 2ADOA 2GPYA 3W5HA 4EK9A 3BKWA 5AP9A 3ONFA 1NN1A 5J4YA 1U0JA 4I6GA 4P6VF 4G1CA 4M0MA 4NJMB 3NC4A 1SKUA 1VJ5A 3TK1A 3OY7A 2PPLA 5K0TA 1I51A 1RFHA 4TXHA 1WVGA 1U9CA 2J0EA 3ETGA 3HACA 4XW2A 2SGPI 2O1WA 1P0CA 2NZYA 1NXSA 2QN1A 3G2OA 4OOEA 3VOSA 5B12A 1BXZA 3CM0A 4WDRA 1OJ7A 2FSSA 2GSDA 3BRSA 2EYUA 3EUAA 4MA5A 4EB8A 4JR1A 5AOVA 2C7QA 1BFDA 4UPEA 3LY9A 4ZI3A 3PT5A 4Q1VA 1Z4KA 1K7VA 1J2YA 3BGDA 3ESCA 1ABFA 1GGEA 1G4UR 2O2SA 1SKAA 1GV0A 3TH5A 1GKLA 2IX9A 3E22B 1AA9A 4MP8A 1K5HA 4BNTA 3K72B 5IABA 1KI1A 5F51A 4Q18A 2V7EA 3N8KA 4P9NA 1OD6A 3I6QA 3O8QA 2PQ8A 2DPGA 3U40A 3ETLA 3NDIA 4IDEA 2W8BA 4TV8B 3QBTA 3N8GA 2A6PA 5H83A 1P19A 3FZQA 2IHYA 3F5DA 1VCIA 4LQ4A 4BMYA 1A04A 1CFJA 4RTPA 2RH4A 2WZQA 3R76A 4IV5A 4EW2A 4LFCB 3MJFA 4BKPA 1L8AA 2AK2A 2J0UB 2TMKA 1FDVA 4WRRA 3W7VA 3O3MB 3KJEA 5DBHX 1GZ5A 3T0FA 5DM1A 3ZV5A 4K46A 3RTGA 3BPSA 4EHFA 1DWQA 2AB0A 3FCXA 1NSYA 2CLCX 1OGYA 3OE1A 4NJEB 4PGHA 4UBKA 5BSFA 1MPXA 5EMHA 2BGWA 1R12A 3C8UA 3SJAA 1AGRA 5EP4A 5ECDA 2H07A 2AJ8A 1VCNA 2PZMA 3MWGA 1Z5WA 3OOSA 3GARA 3ZHYA 1S8AA 1G8AA 2QQ5A 4BVFA 3AFGA 3RVLA 1F51E 2H1SA 1RXCA 1TQ6A 3CNBA 2X3TA 3WIBA 5KU7A 3BOSA 4ENPA 2QI9C 2IDZA 5A9SB 1ACMA 4M9QA 1KORA 4FLFA 4NI5A 1PSZA 1VHDA 4U3JB 1AHIA 1FL9A 1Z28A 4OQPA 4RPIA 4EVQA 4DIKA 3I6YA 3KLNA 3A70A 1FP1D 3KM0A 1CNMA 4TKVB 5G41A 4DRXA 4KWTA 4B4DA 4A92A