5FUWA

Catalytic domain of thymidine kinase from trypanosoma brucei with dtmp or dthd
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
168
Chain Sequence
AHGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTGDTLTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 53
structure length 168
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuwA01
2WJHA 3MRSA 3I61A 1P9RA 1A2BA 4E22A 3GLFB 3UK6A 2WWHA 1AA9A 5F2EA 1R5OA 1EFHA 3WBJA 3QXCA 1TF7A 3EWAA 1NKSA 4FMDB 5JFGA 3CPJB 4OI4A 4IVQA 1XZQA 4NCJA 2N42A 4URWR 3CZPA 2VEDA 1OXXK 3IILA 1EK0A 2FZLA 1KDOA 3G5UA 1OFIA 1LFDB 2EFDB 2VTKA 1NP6A 3BH6A 3LX5A 1E1RD 3BFXA 4B47A 3VR1A 1KAGA 1F2UA 2P5SA 3EZ7A 1E3MA 1W36B 4B6DA 1ONBA 3SN6A 4QM6A 1II8B 2OFXA 1OH8A 2FH5B 5CJ2A 1XTRA 2QM7A 3DPUA 3RABA 2WHXA 1KTVA 4OHWA 1YRBA 3QEOA 4OHVA 1KKMA 4P33A 3QKUA 4M1MA 1CU1A 4C0SA 3QJYA 1KGDA 4DIDA 4D6PA 4D4MA 4PZZA 5JBQA 2ZROA 4HAUA 4POAA 1EFTA 4B43A 4C0AC 1U0JA 1SXJC 1FQJA 1ZU4A 3VX3A 4IOJA 1ZU5A 4YMSA 1XNJA 2REOA 5D3QA 3VHLB 3GJ4A 4X8MA 3R7WA 2V8OA 4II7A 3AGPA 3LVQE 5G40A 5JSZB 1KBFA 2IBMA 3EIEA 4PC6A 4RY2A 4HDQB 2YKGA 1FUKA 1NBMA 4DC9A 3QNUA 2OT3B 1ZRHA 4NCKA 2IS2A 2HV8A 4HYYA 1E2LA 5F98A 1H8EA 4B6FA 5FOVA 3GPLA 2OBNA 1P60A 3L8ZA 4PPGA 4LPKA 2W2VA 1G19A 2VP9A 3TQCA 4YDSA 4B3BA 2WWIA 5FUXA 2DPXA 2ZI4A 2YJTD 2C78A 2FMXA 3D3QA 3BC1A 5CIWA 2QE7D 4DCNA 1LB1B 2JJ8A 2X2FA 2ZSFA 3FKSD 1VCOA 3T1QA 3A37A 3K0AA 3K9LA 4FMDF 1Q20A 2NG1A 3ND9A 3QVUA 5IK2A 2BBSA 3UGLA 1R5NA 1N5IA 4B3FX 3QSYA 2GCPA 2UZIR 4TLCA 4MDEA 1PTQA 3Q9LA 5D3MA 1ZNYA 3UIEA 1CRQA 2ODWA 1ZMXA 5EP3A 3UXMA 2Q9CA 2X19A 4Q1FA 3ZZUA 5FPHA 4BPBA 1QHSA 4IDQA 4V02A 5DIFA 1RZ3A 5JWOA 4O2LA 3PENA 4DDWA 5KSOA 1X1SA 1VG9B 4RZ3A 1PUIA 4GOJA 1W0JA 1KMQA 4WW0A 4OKSA 3A1VA 5BN4A 2GBLC 3HYRA 4M1WA 2VSFA 1IQPA 4D25A 5GJWC 2AK3A 2ZI7A 1DAGA 1SVWA 1GZSA 3WHKA 2FSHA 1YE8A 3CRVA 3TQFA 4DHEA 3F5FA 4G5QA 3T12A 4AC9A 3WP1B 1RRPA 2OCAA 5B2ZA 5BN3A 3X1WA 4QKQA 3N70A 3D6TB 3FMPB 4JJZA 4AY2A 2DHRA 4HEJA 4RD1A 3W3ZB 2LWIA 1E1RA 3DMNA 3RWOA 3R8CA 2ERXA 1YJ5A 1YZKA 2B92A 3CPEA 3ZZ0A 2C9CA 2GAOA 4DLSA 3GLGB 4C30A 3LO5A 5DO9A 1UBEA 5HZKA 2JGNA 1R4AA 2VSXA 2CLDX 1XCMA 3REGA 2VL7A 3VKWA 1TQ6A 1G1MA 5EXSA 3THWB 5CIQA 1CR4A 3JZMA 3HPRA 3WXMA 4EFNA 2OG2A 2HF8A 2IYXA 1BS1A 3CNOA 4EPWA 1UM8A 3AF1A 1NVVR 3B2EA 5DH9A 3SYLA 3QPVA 2QRZA 2UKDA 4MYTA 5AJYA 4YONB 2XGJA 1JPNA 1OB2A 3MWJA 4E5UA 2OE2A 2FA9A 1FTSA 1XCPA 3WHLA 1CTQA 2CJWA 5E7MA 4XTRA 1SXJD 3RRMA 3UMRA 1N0VC 5HPYB 4ZI2A 3U6BA 3R9IA 4BFVA 2G88A 2G3YA 3H4MA 3PITA 3GD7A 3K70C 4Q47A 4XVUA 3MMPA 4KFTA 4GZMA 2DB3A 1KI7A 3X1XA 1KO8A 1S9DA 1XEFA 2QE7A 3EC2A 3SEAA 2GJKA 4AD8A 1T0JB 2V55B 1Y3AA 2J87A 4PANA 1BOFA 2GZAA 4PQRA 3KXLA 4P31A 3PQCA 4Z51A 2P65A 221PA 1Q1ZA 3QBVA 1KK3A 1JI0A 1RYFA 3DOEA 3I8SA 2KSQA 1ZIPA 3QF4A 5DHAA 2YYZA 3ZVMA 2PEYA 3NBYC 1G17A 2ASEA 1MOZA 2GNOA 1ZC3A 3BIFA 4R2HA 1R8QA 3BAFA 4ZIRB 4BFZA 4BRUA 1W0KD 2GCNA 4GDFA 3CRQA 2PLRA 4QGAA 3I62A 2W2XA 3TSZA 1GVNB 1QHNA 1JJ7A 3ZQ6A 1GL6A 5JI3E 1KJYA 3CF0A 5FTNA 4X8OA 3EW9A 2AK2A 3R8FA 2CHGA 2NZJA 1W49A 1R6BX 4JZKA 2ZR0A 1SHKA 5JLJA 1G4AE 2VP0A 1A2KC 1G3UA 2Q9BA 1MRSA 4RKEA 1GKUB 1NF3A 2XTMA 2GRJA 3C8UA 3OEHD 1R2QA 5H1YA 4D4KA 1IJFA 1Q1QA 4R98A 1KSHA 4Q9HA 1HQYE 2PJRA 2YOGA 5AUPB 2ZI9A 4WA7A 4L9SA 5HE9A 1NMYA 4E07A 4RD2A 2EFCB 1M7GA 4M9SA 5DLQC 4A6XA 1MR3F 3MD0A 1RFLA 5KOYA 3EARA 3LDAA 1W1WA 4O2RA 3UKDA 3AM1A 1TAGA 1NSFA 2Z4SA 1DAKA 2FNAA 4RZ2A 4TMVA 3SOPA 2IX3A 2JAQA 3U61B 5FL3A 2WKPA 3M6AA 1D2EA 1QDEA 2Y8EA 2IW3A 4OQXA 2VP5A 4QGGA 4BQSA 1RPZA 4A2PA 3AVWA 4BASA 3BB3A 1VIAA 3X1ZA 4B74A 1TU3A 2IA5A 2BMEA 2YWHA 1YR6A 2WSMA 3C15C 3PVSA 4A9AA 1HT2E 3LFUA 3P26A 3O8CA 2GZDA 5GVSA 1VHLA 3I8XA 4F4IA 4B35A 3IKJA 3AKDA 1LV7A 1ZD9A 1E9SA 1AK2A 3K9NA 3EC1A 1NMXA 1SXJA 4KBFA 1TBNA 2WOJA 3UMSA 2V3CC 3CW2A 3DZDA 2F3RA 4HAXA 4RFSA 4WIAA 2BHRA 3K0CC 2XNDD 1NJGA 2YUUA 5EXXA 2CCKA 1XPRA 2MSEB 5FBVB 2IXEA 1J8YF 1GDDA 1GUAA 2C9YA 2V54A 2RHDA 4MH0R 5CK4A 2Q21A 4OL0A 1P2VA 1W48A 3MG9A 4WZBE 2IUTA 1DS6A 4OYHA 3Q5DA 1N5KA 2AFHE 4MRRA 1KY2A 3AGQA 5EE0A 3K70D 3ICQB 4PFSA 1G4UR 1XWIA 1KOFA 2Q6TA 2JCSA 2ZRFA 1RFHA 2VRWA 3LBIA 2EU8A 2HJGA 2HXSA 2ZJZA 1T5LA 1GILA 1TEXA 1U9IA 2W2TA 1XX6A 1HV8A 1KMHA 1R0ZA 1UBFA 3H1TA 3NHBA 2H5EA 4AYTA 1CXZA 1W0KA 3QKRB 3LX8A 1E99A 2GAAA 1FMJA 4DBLC 3GLIA 3CX6A 2BDTA 3AVTA 2OLKA 2UVQA 1E79D 4FI3C 2QROA 1CR1A 1N6IA 4L15A 1QHGA 4TZ6A 2ZIAA 3OZXA 4TLEA 1G7TA 2QY9A 4DRZA 3GLHE 2ZRIA 1MO5A 1XXHA 2ODNA 2VHUA 3CWZA 3TSWA 2WM9B 5EUMA 3W34A 1UEIA 3RNLA 1HE8B 1F5NA 1EFRD 4M1YA 5DYIA 3OEHA 4YMTA 2FJUA 4L9MA 5FBQB 5JI2E 2G0TA 2L0XA 1DG1G 2OESA 2QAGB 2DWQA 4IXMA 4Q9KA 1Z2AA 1XMVA 2F43B 4WVFA 2D7DA 4OQFA 1FZQA 4A0HA 4Q7KA 2ZRHA 2QTHA 4PO9A 3SYKA 4ILEA 3AP1A 3ZYCA 5KPJA 2BEKA 4JLMA 1AZSC 2O8BA 1HH4A 4C0KA 4EDHA 3AB3A 3NBZC 1H65A 2PCJA 1VG8A 4U02A 1DARA 3X2SA 3K0FB 5KUTA 1JB1A 4OHXA 521PA 3B9QA 4CEHB 3MWYW 2TMKA 3MGCA 1OXVA 2OEPA 2ZETA 4Q48A 1CR2A 1G21E 3FYHA 4NBSA 3REFA 1D9XA 2FSIA 2PH1A 2RH5A 2OXCA 3EXAA 3SC3A 3X1DA 1NKTA 2LKCA 4NYMQ 4QBFA 1BIFA 1KAOA 1KI8A 1NBME 2IEZA 3LWNA 2ZI5A 2WIAA 1P73A 4JT4A 4DIEA 4OQLA 1TX4B 1Z22A 4NHOA 3U3JA 2NZ8A 4YMWA 1Z0AA 2QRNA 4KODA 1KNXA 3LA6A 5FOSA 1D2NA 4GZLA 1E2KA 4JLAA 2XNDA 1JXOA 2Z4RA 1S0UA 2VSOA 1LY1A 3CRW1 3FE2A 4LUCA 1Z6YA 1S2MA 5EZ5A 4H9GA 4MGKR 2ZS7A 1Z8FA 1RRGA 4IW3B 3BE4A 1GOTA 2ZYWX 2G9NA 3SJCA 2JLSA 4PPNA 3OAAD 3A1UA 1NN5A 4C7OA 1X3SA 3HJNA 3LD9A 4D80A 1L7VC 5JJKA 4OBEA 4OK5A 2ORIA 5L3QB 1N5JA 3LNCA 2I3BA 5A0FA 4N0DA 3HU1A 1Q12A 3OIUA 1CULC 1KYIA 3PUWA 3QKSA 1R7RA 1W4CA 1T6NA 2SHKA 4KHZA 1NY6A 1OH5A 4UQOA 1OW3B 1P75A 1ZUIA 3IO5A 5FOXA 4LRWA 5FI0B 1SQ5A 1KKLA 1W2HA 2B21A 4Q4JA 3TH5A 4CVNA 4URZR 2O8DA 4G5SA 4GNKA 1E79A 1R0WA 4LJAA 2LCFA 1R79A 2OAQ1 3VMFA 4KSCA 2F7SA 2HT1A 3ZS8A 1BO6A 3H84A 3UFFA 1KHTA 1NIPA 2WJIA 2WWXA 3U3RA 2WKRA 3U3OA 1KSFX 4M1SA 2CDNA 3K0EA 4OQNA 2V6JA 1EFRA 3NVAA 4G1UC 3SFZA 3HP1A 4LJ7A 2W6JD 1AZTA 3T1VA 2R2AA 4CEJA 2ORWA 4HAWA 4QG7A 5A4JA 1Z0KA 3W5JA 4WOPA 1G7SA 4NCIA 1VMAA 2PJZA 3GJ3A 3SS8A 1YVDA 3SJAA 4G5OA 4XVRA 3OEEA 2BM1A 2AKYA 4HLCA 3EAQA 4C0QC 2R9VA 1R0XA 2V7QA 3KKPA 3SDZA 4Q9LA 3TE6A 3EPLA 3DM9B 3CIOA 5DN6D 3QE0A 2ZREA 2JJ2D 3FMOB 4JLVA 2HCJB 1G18A 4JVLA 1L2TA 1ZM2A 1MRNA 1ZVQA 5G3ZA 4ZKEA 4BLQA 1Z5ZA 4XWAA 1NVVQ 1KNQA 2Z83A 4TMZA 5SZJA 4CEIA 5DGXA 1MABA 4ZCLA 4B33A 3LQQA 3IBGA 1QHHB 3FB4A 3LV8A 2IYWA 3W8RA 5BYKA 5FTLA 2ZJ5A 1TQ4A 1M8PA 1NN1A 4HDCA 3ADDA 1Q1BA 5CB8A 1T8TA 3KJHA 2GZHA 1PZNA 2MMCA 3PEVA 4I1SA 2GVZC 4JVSB 1GKYA 4WAUA 1AS3A 2C04A 4FCVA 1OXTA 3HR8A 4A0RA 1XD2A 1P4SA 3KTAA 4M9XA 3I5YA 2QT1A 2ZR9A 3DL0A 3ONWA 4DKXA 2QTVB 5JCZA 3EIHA 2OCBA 2FEOA 3Q7PA 1XRJA 3ZGXA 4BFSA 1NN3A 3OAAA 2GF9A 2WAXA 4TWZA 2IEYA 5FTMA 4O3MA 2VHQA 1G291 1GRQA 3K0CA 3C4JA 2ZSBA 2IK8A 1E69A 2C96A 1OJLA 2GCOB 4D0GA 1C1YA 1UDXA 3KQNA 1Z2CA 2CXXA 4P4SB 4CDGA 3NC1C 2ZI3A 4TLDA 4V0LA 2QN6A 1G7CA 4QBHA 4R2IA 4XJXA 2VHTA 5FBWB 2DBYA 1JXMA 1HTWA 4DUGD 2ZPTX 3Q72A 4LGMA 3VHXA 3H2YA 2O8FA 5JEDA 2P6NA 3VAAA 4P0TA 3LW8A 2O5VA 4Q1AA 3EG5A 2PT5A 2XXAA 5DI3B 3ZJYA 3CF6R 1G8FA 5H68A 3QENA 4NE2A 1XJCA 4RSGA 5FL7D 3T5DA 2W6JA 4FIDA 4M2LA 2Q0HA 3PUXA 4F91B 2IWHA 4AI6A 2ZUBA 3QKTA 2CLSA 1P7CA 3K1JA 2CVFA 5JWRA 5G3YA 5BXQC 4A8JC 2X77A 1KI6A 1FPMA 3NXSA 2P0EA 4F7WA 3TVTA 4BWYA 3QOFA 3W3AA 1F2UB 3KJEA 3TRFA 4TYYA 5DN6A 4UXHA 4JBXA 2ZU0C 5FPSA 1E2PA 1P9WA 2KJQA 4NCNA 4IKEA 1XTKA 1T3LA 1SVKA 5FOWA 3NH9A 2YNMA 3TMKA 1XB2A 2NOAA 2QMHA 5J4LA 1G5RA 1DG3A 1S1MA 1CJUC 2XZLA 2WIBA 4TT3A 2ZJ8A 3QPWA 2D2FA 4DT1A 2GWHA 3LY5A 2XNSA 4G01B 2A9KA 4QOSA 2OUKA 2QMEA 5ANRB 1PLLA 1ZD8A 3IPYA 2C03A 2VLIA 4D0LB 1AS0A 1SXJE 4BLSA 2RGAA 1VCNA 4MKFA 4Q03A 1U8YA 2CL0X 4FWIB 3ND8A 2RGNC 1OYWA 4X8LA 4PXAA 3RDPA 3AV0B 4EQ6A 2GHIA 3BK7A 3LVRE 1Q57A 2QPTA 1OH7A 1XD8A 1YR7A 2H17A 4GP6A 4CT4B 1I2MA 1KZ7B 3QXJA 4TQ9A 1UKVY 3W90A 2BMJA 2ERYA 3RRNA 2B8WA 2P6UA 4MYHA 2WWYA 2GJSA 4MYUA 4B48A 1OLOA 2B6HA 3D7MA 4B6EA 4P32A 1OFUX 1D2MA 1X8KA 1AIPA 1IN8A 2ZRMA 5LB2A 4YMUA 2X8AA 3K0AB 3TGPA 5G41A 3KDSE 4YXWD 3SQXA 2G77B 2JJ1A 1J8MF 1XZPA 2FE4A 2IYTA 2VHCA 421PA 4B73A 2A5FA 4A92A 1U0LA 2UZ3A 3EZ2A 5D3MB 4OHZA 4ERNA 2VP6A 4DUGA 2IXGA 3KJIA 1W36D 1TL7C 4Q1CA 2LKDA 4E03A 3GLIE 4JLJA 2J0VA 1T4GA 3CONA 5FOTA 3U3MA 4TSFD 2VP2A 1PTRA 2IF0A 4BLTA 4DLTA 1VKJA 2AN9A 3CKLA 1KK1A 1OPXA 2GESA 3EA0A 1XXHE 3IUYA 3GEIA 3MAAC 1FQKA 4IDNA 4ARZA 4B44A 4PHHA 1G5PA 5FL7A 1YZGA 1OF1A 4FKDA 1KI4A 4IOMA 4NP6A 4QGFA 2KWIA 2CNWD 1ETUA 1GL7A 1OYYA 4XOIA 4LYHA 3A1WA 4PHTA 1P61B 3N2EA 2P2LA 4B3DA 1EXMA 1XEXA 3KQHA 1W4BA 4PX9A 3THXB 2ZSEA 4TZ0A 1OIWA 3ZQJA 4AYXA 4NU0A 3KKNA 1DTSA 3S1AA 3T61A 3TVDA 3P20A 2WZQA 2BOVA 1SGWA 4M1TA 2GXAA 4NYMR 4PPQA 5E95A 4HZIA 4B2PA 1NLFA 1FX0A 1XCGB 2FZ4A 3OFND 4QC2A 2GXQA 2WVJA 2H8KA 3NBFA 1WA5A 4QNMA 3SYNA 5FTKA 1ZM3A 5FR2A 4IOKA 2NO9A 3EPKA 4IDPA 3UG6A 3L82B 3AQ4A 3LQRA 1A1VA 2QT0A 2P6RA 1V5WA 2JLZA 1W47A 3VR5A 4HSEA 2WWFA 3RLFA 5JJIA 1ZW6A 1NLZA 1AS2A 1U9IC 4DLUA 5K8UA 4QXAA 3HU2A 4CW7A 4BFXA 5EUQB 2V4ZA 2RGDA 4MA4A 3PEYA 1HEIA 1CJTC 1OXUA 3U5ZB 1RE0A 1E9EA 1OIXA 2XITA 2QGNA 4EIWA 2BEJA 5EP4A 4JSYA 4AG6A 4B75A 4HZUA 3THOA 2CJWB 3WRYC 1EWQA 1U81A 2ZUDA 3L0IB 5BWMA 121PA 3SHWA 3GLFA 4PC3A 3O8DA 2EW1A 3KQKA 2GK7A 2ZSDA 2ATVA 2VPPA 1EFCA 2RAPA 4XWOA 2QNRA 5GJVC 2R6GA 3ZVNA 3IO3A 1EG7A 2WMOB 4H1UA 4JMPA 2QZ4A 1E6CA 4JKIA 1N6PA 3RHFA 1Z6AA 4YXWA 2ZEJA 4BZQA 3B9PA 2KI5A 4L16A 3ADCA 1II9A 5K8IA 1E2HA 3AKYA 2D3WA 4DSOA 4BFYA 3K0SA 1T9HA 4RVCA 3B1VA 1IY1A 1RJ9A 3WNBA 4B2IA 4B3GA 3LLUA 4IFBA 3KKMA 1DBSA 3EZFA 4Q01A 2ZJOA 1N2CE 2PT7A 3RVBA 2ENZA 3TSOA 4TYWA 1A5TA 1NRJB 2HJVA 1AQUA 4EFMA 1GM5A 2QMUA 2PL3A 4HUQA 4TL7A 1Z83A 2WICA 2J1LA 4PC1A 4AG5A 1GWNA 4MUAA 3A36A 2CNWA 4F93B 4TYNA 5AJVB 3GEHA 2A5JA 2QBYB 2ZJYA 5FPTA 4BECA 2A2ZA 3J81k 3SBEA 4NYJR 2OBMA 1QRAA 4DB2A 4KXFB 4KI0A 3GCGA 3PIRA 4M21A 1UAAA 1JAIA 3L2OB 1P2SA 2YZ2A 3C5CA 4OJQA 4UNQA 3T15A 3CX7A 4BLRA 1E2MA 2RGCA 3AEZA 1G7RA 4LHVA 5FUWA 1AQYA 3IHLA 3RS0A 1B23P 4MQBA 1XF9A 4PO1A 1I4DD 1TPZA 2AHOA 1CJVC 4A8JA 1G6HA 2B8TA 3M4YA 3T06B 2N46A 4V0KA 4QGHA 2WMNB 2AKAB 1Q22A 1C9KA 4U00A 5G53C 2CL6X 4FMCF 3IQWA 3FOZA 3QG1A 2ATXA 3FKSA 4LSGA 2FFHA 2WKQA 4NONA 4BZPA 2WJJA 1RIFA 1U0HC 4LJ9A 2CL7X 5FUYA 2G83A 4I81A 1F6BA 4TLAA 4LDJA 3DZ8A 1E96A 4CYMA 1IXSB 1GITA 2ZTSA 3HYTA 1Z6XA 1KSJA 1SXJB 2JLQA 4M53A 2QP9X 1XTQA 1QG2A 4EPXA 5KDLA 3SQWA 4GOKA 2RGGA 2X2EA 2QUZA 4PZLA 1GNPA 2E73A 2RGNA 4DCUA 3R9XA 2R44A 5CYOA 3NEJA 4IEEA 1WRBA 5JCPA 4ON9A 1FFHA 1QVAA 4DEXA 1N6KA 3N2IA 4N0EA 2AL7A 1CP2A 5GADl 5FPYA 2YOFA 1IY0A 2BKEA 5JMTA 2J0QA 5HE8A 2W83A 1ZM7A 2VRWB 2V1XA 4G5RA 2AD5A 4W5HA 1P2TA 3HWSA 5FBRB 5AUNB 2G1JA 4IFEA 4CF7A 2IYRA 2DFNA 1P62B 2FN4A 3GJ6A 3THYA 4DB4A 3CB4A 4AKHA 1N6NA 5CJPA 2BCGY 2O52A 4PTLA 3GLIB 3Q7QA 1I4TD 2D06A 1ESMA 1RRCA 1DOAA 2Q9AA 4OQMA 2Q3HA 2XZPA 3C5HA 1E2DA 1OXSC 1XXHB 3QI2A 3KB2A 4EJSC 4B3CA 2AWNA 4C2TA 4TQUS 1TNDA 3IIMA 4MUBA 1M7HA 3CPHA 4QJ5A 4A2QA 4QM7A 3CR7A 2OCPA 1VDZA 3EWSA 2IYVA 4C0BA 5GJCA 1U90A 1FP6A 2BVNA 3Q8XB 4LYAA 4RZXA 1VG0B 4QHYA 3I32A 4Z8XA 4A1FA 5AUQA 4DXAA 1P6XA 4A2WA 2FU5C 2F55A 1E0KA 2YOHA 5FOUA 1K8RA 4FCTA 3FHTA 3CF2A 1ESNA 1D6JA 2CMKA 2GK6A 2YV5A 3EASA 3KJGA 3LXXA 4RKFA 4MDFA 3KB1A 3U7GA 1ZNXA 2O8BB 1G64A 2J0UA 5KNBA 1E9AA 5IRCD 2CK3D 1NNEA 5AWFC 2E87A 3HR7A 5DISB 1I2DA 4GMXA 3V4RA 3BERA 3E70C 4CZ2A 3A4LA 4IDHA 4Q4AA 3NDBB 1GRRA 5J47A 3U44A 2RCNA 2HYDA 1WQ1R 2BMFA 3QY0A 4TMTA 1F2TA 4JYCA 3B1YA 3TAUA 2QL6A 2GXSA 3C7KA 4KVAA 4HAZA 4Q18A 5L3SA 1JBKA 4BUJA 5DNYB 2ZE5A 3AKCA 3U4QA 1Q21A 1XPUA 1IY2A 3KXIA 4US1R 3KZ1E 1T0HB 4GPTA 4QBGB 2F1RA 4PO8A 1VG1A 1ZD1A 1FMLA 2ZYUX 1LS6A 3IGFA 4B32A 1N3BA 1SKYE 1CKEA 2DFKB 2F6RA 4PQFA 3SBDA 1JPJA 4DSTA 1G5TA 1L8QA 1F48A 5JEEA 2IWRA 1R10A 5TDHA 5J5CA 2DWOA 1W46A 5JRZA 1X86B 2OM2A 1E9RA 5JZVA 1O87A 3T34A 4ABYA 3SHFA 3SI7A 3K70B 1S96A 2FFQA 3A1SA 1BKDR 3SFVA 4Y0VA 2QAJA 1EX6A 1K6MA 4B3XA 3AF2A 4KFRA 2J9RA 1CLUA 3B82A 3MFYA 4GOXA 2JLRA 4GRAA 2XB4A 5L8VA 2OXRA 2R8RA 3GFTA 1VYVA 3UEJA 2OSBA 4DDVA 3GJ7A 4L8GA 3AF3A 4Q4JB 4RFVA 2KE5A 2O8DB 3B1ZA 2QI9C 2D4HA 3FMIA 1UKEA 2HUPA 3FFAA 1W5SA 3HU3A 1N6RA 2GILA 3OIYA 4Q4HA 1KO1A 1ANKA 1ZP6A 3DDCA 4JLBA 3TUIC 4GL2A 2OAP1 3FTQA 2F9LA 2GJAA 3CNNA 4R71A 1G6OA 3VNUA 4CEJB 1MO3A 1HQCA 2ODBA 2F3TA 4YLGA 4LJ5A 4DLYA 1KI9A 1UKZA 1GP2A 4HDOB 1EFUA 2VF7A 3KKQA 4OHYA 1NVUQ 4JVMA 3RS4A 2PZEA 4CGZA 1US8A 2BBOA 3QF7A 4NPHA 4XIGS 3QIAA 3SZRA 1JR3D 3ICEA 4MKIA 4XD7D 1Z0DA 3TR5A 1U2RA 3W6OA 2CK3A 3PEWA 2ZRKA 1XMSA 1ZYUA 1KJWA 3B13B 1E4YA 1Q3HA 2NTYC 4A0GA 2AX4A 3TAHA 1LNZA 4LI0A 2RKOA 5FPKA 4IXNA 3KUDA 2DWPA 2O0KA 4P4TA 3RS3A 3AVYA 4CEIB 4Q1DA 2RMKA 1MABB 1CR0A 2VA8A 4NL4H 4M8NE 3A8TA 1E1QD 3QUSA 2ZRJA 3O8BA 4TN1A 5L3RA 4IRUB 2GA8A 4GFDA 4L4UA 1CS4C 4EPRA 1E94E 1DAFA 2OZEA 3QKRA 1TBOA 4M4SA 4DSUA 2JLVA 2O8CA 1EGAA 2IHYA 2XZOA 2C8VA 1AJEA 1E2JA 1G8YA 3L43A 1U8ZA 3Q5EA 1J2JA 1YHNA 1SZPA 4MKHA 4BFTA 1XD2B 3T1OA 3KTAB 4LV6A 3ZZTA 2J7KA 3QPUA 3WMFA 2R6AA 3OESA 1XFAA 4OI0A 1U94A 4KFSA 1NN0A 1E2QA 1WCV1 3CM0A 2ZJ2A 4HLUC 4LBYA 4G0NA 3TLXA 4A6PA 4UNPA 3FDIA 5CYPA 1W7AA 1N6LA 3LBHA 4FMBB 2YC4C 5DSZA 3FHOA 4PPFA 3AVUA 3AVVA 1EESA 2REBA 2CLCX 3KFVA 4Y0AA 1HUQA 1PLJA 1JEEA 2AXPA 3BH7A 3MCAA 4MRVA 4CT5A 3SJBA 5BN5A 4A36A 4ZKDA 4LJ4A 2ZQ5A 3U7EB 1E2EA 3DKVA 5LD2C 5KTYA 2GJ9A 2HXYA 1Z0JA 2Q3MA 3AH8A 3QXSA 3O47A 4Q66C 4C0JA 2O8FB 3K8YA 4DCTA 1FTNA 4XTCS 4UXIA 3GMTA 5LPNA 1C4OA 5FBLB 5HCIA 1BMFD 3TUJC 3WYAA 2XXAB 1S3SA 1PV4A 3WP0A 4KSBA 1AKEA 4DLXA 1KJZA 2YWFA 4NYJQ 2IL1A 2FDCA 2BM0A 2WOOA 1GAJA 4HUTA 1DADA 3CX8A 3FWYA 1T3SA 2EWWA 1PJRA 3BWDD 1LVGA 2NO0A 1VPLA 1ELOA 3IHWA 3WMEA 4AKGA 4NKRA 1UADA 1OB5A 4EJSA 1G3MA 2BBTA 2FF7A 4BFWA 2IS6A 1KI6B 1AGRA 1G8PA 5IF9A 2ZS9A 4CIDA 1JR3A 4Z1MD 3ZH9B 5L3VA 2GF0A 4MITA 1TUIA 1GIAA 2C98A 4WXRA 4XD7A 1E98A 3RS2A 3VX4A 4O0MA 4GMDA 2WTUA 3WRXC 2H16A 721PA 3JVUA 4W9MC 5J40A 1P5ZB 1T3HA 3AVOA 5TXGA 1S3GA 3PR1A 2DFLA 2R65A 2ODEA 1FARA 4RCZA 2MMGA 4M9ZA 1DPFA 1E1QA 1VECA 2OFOA 1W36C 1S4QA 2YWEA 4MGYR 2ELIA 1IXRC 2D74A 3C14C 3LBNA 4JVNA 1WXQA 4LV5B 4I1OA 4ASUD 2VHJA 3BB1A 4MGIR 3G82C 3Q3JB 3G0HA 1X6VA 2WV9A 3LLMA 3B7GA 1B0UA 4QBIA 4F92B 2XX3A 1CJKC 3W8NA 2RHMA 3EPHA 1OKKD 4IDOA 4DLWA 4PSAA 4PSVA 3UGDA 4EQ6B 4BFUA 1DO0A 4D0NA 4GP7A 1I4LD 1XTSA 1TTTA 2JLWA 1TQ2A 4NMMA 2FFBA 4O25A 5JJLA 2JLXA 1YRAA 1UF9A 4RD3A 2CVHA 2N1BA 3VR2A 2OILA 2YVUA 4K46A 3QG5A 1PLKA 4HLQB 1SKYB 1SKQA 2QA5A 4AURA 3NBXX 1E2GA 3BBPA 1GNQA 3KX2A 3AUYA 4TL6A 2ZVPX 1G3IA 4EPTA 4LX0A 1KO7A 1HYQA 5LB4A 5KU1A 4DDTA 3PUVA 2IT1A 4BLOA 1DAEA 2FWRA 1SVIA 1OSNA 1XEWY 2HLDD 3B6EA 4EFLA 1LW7A 2W58A 3KFXA 1DAMA 1DELA 1K5DA 1G16A 3EZ9A 1X8LA 4S2EA 4FINA 3RYTC 3LAWA 3GP8A 4RZUA 4PZYA 3A4MA 3GQBA 1VYTA 1VIYA 2XTZA 2JJ2A 2Z0MA 3BH0A 3UWOA 1BMFA 5EZ6B 3PCRB 3IEVA 4WZ6A 2A5GA 2JA1A 2QP4A 4D4JA 2QSYA 4G3XA 3W9YA 3AKEA 1T5IA 5EE3A 3CRMA 3EX7C 1KIMA 5C18A 1KDPA 2BC9A 3QXHA 1ZUNB 1DAHA 2JLUA 2VO1A 3UEYA 3FPAA 4PQYA 4UNRA 1XEXB 1ZBDA 1Z0IA 1N0WA 3ZIAD 3KQLA 1WBDA 1M6NA 2IYZA 3KUCA 4KYUA 3DMDA 4KO8A 4Z1MA 3S1AB 3TNFA 4ZDJA 2ZR7A 3R7WB 1E2NA 1TQDA 3CBQA 5BW8A 4C4PA 5CK5A 3CXLA 1XBTA 2GETA 1FX0B 5J4KA 4NH0A 5SZHB 3BFVA 1G9XA 1YR9A 4NZYA 4YQFA 4W7SA 3WMGA 2GEUA 1IBRA 1P72A 5C4MA 2IYUA 2QENA 4ZCIA 1HY3A 4JLOA 4KBGA 1O3YA 2H92A 3V4FA 3QQ5A 2IC5A 4ASUA 5HR5A 3O8RA 1W4AA 2QTFA 4LBWA 4LHYA 2I4IA 3BOSA 4JBYA 4M9QA 4HAYA 3SU8A 4KITB 1WBBA 5H8WA 3L0PA 1RC8A 3TR0A 3IIJA 2ORVA 2C5LA 1G41A 2O8EA 1Z6TA 4LBVA 5EE9A 1DAIA 5B64A 2CEAA 1EWRA 3VU9A 4HZUB 1Z29A 2H18A 2J59A 4TQAA 1RRFA 3CO5A 2OLJA 2O0HA 1ZC4A 2ONJA 4LYFA 4B71A 1W0JD 3HDTA 3RSOA 3RS7A 2J7PD 4DSNA 4C3ZA 2CBZA 2E1RA 1W5TA 4DEYA 5B57C 3LW7A 3GLHA 1TF2A 1MO4A 2ZYTX 3B5JA 3BGWA 4WBSA 5E7IA 3FMFA 3OE7D 1H8HD 2VF8A 3VR3A 3TIFA 3FGNA 5AK0A 2CHQA 4W5WA 1AN0A 2EFHB 1G3QA 3RC8A 4HLUA 5IT5A 5BQ5A 2HLDA 3EZ6A 3FFBA 2ZRCA 3WNCA 1R0YA 2FEMA 2ZXUA 1KY3A 2EYUA 1RJ9B 5LDDC 1XJ0A 5KDDA 4A15A 5J4HA 1J70A 2ZJBA 2QQ0A 1P3JA 1E32A 1OFHA 1VCIA 4QHSA 5JS7A 1QZXA 2B7BA 3NEYA 4HUQB 1WP9A 2QM8A 3MWKA 2XJ9A 2PCLA 4HLDA 1JALA 2C99A 5E4FA 4LC0A 2FPMA 2PBRA 3CR8A 3VQTA 4AIIA 3FHCB 2I1QA 5EE1A 3B78A 1LF0A 2NPIA 1ZCAA 1M2OB 4E09A 2KBEA 1Z47A 4LHXA 4DCSA 3ZIAA 4LPSA 1WB9A 2O0JA 4PHFA 5FTJA 1Q1EA 5K8TA 1E0SA 2BMDA 4PAQA 2RGXA 2ZRLA 5KYKA 1ZM9A 2F1HA 3K9HA 4D2IA 2ZUCA 2Z6VA 2KBFA 3N5CA 2ZE6A 2ZANA 3DOFA 1E9BA 1SVSA 2ZRBA 1YZNA 1MT0A 4TL8A 1WF3A 1KBEA 4OI1A 1N6OA 1JQJC 3K53A 4A8JB 4Q9JA 2EVWX 4D4LA 5GJBA 3M0EA 3FKQA 4JS0A 2AR7A 1HT1E 3U6KA 4TTPA 2XOKD 3KY9A 4FMCB 3SJZA 5HKKD 3JZAA 1YKSA 3GJ5A 3LXRA 1TUEA 3MUFA 1UBGA 1V43A 2AXNA 2C2HA 5DI9A 2XEXA 3AUXA 1ZIOA 4PR0A 1BYIA 4B34A 1XPOA 2ZE7A 2P5TB 3TUZC 3W6NA 4PSKA 2QPOA 1J99A 1TADA 5TMPA 2MSDB 1II8A 3QF4B 4EPVA 4AKIA 3UANA 1KO4A 5AR1A 4TSFA 1TMKA 1CRPA 2QQEA 2J7PA 3BJIC 5AUOB 1U8AA 2G6BA 1U98A 2BWJA 1GL9B 4Q4LA 4H1VA 2ZVQX 2EFGA 4D81A 3E2IA 1E4VA 1H8HA 3OE7A 3R9WA 4AK9A 1RW4A 3THXA 3CUEF 4LC1A 3A4NA 5TY0A 1XD9A 1U99A 5AJXA 1G8HA 5DHFA 4TL9A 4L9WA 2OCYC 2ZJAA 4HI0E 5FFMA 5JSZA 1IONA 4KYIB 4KJZA 5KSZA 1S1CA 4UJ5A 1T91A 1JNYA 1IJEA 4JL5A 1COWD 4CRWB 3DM5A 4XH9B 5H70A 2DB6A 1P2UA 3R20A 2FSGA 3I92A 4EKDA 1QBKC 3I4LA 5AJZA 5SZIA 3THYB 1QHXA 2HF9A 3B85A 3OFNA 2WPDD 4YC7A 3RRZA 1R5BA 3MSXA 4QNRA 2AWOA 3ADKA 1OFTA 4S35A 2WJGA 4TMWA 3CLVA 3ETLA 4RJLA 2QGZA 4BEBA 3PUZA 4NYIQ 4LK2A 4URVR 2J41A 2CCGA 3PEUA 2GXUA 3P4XA 4IOLA 5EXPA 1JJVA 2BCJQ 2ANCA 3D31A 4JKYA 4LJYA 3DKPA 5B58C 3H86A 2NPFA 4BLPA 5BYJA 4NCHA 5IDVA 4ESHA 1JR3E 3L8YA 3AP2A 5HCNA 2W0SA 2ZYVX 1UBCA 2ZE8A 2FGJA 3I72A 1KZGB 2W00A 3DVLA 4RD6A 1RYHA 1RKBA 4AKEA 2F1IA 1D9ZA 2VQSA 5KSYA 3U3KA 1YZQA 5TARA 3GJ8A 5FI1B 4RFSB 1SVOA 1TU4A 1FNNA 1S9HA 2WWGA 1X1RA 2J0UB 3K09A 5EE5B 1E2IA 1E9DA 2CHVA 1E0AA 1NI3A 2XTNA 1YZLA 4U7DA 2XOKA 3GJXC 821PA 5HKKA 1ZJ6A 3CH5A 4JLNA 2QAGC 4MKGA 4LHWA 4FD2A 3GFOA 4XSHA 4BRWA 3H0KA 4Q4AB 3RAPR 1PVOA 1MH1A 3U44B 3HPQA 5K8LA 4Q7JB 4GBMA 2H57A 2BKUA 1EX7A 2FSFA 2IF2A 1F2TB 1KK2A 2JDID 4DDUA 1KDTA 3GLGA 5L3SB 1E0JA 3C41J 3U4QB 3BD9A 1Z63A 1OV4A 2R6CA 1Z08A 5ELXA 2FNFX 2VIIA 2ZSAA 1KMHB 2IUSA 5CDFA 3RS5A 3V00A 1LS1A 2OHFA 3THWA 1M7BA 4Q1EA 3KQUA 2VYFA 5C2JB 2D62A 4HB3A 2P67A 4DZZA 2QBYA 1IM2A 1QHIA 4OK6A 2JIZD 4ZV4A 4QHTA 3U60B 1F3OA 1G8GA 2ANBA 3TKLA 4DVGA 3MJHA 3ZD6A 3ZS9A 1TF5A 1LTQA 3GJ0A 1Q3TA 2GDJA 2VP4A 1Y63A 1KI1A 2WBLC 2WWWA 4LJ8A 2DFTA 1NG9A 3NWJA 4RD0A 1KK0A 1OHHD 2HEIA 5C1BA 2YINC 3NG1A 4IVRA 5KSPA 4BE7B 5HZHA 2J45A 5JWHA 3I5XA 3FVQA 1COWA 1TEVA 3DHWC 2VH5R 4NDZA 4UJ3A 2OV2A 5JECA 1GRNA 1ZUHA 3NH6A 2PMDA 2CE7A 2A7QA 1UPTA 4XWKA 1CF4A 2XAUA 1WE2A 4QJ3A 2Z43A 2WPDA 4V0MA 5J4YA 4HB2A 1MV5A 2FPKA 2HT6A 1UJ2A 2F1JA 3ZVLA 1W44A 4FWTA 1M74A 3RSLA 5TVKA 2REXB 5DYGA 4X8HA 2ZITA 4Q4HB 1NG1A 5SZKB 5DE3A 1IXZA 1D5CA 2CE2X 2OO7A 4V0OA 1SULA 3LRPA 4MRPA 5IHPA 4Q5IA 5TV2A 1IN4A 1XMIA 2J46A 3QEJA 4LOAA 4US2R 3MWLA 4HATA 2XB2A 1XDBA 2W0MA 4ZIRA 1UFQA 1US8B 3OIWA 4Q02A 5P21A 4JSTA 4UNSA 3PG5A 2QORA 4OJKA 4IJMA 1BH2A 1UKYA 4JLPA 4DCVA 1AM4D 3AVXA 1WDTA 1OH6A 1YQTA 2FV8A 1JAHA 4M22A 5JRJA 4QJ4A 1GSIA 1K5GA 3A58B 3W6PA 2J0SA 4PC7A 2IYSA 3F8TA 1T8UA 1ZINA 4Z54A 4L5BA 3UMFA 3P1JA 1QHYA 1OIVA 1F60A 4JL8A 5E3HA 6Q21A 5FUVA 3BFKA 3PV0A 4FW9A 4LV8B 4LCBA 2PMKA 1DE0A 3WNDA 1VHTA 3MLEA 4JT2A 4C7OB 3AVPA 3KKOA 2JDIA 2IYYA 4XSGA 1VTKA 2V6IA 1N25A 2A78A 2QP3A 2ZI6A 4FXPA 4QRHA 1XP8A 3X1YA 3QKSB 3VNVA 4MYCA 1G20E 2BJWA 3BB4A 2O8CB 1HURA 1CEEA 5KNCA 4C0LA 2NO7A 5AJWA 3RRYA 3T5GA 2ZRNA 4EPYA 3PXGA 3IIKA 2V1UA 1M1YE 3NIBA 4FCWA 1ZM4A 3WYFA 5LBIA 2JIZA 3ZDQA 4M0LA 5GVRA 2PX3A 3VKGA 4US0R 2C95A 2FX3A 4ZI3A 1W4RA 4GSYA 2ZU6A 2GEVA 3PUYA 1NL3A 4LJ6A 4F4JA 3BJIA 3T1TA 1OHHA 2GBLA 4JL6A 5KO2A 1DEKA 4TMXA 2GVDC 4NTZA 4TYPA 4LYJA 4A82A 3AVQA 4JLDA 4Q9IA 4U5XA 4JBWA 3TW4A 1FNMA 5C46F 3EPJA 3OEED 1LF5A 2WJVA 1N0UA 1NVXQ 2IUUA 3F0TA 5HTKA 4DWJA 2V7QD 1R8SA 3IDQA 2EFEB 3TBKA 2H7VA 1XTJA 4UXJA 1SHZA 3OHMA 4KU4A 3UWKA 1XJQA 3KXKA 4R9UC 1E9FA 4BEJA 4D26A 1KSGA 2ONKA 2NO1A 621PA 1JECA 1ZNWA 1KI2A 1NIJA 2BIFA 2ECKA 3ASZA 4Q1BA 5EJEA 2G0NA 1N5LA 4Q7LA 4ZO4A 3TK1A 3B60A 4I1VA 1UEJA 4IEIA 1GKIA 1X8JA 5CM8B 2RGEA 3P27A 4D82A 3EA5A 2GTPA 3NHAA 3A1TA 4ZDIA 2DY1A 4ZDWA 3VFDA 4N1AA 2PZFA 2WSSD 1Z06A 3BS4A 2EWVA 3F3YA 2DYKA 1FW6A 4PC2A 2E9SA 3E5HA 3LH5A 1JEDA 1IN6A 4EJSB 3ZD7A 3PFIA 4KVGA 2A5YB 4ESVA 3BORA 2IS4A 3P32A 1CIPA 4DLZA 1KO5A 2RGBA 1GTVA 3GLFE 4BGDA 1XEWX 4B2LA 4QFMA 1ODFA 3ECCA 3NDPA 4TYQA 2G1KA 4P3YA 5KHOC 2R6DA 4AWXA 5EQTA 1FL9A 2WAYA 3T35A 4ZCMA 2YHSA 4LBZA 3SR0A 4LZZA 1IN7A 4KAXA 2C9OA 5FH9A 4Q21A 2QU8A 3Q85A 1YU9A 4LY6A 5JHHB 2QMOA 1MKYA 2H1LA 2NO6A 3AF0A 3U2QA 2IYQA 1Z07A 4JJKA 1FP7A 5E7JA 1W2GA 3V9PA 5KDOA 3NKVA 1HA3A 1OE0A 4TMKA 2QAGA 2R6FA 1L4UA 1NY5A 2F43A 5A5GA 1A7JA 1OT3A 3B8HA 4HAVA 4RD4A 3ZLJA 5J4VA 1Z6GA 2NGRA 4MRSA 2PX0A 5F9FA 3OF5A 3SE0A 4URYR 1NVWQ 1FUUA 5F3WB 1IHUA 4UNNA 2AFIE 2HYIC 3VTKA 3K0FA 5UKDA 4GT1A 3C16C 4CEHA 2XSZD 2A5DA 4KLZA 4V03A 1GNRA 2QSZA 3M1IA 4C0HA 3PJRA 4TTRA 4JIMA 1KI3A 2C77A 1JR6A 1S8FA 2CCJA 4JLKA 4URXR 4NYIR 4Q7MB 3WYGA 4ITRC 1YZUA 4K8OA 2K5UA 2JATA 2JLYA 1FOEB 2ZRGA 1SVMA 3VKHA 2FOLA 2ZM5A 5TB5A 2ENNA 4KV9A 1AGPA 2GKSA 2ZRAA 3OIVA 1Y8FA 2J5XA 4F38A 3IBYA 1QF9A 4QL3A 1QVRA 4ACAA 4DJTA 2RB4A 4PHGA 3P4YA 2HCBA 2BV3A 2QEQA 3DEFA 4HB4A 2FFAA 2ZRDA 5F9HA 4TT3D 4Z8YA 4V0NA 2KB0A 1NJFA 1N6HA 5L3QA 5CB6A 1NSTA 3EIQA 3I1FA 3SNHA 1CBUA 1BYUA 3DO6A 2F9MA 2WSSA 4M1KA 3L0OA 3RWMB 2GJ8A 4DT1B 2IYLD 2R62A 3AP3A 1CJMA 3VR6A 4URUR 1WMSA 4TLBA 1YZTA 4KLNA 4OI2A 3UG7A 2IS1A 1Q44A 3WY9A 3AF4A 3IEUA 4PAOA 1E9CA 1Q0UA 3BXZA 4EUNA 4A0FA 4BZXA 4C9BA 4OK3A 3UATA 3KL4A 2W6ID 2ZAMA 2B7CA 5KPDA 4FN5A 4WXPA 2QG6A 5CITA 3ADBA 1YR8A 2XJ4A 5CLQA 2PEZA 4Q19A 5CLLA 2ZS8A 5C4GB 1J90A 4N3NA 2FPLA 3GEEA 1XTIA 2BBWA 1Z3IX 3QVVA 3WBKA 2VBCA 1QG4A 2ZAOA 2NQ2C 4J0QA 1NMZA 2JASA 3NTUA 1VCMA 2JJ1D 2IXFA 2OBLA 3GLGE 1DO2A 2GEDA 4M1OA 4KCGA 1UDWA 4TTQA 5EXTA 1VYUA 4DLVA 5CDFE 1ZNZA 3UGIA 2IHBA 1SVLA 3QXXA 3CH4B 2O8EB 4Q00A 4KFUA 5CM9C 3NC0C 3VU9B 2NMVA 1G3RA 8OHMA 3MJRA 3RC3A 4I1UA 4K81B 2V9PA 1IOZA 3K9GA 2XSZA 4IHQA 3E1SA 4A4DA 2FG5A 2OFWA 5M04A 2A3RA 4LHZA 3I73A 2JEOA 3I3SR 1L4YA 4ACBA 4YMVA 1II0A 2J3EA 2I1VB 4ARZB 1AKYA 2NIPA 1RVDA 1QHHA 4B76A 2YC2C 3GLHB 5JS8A 2Q3FA 1A4RA 3BRWD 4EAQA 1XMJA 2BJVA 1ZCBA 1GG2A 4DLRA 5JHGB 2Z5FA 2DCUA 4W5JA 5FR1A 1XU4A 1Z28A 1GFIA 2D2EA 2YWGA 3QBTA 1E2FA 2MSCB 3ASYA 3D8BA 3B1XA 3ZVRA 5KNDA 1KDRA 2WJYA 4V0ME 2A30A 4ZDKA 1NBMD 2DR3A 3K09C 5B30A 2ROWA 4MGZR 3W5IA 1J7KA 4P4UA 4YDHB 3U7FB 1ZAKA 4IVPA 2EQBA 1A82A 1H8ED 4ZPXA 1M34E 4LWZA 4I4LA 3L0SA 4HB0A 2FGKA 1DVRA 4WZAE 2X1VA 1P9NA 2EYQA 5LD2B 1MO6A 3CWQA 3RANA 4AYWA 4C2UA 4R7ZA 2GCOA 1JQLB 1IN5A 2P3SA 1NLYA 2QPAA 2HDNB 4F4CA 3B1WA 4PAMA 3IQXA 2PLFA 1XA6A 4P4SA 2D7CA 5IK2D 1D8TA 4I99A 1FAQA 4GI7A 3VR4A 3CNLA 5EP1A 3TJZA 2AD1A 4JYBA 3CZQA 4MRNA 4UKDA 3A6PC 3UPUA 3JVVA 1IAQA 4RCYA 3U7HB 3TW8B 1PUJA 1OKKA 3GFPA 2GVIA 2W6IA 1Z0FA 3IPXA 4G5GA 4XVQA 1HE1C 2PZGA 5EP2A 5DI3A 3CRRA 2ZRPA
chains in the Genus database with same CATH superfamily
2EBWA 1TECE 3I61A 1EE9A 2D0IA 2DSTA 4XX0A 1TGVA 2M5XA 3QKIA 4W6ZA 2WWHA 4PG6A 4EEZA 4IHJF 1GZDA 1T4DA 3A10A 3OICA 3IAUA 1AK9A 3R4VA 4UVHA 3KWFA 4BNLA 3EWAA 4FMDB 1QYRA 1UKAA 5CFMA 5C53B 2XUAA 3OKFA 4IVQA 3I52A 1XZQA 3K92A 2BT4A 3JQQA 3ROEA 4C4TA 1VKOA 4DMMA 3MTJA 1TIKA 4ESEA 3LDHA 4OMUA 5L4NA 3CZPA 1ZH8A 1KERA 1EK0A 4HQOA 1K92A 2AEJA 2FZLA 4JBHA 4W82A 1RYNA 2AMYA 2VNHA 3HB1A 3PF9A 4WKBA 3FFWA 1MAAA 3LX5A 4YLEA 1E1RD 4ZYVA 2QK4A 1LX7A 4RA9B 1F2UA 1D4OA 3NOXA 1X19A 3SN6A 3MWDB 1II8B 3OLQA 1Z37A 4QM6A 1D7AA 3BMNB 3RABA 2WHXA 4DF3A 1KTVA 3MW8A 1NT2A 3QEOA 1P81A 1BA3A 1V7PC 2BRUA 2OZVA 1CU1A 4G0OA 2M2IA 3LUDA 3ZWOA 4H3VA 3KOOA 4I6EA 4UTOA 3O1LA 3VTAA 5JBQA 1C0PA 2PK3A 4C0AC 5LLSA 4XLZA 1NI4B 2W6CX 3D5EA 3WGMA 1JVNA 1NBWB 3U48A 1ZU4A 3JQ8B 1C8KA 1EINA 3OJFA 5HDBB 2AH5A 4AO6A 4UDYX 1N9GA 3PB3A 1KMCA 2NT4A 5JNWA 2B94A 1T1EA 1XVLA 1C9YA 3R7WA 2AV6A 5JSZB 3LVQE 3SXUB 1KBFA 2Q3LA 3EIEA 4ONEA 1ORIA 1BCSA 4JEIA 1T8RA 1FUKA 3W5CA 4XIFA 2AEFA 2A7XA 2OT3B 1V47A 3EQ7A 4BNHA 2O2DA 4UM9B 1RWKA 3UPDA 1E2LA 2OYRA 1DIAA 4EHLA 1JDBC 2AC2A 4K9NA 4PFKA 1JA1A 4B6FA 5DULA 4MQFA 1P60A 1C4KA 1HNNA 2W2VA 2CDRA 2CMDA 2DPXA 4AO7A 2ZI4A 3P0EA 1YB1A 2C78A 2YJTD 3BC1A 5HGJA 4YRSA 4RV4A 5KHLB 2E18A 1LB1B 1GADO 4XWWA 1P5FA 3FKSD 2V7WA 3WB0A 3FI0A 1YJXA 1GLGA 3LFHA 4EHJA 3DOUA 3KVOA 3QKWA 1Q20A 4QNNA 3QVUA 1LWOA 3GN1A 5D7BA 4UASA 4OA8A 5DM60 1QX4A 4EYSA 4KQJA 3WKCA 1OGIA 4C6HA 1R6VA 4PNEA 4MDEA 1PTQA 1GUBA 1ZNYA 3DTTA 1VPTA 1CRQA 1JU3A 4QIHA 1J9EA 3LOQA 1OI4A 5J5AA 1D4ZA 2ARKA 1QTRA 5EP3A 1DJLA 2X19A 3HB4X 5DIFA 4V02A 2OWDA 2V3VA 3LHSA 4JI5B 4Q9DA 3LGAA 3F9IA 4BO8A 2RJOA 1JG1A 1A2QA 4O2LA 5FHRA 2M6RA 3MXOA 4ZYXA 1EVQA 2XGOA 2XR1A 4Q9AA 5JSFA 4B3GA 1LBEA 2XRMA 3OQPA 1UH5A 1EBUA 5C37A 1XQ9A 2IXDA 1ZAYA 3HJHA 4KDFA 4OKSA 1Z39A 2JHGA 3R3YA 5JPIA 1NJ2A 3AI2A 3IOMA 2GFQA 5GJWC 1BAPA 1PQ4A 2AK3A 1TJ3A 4IS3A 4EX6A 1NRWA 1ZISA 1GZSA 1SA0A 3FI9A 4CQMD 3O82A 4WADA 1M73E 3G2LA 2FKNA 4L6CA 3T12A 1VSUA 4MYDA 3ZWBA 4AC9A 4YCCA 4QO8A 3WP1B 1RRPA 1WS6A 4C6TB 4YRMA 2PR7A 1E8DA 2PR2A 3CZ4A 4QKQA 2W0TA 1XEAA 2DHRA 3A25A 4M0KA 4RD1A 1K6XA 1U3WA 1PL0A 1TK2A 3LM8A 3LPDA 1HMPA 2TSYB 2LR0A 3DZFA 4J0DA 5FA6A 4D3FA 5K0SA 2X0KA 1YJ5A 4D4HA 3H17A 1YZKA 4HYTA 3E7DA 2L19A 4UTPA 3BMCB 3N2KA 2X8BA 3UGTA 4DZRA 5DO9A 2Q99A 2QT9A 4QUEA 3CPSA 1PZFA 1R4AA 5JNTA 1TYCA 2VSXA 3EEQA 3A3NA 3F8WA 1UDBA 3D7LA 4ZJYA 1P0QA 3D6HA 1JH9A 3KAPA 3TZHA 4Z7NB 1CR4A 2WI8A 3C3JA 1DAOA 3G9TA 1KR5A 3WXMA 4L76A 3WGVA 4ECEA 2OG2A 1SXGA 2Q3CA 2IYXA 1VE1A 3P2IA 2QJOA 4L07A 1QIGA 1J21A 3Q9SA 4EPWA 4KOAA 1NVVR 3B2EA 4XGRA 3SYLA 3PEEA 4U7PB 3H05A 2Q5JA 1LI7A 3P5SA 1NM5A 4FN4A 3BE6A 1FMTA 4Q82A 4G86A 4WCFC 2ZT5A 2XGJA 1XZAA 5A4IS 2J5QA 3ABRB 3EGWA 5E6RB 4Y6QA 3Q7EA 3B6KA 3R09A 4B43A 3RFUA 5IAKA 5A5DA 4RXUA 4E5UA 2OE2A 4F21A 1FTSA 1I7PA 2GN6A 2KMRA 2A0FA 2C0CA 1UFOA 2V65A 4ZRDA 2CJWA 1GL3A 3MOGA 3GPDG 4M55A 5HPYB 4ZI2A 1FFDA 4JT9A 2G82A 3R9IA 5SYMA 2G88A 3H4MA 3ZU2A 4E5MA 1TO2E 2YXLA 3JQFA 2HFKA 4Q47A 3WL4A 1LZLA 1L7AA 3PGMA 1KI7A 2C4WA 1GNSA 2BDUA 1KO8A 3CLUD 3OKPA 3EC2A 4FWBA 4PYLA 4N7MA 4R8VA 1QXSA 1J56A 1T0JB 5ALNA 4V1CA 1Y3AA 5JYEA 4LRSB 2J87A 2O4UX 1A9PA 2GZAA 3O2SB 3R8XA 3MWFA 3PQCA 4Z51A 2VJYA 4N82A 3WJAA 2IOFA 8ABPA 1PTJC 1OREA 4NULA 2HK9A 5FULA 3ZU5A 3JSXA 5LU9A 1Q0RA 2F8LA 2YN2A 3QE4A 3DOEA 2Q7DA 4XPIB 3I8SA 2WUGA 2REQB 5T6MA 3WG9A 1ZIPA 3QF4A 3H6GA 4NOJA 3PF8A 2FWIA 4PX5A 4Y3UA 2PEYA 4DREA 2I8LA 3UJAA 1C9DB 1WU8A 2EAUA 3DZCA 2FPPB 4ZAGA 3MJDA 3BIFA 4J3FA 3UENA 4QXMA 4BFZA 5KOJA 4UHJA 3VPFA 3M3PA 4GDFA 2YJZA 5DASA 2ZP1A 3I62A 2B5VA 3SLRA 3TDMA 1GVNB 3TSZA 4KQMA 4AQ7A 3DEYX 3OXGA 1TPYA 2M98A 2WC1A 4HGUA 4Q6BA 5K0BA 5D6NA 2GPWA 4NBWA 2XQGA 4R9NA 1NW4A 1U8TA 1NU6A 3EXIA 1JHYA 1GPYA 5JDCC 3S6JA 1A2KC 2DY0A 5K7SA 3W06A 1JLKA 4RKEA 4YT8A 1NF3A 1TM3E 3PFKA 3OEHD 5AHRA 3BRSA 4D4KA 2EJCA 2Y99A 1Q1QA 4DV3B 2O6LA 4PZDA 5JD3A 4KZPA 1VLHA 2H4JA 3SHOA 4OGWA 1KSHA 2PJRA 2ZJ1A 5EI5A 5AUPB 2FDCA 4MVJE 3CRZA 4DM3A 4G81A 4M0MA 1NMYA 5IUKC 5BORA 2EFCB 5BW4A 5DLQC 2PRSA 3MLBA 1QK3A 3E81A 4A6XA 1JMKC 3IULA 2G40A 3C3AA 3P52A 1DFIA 1QP8A 1FDRA 2YIMA 5HFJA 2GO1A 2JHCA 1W1WA 2JA2A 2JGKA 3SG0A 5GZ3A 1NSFA 4TMVA 2FNAA 4IGFA 5GM1A 1QDUA 2XIJA 1LSJA 4MWEA 1U63A 5FL3A 3V8NA 4OQXA 2IW3A 1ZSYA 1G2PA 4FGJA 4YH1A 1ZH4A 3DJYA 4RM2A 3WADA 5KYXB 1RPZA 5DJ5A 3HXTA 2Q07A 2GNPA 2IA5A 3R2JA 3IT0A 4O2BF 3VSEA 4NPAA 4H18A 4MA5A 3ECSA 3LFUA 4JAVC 1RJFA 5EXDA 1C50A 2GZDA 3OFKA 2Z8ZA 3L7BA 3PNQA 4XPZA 5GVSA 4JBLA 4EKGA 1IAVA 1XQVA 2K2QB 3HI6A 3IKJA 3AKDA 3CJRA 4FHDA 1I3MA 2CXUA 2OV4A 3I9V6 3H4VA 3EMKA 1NMXA 3GEBA 4YR7A 3KTOA 2C58A 1IBLB 1QO9A 3UFBA 4BCCA 2RHTA 3BDVA 4PG8A 2OAEA 5ICEA 1KVUA 1UMCB 3CW2A 3DZDA 2F3RA 4JWTA 4WIAA 1QH8B 5F51A 4P3PA 4RUKA 2O1WA 3X0DA 4Y2QA 5K0FA 2EW8A 5EXXA 2ZCJA 5KWSA 3L7YA 3PYLA 5D85A 1J8YF 1GDDA 1DRJA 1GUAA 3NDJA 4PGAA 4MH0R 5CK4A 2Q21A 4OL0A 2MDTA 2XOEA 4ZOQI 3BDAA 3O83A 4N5NA 4ZARA 4M7RA 2ID9A 2IYOA 1YGPA 2ZR8A 4L72A 5F33A 5IAOA 4KKXB 5B5SA 5JOQA 3JYHA 5THKA 1Q7GA 3ZJUA 1KOFA 3QLVC 1SBTA 3PPYA 4RGBA 3NAMA 2Q1UA 3SM3A 2G5CA 2ZJZA 3KALA 4OOFA 5IU6A 1T26A 1U5BB 3R7AA 3UAYA 4COOA 1U9IA 3OT1B 4GEGA 3PIIA 3UT6A 2CN1A 2GLXA 1XDDA 2Q1WA 3EBPA 3LCRA 4ARUA 1Y8RA 4OJTA 1T2UA 2HWUA 2R6HA 5HJ2A 3M1AA 1DKRA 4Y1GA 1E99A 3PNLA 2GAAA 1FMJA 5MFZA 1XNQB 3ET5A 4DBLC 1D09A 3P2JA 2W93A 1ISGA 4NK5A 1FFEA 3TNYA 3M33A 2BFFA 3WQQA 1GV1A 5ADVA 3WRYA 3HRHA 1D2GA 4WEOA 3B9RA 5AVOA 2ZIAA 5JY6A 2VYCA 4TLEA 1QZTA 2QY9A 5LA6B 4DRZA 5D1HA 3CWZA 2DWCA 2VHUA 2VYND 3GP3A 2WM9B 2ECOA 2R00C 3ED1A 4I0WB 4LYEA 5FO0A 3B2NA 3SIWA 4W5TA 2TECE 3JY6A 3IELA 3QLEA 4XYLA 3K1AB 5JXGA 3ZQKA 4YI3A 4L9MA 4FGUA 5FEMA 2C5EA 5ENVA 2GARA 2NU6B 4C7MA 1P2BA 3GGDA 1XYVA 3KZCA 2ZB4A 2QAGB 4UTXA 4YV2A 1Z2AA 1SCDA 3ZHYA 4DNXA 4UD6A 3QQPA 4NU8X 4ZVKA 4H4CA 3MTAA 4A0HA 1FP2A 4PO9A 1XTTA 4ZC8A 2NUTA 2OBXA 2JAXA 3SYKA 1FLDA 5KPJA 5EIOA 4JQCA 4PCLA 4D9EA 3ASUA 4KO4S 2VK8A 2WQZA 4KQXA 2XMSA 2X3TA 2VF2A 5ILQA 3PGA1 4OHXA 4KPUA 521PA 4DG9A 4CEHB 2PA0A 1G55A 3AEUB 3MWYW 2VK2A 1GA6A 1F12A 4LCEA 2PT6A 3BXPA 3GZNB 3LT1A 1UBNA 1AKVA 2A58A 3F78A 3ID6C 1ESCA 1RM5A 1ZQ9A 3CGGA 4LXYA 5EIHA 1ILEA 2FCAA 3REFA 3CG0A 2RH5A 5BVGB 4B3RB 2OXCA 5HNKA 1ACLA 3HHEA 2LKCA 4QBFA 5ALDA 3HK2A 4DQUA 3LWNA 1YACA 1DC3A 3CSUA 4MUYA 2JIDA 1TW3A 2R5FA 3VOBA 4OQLA 1KIAA 4C6SA 4B3IA 2QRNA 1N0HA 1KNXA 1UXGA 4G8CA 2WW8A 3HVUA 4GZLA 2IHVA 1BS2A 4JUIA 2JG3A 5CW2A 5CNKA 5KNCH 1KYVA 1QH9A 5B3LA 1YU6A 4LDNA 3RC9A 1P2GA 2AOUB 1Z6YA 1HJAI 1GGKA 4OEHA 1S4MA 5H5JA 5I6DA 4DFDA 1Z8FA 4IW3B 3KAQA 3FCSB 3SJCA 2ZYWX 2PZMA 3DWFA 4PPNA 3PL1A 5MN5A 2Q5EA 3A1UA 3L6CA 3BJMA 3OAAD 2H3EA 1NXWA 4DA7A 2SKDA 1L7VC 4I36A 2D00A 3ZK9A 4HXYA 1BGVA 2UVPB 2I3BA 5F9MA 5A3SA 4N0DA 1LLUA 1TM2A 4EUEA 1M2EA 1CULC 1JHRA 4KAAA 3RQSA 1QRUA 3AZOA 8ADHA 3OLYA 5DT9A 4BN5A 3IQHX 1E61A 5GZ1A 3DDUA 3JARB 1JEYA 2CBXA 4RK1A 4KHZA 1E4EB 4IIXA 1NY6A 2JGAA 3DE2X 2V7UA 1O08A 1CFZA 3TM5A 5FOXA 4EMSA 2NU7B 1CX9B 4LRWA 5FI0B 2B1JA 2ZSJA 1W2HA 4HEQA 2B21A 2GK4A 4LOJA 4CVNA 2IYFA 3NTVA 4ZVPA 2R86A 1WR8A 1JLLB 1I2ZA 1U2PA 5AVSA 4ARCA 3FNFA 1WKBA 2AG1A 2F7SA 4YJGB 2B9EA 3RYCB 2HN9A 4HDAA 3WGJA 1TT5A 2PX6A 3ZV6A 2D1FA 2EP8A 1W1IA 2GS9A 2O2SA 4YAGA 1ABFA 2RHOA 3DHEA 4OQNA 2WHPB 2W9XA 3GCZA 1YB7A 4FS3A 3R0QA 4KRGA 1HZZA 3GHHA 4NABA 3NUZA 2EZUA 2MSKA 1T0BA 1NYTA 4B4KA 1ZDMA 4K0KB 1TC2A 3IE1A 4QG7A 4C7BA 3HKBA 1Z0KA 3E7FA 5AW3A 3EPRA 5IASA 1HDRA 4C4ZA 1YVDA 1FXUA 3FCUB 4G2TA 2DPHA 3SJAA 4G5OA 2Y0BA 4XVRA 3VV2A 5GIPE 4UEKA 4KW7A 5JDIA 1BH6A 1DWQA 1D0IA 2WSIA 3EAQA 1H0KA 4M89A 5CA0A 3ESRA 1JF8A 3KKPA 3V32A 4AJ1A 4RPCA 1H4QA 3DM9B 3L8EA 1W4LA 2C1EA 3QE0A 4CCYB 2PUJA 3LRTA 4MMZB 4JLVA 2HCJB 2GT1A 2JIBA 1G18A 2R79A 1J1ZA 1M8KA 3HDVA 5EJIA 1KDZA 2XPCA 1Z5ZA 4XWAA 5CNJA 5ALWA 1JHVA 2GM9A 4TRMA 1HNXB 1X39A 1L1FA 1RYEA 4TMZA 5SZJA 1T8WA 4FNMA 1T5TA 4TZTA 4BBZA 1JA0A 1CZOA 1MA3A 1P7WA 1Q7TA 4U9UA 4Z6KA 2P90A 3ITDA 3Q2OA 4OAPA 1QHHB 4GX0A 1WSAA 4MW6A 4X1IA 3F6CA 1KOGA 4OX9Y 4EO7A 1MORA 4QEKA 3ZDEA 4X44A 5EHZA 1E2BA 1M8PA 2VK4A 3ADDA 1Q1BA 1K7SN 1YFLA 1RMQA 5AKGA 2XYQA 4QWWA 4I1SA 1TW2A 1EPUA 3MBOA 4JVSB 1GKYA 4LGVA 1K7EB 3QBJA 1OXTA 4MUMA 1EI9A 3V34A 3COJA 5EJ9A 2Y1EA 3LUKA 4M9XA 2FRXA 4LMRA 1WW3A 2C5AA 2QT1A 2ZR9A 4LAFA 4M6WA 4AXBA 2OBBA 5ALVA 1C7IA 2DP4E 2OPBA 2W22A 4EYQA 5JZ9A 5H9WA 2FEOA 1JHMA 4N3AA 5HK8A 4O3MA 1M5UA 2GF9A 1JKXA 1N7IA 3A0RB 2WTEA 4G0QA 4JJ7A 3O8OA 5BW6B 1LGYA 2QQFA 1LSOA 2ZSBA 5G1PA 5IFLA 4JCOA 4WT7A 4XDZA 1OJLA 1QYVA 3HA7A 1XHEA 4EGSA 3CISA 1DKMA 2GJ4A 4WZBB 3I23A 4MVWA 2QZ9A 4P4SB 4MVJG 4TUYB 4GPEA 3U4HA 1RHMA 5A3QA 1Y3FE 2QN6A 5DLYA 2ZJ4A 1G7CA 2ARPF 1PR5A 2EZ9A 3NNDA 4QBHA 2DBYA 1QFZA 1NRIA 1EDZA 2DUUA 3NEAA 2ID8A 4HRXA 1Q5PA 1Y7HA 3HCRA 4HYQA 3JD0A 4L4SA 3GFVA 4JUDX 2JI8A 4Z4HA 4IAOA 1K3FA 3P0JA 3WICA 1ORWA 2I1WA 3GZ4A 4X91A 3AVVA 1DT3A 1CQIB 5D3ZA 2L82A 3OSZA 2UUAB 2PT5A 4AY5A 4MI6A 1N3IA 2BJHA 4GEKA 4IUDS 4FGLA 2IE8A 5H68A 1PBNA 1H2XA 2CF5A 4NE2A 4WVLA 5I8ZA 2BTEA 3QTLD 3OKCA 1BW9A 2PRZA 1F9EA 4O1HA 4M2LA 2XODA 2ATEA 3SDBA 1GNLA 1QJCA 2FW7A 4EKNB 2VOEA 4A16A 2IWHA 4AI6A 2VYVD 2ZUBA 4UE6A 3DTVA 5ITZB 3K1JA 1P7CA 3QHQA 1C1DA 3H65A 1C1HA 1AUPA 5EFZA 3SGBI 1WMDA 4H0CA 5G3YA 5DX8A 1BCRA 5BXQC 5JALA 2ZKIA 1KI6A 1FPMA 3NXSA 1CRWG 2P0EA 2H6EA 4UUBA 6GPBA 3JQFC 1WOYA 1Q84A 3RV4A 4GX1A 1FS6A 5AKJA 4F7WA 5JMOA 4K3VA 4L75A 1ENYA 3W3AA 1EDOA 4ZCTA 1VHJA 2B8JA 1BFDA 5DN6A 3TRFA 2J85A 4ZTZB 5FPSA 4TYYA 1R66A 1E2PA 1MB3A 1P9WA 4E1PA 2Q6LA 5IC5A 4HQLA 4DMHA 4JOSA 3K5HA 1XTKA 1PKEA 1T3LA 2YWXA 3NH9A 2YNMA 2CVPA 4LOHA 4NFSA 3TMKA 3QYAA 4X95A 3QX9A 4UMFA 1TZ2A 4Y18A 4GR4A 3CLSC 2QTZA 1YQWA 1JW9B 2QE6A 2WIBA 4K6FA 3BQMB 3HH2C 2ZWOA 2D2FA 1BDJA 3ASVA 4YRQA 4A03A 2GWHA 4G01B 2XNSA 3AF6A 4KUHA 2C4VA 3RTEA 1Y82A 1I6LA 2OUKA 5ANRB 3TZEA 3WGUA 2JGRA 2VLIA 3NVDA 2FYTA 2IFTA 4G56A 3L3BA 4RTPA 1OLSB 5A05A 3CLTD 1G21B 1YOVB 2CL0X 3BCSA 3WLSA 4L22A 2CJYA 4KQIA 3U62A 1DBVO 3VOTA 2M6LA 1OYWA 1YV9A 3HJBA 4X8LA 4YHHB 2PWPA 3VGJA 1G1AA 4JLWA 2GHIA 5B2EA 1Q57A 1OH7A 1ULUA 4HVTA 5D86A 2GYVA 4UFNA 4INAA 2VUIB 1KZ7B 5BUZA 1UKVY 4F6CA 2WG0A 3OPYI 2ERYA 2G5GX 4X0EA 1UVFA 3D3KA 4RM3A 1BDHA 3ZN2A 3DLCA 1NVEA 3E5NA 3V5NA 5L4SA 2CLOB 1NV9A 1OLOA 3D7MA 3G9ZA 3JR3A 5CFOA 1Y4AE 1N34B 2C5HA 3GLSA 4IS2A 1D2MA 1VL6A 2PDAA 3OJCA 1JBQA 2ZRMA 4YMUA 4E88A 1A8PA 1AF7A 2YW2A 3K0AB 5G41A 3SQXA 3GL9A 3N0XA 2G77B 4HADA 3V48A 2AMLA 3C2QA 3U7QA 4ZZ0A 4B73A 5LWQA 4QVIA 2HO5A 2A5FA 1YDHA 2ZTMA 1MPXA 3WO0A 1B2RA 3RIMA 1U9CA 5T8KA 5D3MB 1NAIA 1KJ8A 2QRPA 3D3NA 4DUGA 1E59A 2BFEB 2A1TS 1TL7C 3GLIE 4JLJA 4ZZ3A 2P9QA 1T4GA 4XCVA 2QSUA 5BQFA 4CLOB 2VP2A 1HORA 4YRIA 1VKJA 2HFJA 4K6GA 3QVGA 3NQ41 2GESA 1OPXA 3IPCA 3EA0A 4CMKA 2JB9A 3RC7A 4IDNA 1NVAA 4D1YA 1R18A 4PHHA 4B5LA 1G5PA 2E6KA 2MYUA 5FL7A 1LQTA 1U7XA 1YZGA 4FKDA 1KI4A 3AR3A 2Q3BA 2QWXA 2KWIA 3T0GA 4CI0B 1SXQA 1GL7A 2FPWA 1PJ4A 4LYHA 3A4YA 4X9XA 1ZUNA 3LPNA 3N2EA 1B3BA 1POXA 3B7PA 1PFUA 1KMNA 3LCCA 3CG4A 3N05A 3WV5A 1DX6A 4B3DA 1W4BA 3THXB 3GI1A 4J0IA 2QRVA 3R3XA 3G8YA 4NU0A 2ODAA 4O4LA 1DTSA 2V1CA 4M7PA 4YO7A 3C3PA 3W1EA 4B46A 1ZGGA 4CR7A 5IKMA 1N1GA 3P20A 1SGWA 6CHYA 2GXAA 3N53A 3U4IA 2O59A 4PPQA 5E95A 4GICA 4LZNA 2NZYA 3MS2A 4IHAA 5LZ5A 1TXGA 1NT4A 4MKRA 1XCGB 3RHSA 4M7WA 3ZXYA 3OFND 5LMNB 1M6HA 1RWPA 1FNDA 2CXQA 2H8KA 4BVAA 1WP4A 4GR9A 5CCXA 1Z73A 3FSYA 3MJTA 1QGOA 3SYNA 2HPZA 2XGMA 4RHFA 1GUFA 4QOJA 2QYTA 1HSZA 2UAGA 4BBAA 2G0AA 5JATA 3K3PA 5FR2A 3EPKA 1RWMA 5H59A 2AGVA 3UG6A 3LQRA 2QT0A 2GLTA 1XZFA 2MR5A 1U04A 3GT4A 1JQKA 5JJIA 3O7WA 1T35A 1ZH2A 2QVYX 5E2AA 3KSZO 1AS2A 1U9IC 3ZE0B 4AF7A 1IBKB 2WAAA 4QXAA 3LC0A 1PWZA 3ZWYA 1ZO8A 5EUQB 4BFXA 4B3HA 3PEYA 1OXUA 3U5ZB 4JCCA 1BQEA 3B3QA 3FLMA 3QW2A 1UJNA 1OIXA 2P2SA 5FA5A 4HWOA 3T7JA 3T9BA 2BEJA 1NUSA 4R5HA 1JMYA 2DBZA 1LPMA 2P1RA 2XMQA 2NUBA 4YCJA 4AVYA 4AG6A 3I30X 4MCJA 1ETHA 5GOZA 3THOA 1KARA 3IR5A 3WRYC 1EWQA 5HI7A 3EH2A 1KE1A 1RLOA 5HKOA 4KQGA 3TRKA 4AMLA 4PC3A 4PBTA 2ZSDA 5HP4A 2ATVA 2JFHA 3NT2A 5ICGA 4HNTA 5KKAA 2I7CA 4DEVA 5CDGA 3B3FA 4NV3A 2QNRA 2MCFA 4JMPA 3DE6X 3LCJA 2LGJA 2QZ4A 3CNEA 1E3EA 3EVGA 5AIAA 3HADA 3H8VA 3D43A 4I9UA 2ZEJA 5L4LA 4GGPA 1IB0A 3OIDA 4JT8A 4BZQA 1ULTA 5EPUA 1SCQA 2DETA 3P94A 1KPGA 3FM9A 5EQFA 3BVPA 2YMQA 4BFYA 1GCUA 3A31A 1N4DA 1JQEA 4JLUA 1NZFA 2GPNA 1IY1A 1XJWA 3ZCXA 4B2IA 3IJ5A 5TPWA 1A97A 2VT6A 3MWDA 5EMLA 3B51X 2W2OA 4M1QA 3BMNA 3EWIA 3BYZA 1N2CE 2UVDA 3PFCA 4Q3OA 4TYWA 4PINA 4CRWB 2NUPB 1N0IA 4J1TC 1WGCA 3TEFA 2PL3A 2OWEA 5G4KB 3OCUA 2PKCA 3Q40A 3ENQA 4MQMA 5K4AA 4FDUA 1GWNA 3ICVA 1TJPB 4RQAA 2CNWA 2XT0A 1FJ2A 1GHTA 4EA6A 2JW5A 3JQ8A 2WWRA 3HXOA 3WHPA 5JRDS 4BYGA 5K0EA 1WEHA 3R5HA 1T24A 2D3TA 2VC2B 1C4WA 5FPTA 4CKEA 4HS9A 3J81k 3L0ZA 3C1OA 4PCUA 1QRAA 3HYNA 2RJNA 1I5EA 2JZNA 3SXUA 4CIXA 4FJ1A 2YXNA 3GCGA 3MS4A 5EUCA 4LRQA 4FYMA 1PT7A 1YVEI 1MDFA 3C5CA 4OJQA 5EX3A 2DGDA 3W8DA 1TMYA 5DHSA 3ZZMA 4ARSA 5MFPA 3PC3A 1YIOA 13PKA 3HFSA 4MW7A 1E2MA 2GAIA 3VDXA 2ECPA 1YRHA 1AKQA 5TEVA 2QZZA 5FUWA 3FCCA 4UEJA 3EGXA 3RS0A 5LCXA 4WKCA 1XF9A 4O4IA 1TPZA 2H00A 2P40A 4XM2A 1CJVC 4MW9A 4X41A 3C1TA 3TFWA 2H7YA 5AI6A 5FP0A 3EVNA 4P3NA 5ALSA 2WMNB 2INGX 3KOWA 4J76A 2E55A 4U00A 4DE5A 2PU7A 3A6JA 4EM6A 1UMBB 2GKTI 4FMCF 1ZFNA 1HT0A 2AMJA 4IIHA 1MGPA 1QWSA 2YQPA 1UKCA 2ATXA 3FNHA 2XWPA 3FKSA 4LSGA 2FFHA 2WKQA 2BY4A 3A6GA 2PMBA 1WCIA 4NX2A 2CL7X 5FUYA 2G83A 3QVOA 4Y67A 4YRTA 5KJCA 2JBWA 4I81A 1PJSA 1Z4NA 3HQ4O 1TM1E 3HFJA 4J0CA 3HCOA 5KBYA 1GNVA 2ZBEA 2N1AB 2O07A 2F4NA 3QBEA 1LI5A 2VWPA 2MSWA 4CYMA 1KEEA 3WWPA 3A4IA 4FOSA 5D87A 4IMRA 3IQFA 4DA4A 3PA8A 1SXJB 1ZXXA 1E6LA 1XTQA 2EZ4A 3SY8A 4EPXA 4BX8A 3HM9A 5DW0A 3GNTA 5BWNA 1W35A 2X2EA 2K9HA 3F47A 1R0LA 2RI1A 4M1ZA 5FQNA 2J3KA 4JENA 3SHTA 2E73A 3BPSA 3W8EA 4RYDA 2UXBB 5HS4A 2EJUA 5IJWA 5CYOA 2B8EA 2JGMA 4CN9A 1KHHA 2AUMA 3DE1X 4D0SA 4U2FA 2HWYA 1Z62A 3PGLA 4DEXA 5I4CA 3T3IA 4CQMA 3AUKA 3D7SA 5DMXA 3PS9A 2PYZA 5LP6B 3RVLA 1JHAA 1PVVA 4LJSA 4HXFB 4B4WA 4OKNA 4ID3A 1U11A 4TVKA 4QODA 4CM1A 5JANA 5FWAA 4JJAA 4NG5A 4O2AA 2W83A 1K86A 4ZI7B 3BMCA 3GVCA 2BFCB 2V1XA 2VNKA 3T1YB 2AD5A 4W5HA 4GL4A 5FBRB 4W9NC 3ENZA 4NEHB 5FNZA 2P2DA 1OC2A 4N5IX 3DWIA 3MTIA 1GEEA 2IYRA 4OXQA 2VUSA 3IUNA 5AK5A 3TDKA 4DMRA 2GZ3A 2YVQA 2DPLA 2G09A 3CB4A 1JHUA 3AILA 4N01A 5TE9A 1P18A 1K2VN 1N6NA 3ZWVA 1P1CA 2O52A 2XXJA 3S28A 1XZNA 1ISIA 2D06A 3AUTA 1D4AA 5K1ZA 2J4CA 1J24A 1HDYA 3ROZA 3U9SA 2MYPA 2BM9A 4BUCA 2XZPA 2D5BA 4EUKA 3I76A 3B1JA 1XXHB 3HP4A 1HFWA 5ALRA 3THRA 5TX7A 4F60A 4TQUS 1QFJA 3IIMA 4Q7EA 5CH8A 3CPHA 2DMRA 1Y3CE 1Y7TA 4L7QA 3WKBA 4NIMA 4F72A 1UK6A 2QVXX 2VXCA 4XQ9A 1V5IA 1PJQA 3LWDA 2IYVA 2VZ8A 4JR0A 1AHPA 5JMWA 1ZR4A 4A1FA 1EA7A 2BVNA 3Q8XB 4J0JA 4OU4A 3I32A 3PD7A 4H27A 4X3CA 4IINA 5LUBA 3ZE8A 3MGKA 1Z0SA 2Y9PB 3HMQA 3IP8A 1I2CA 4YBZA 2F64A 4O8ZA 7WGAA 4XFJA 1V8BA 3L4JA 2OG1A 1KFCB 2GK6A 2FG7C 1SUCA 1INLA 3EASA 3LXXA 3DWEX 4PZAA 3D1VA 4BGIA 1G64A 3QEKA 4CE6A 4CTNA 1YS1X 3UOWA 1SN7A 3ZLBA 4C3OB 5B7PA 1AD2A 3DV2A 2CK3D 3V8VA 5FAKA 2ZSKA 4KWHA 4XD2A 5CRIA 3A9WA 2E87A 2ZJ0A 4M38A 3WL3A 1VMDA 1EQAA 5BNWA 1QE0A 1B8VA 3E70C 3GWZA 5LYJA 3KQPA 4ZJPA 1JIXA 4PVCA 2P7IA 2F3UA 2XCLA 3AUSA 1GRRA 2YDXA 5TRTA 2RCNA 2CLEB 1PVDA 4NMHA 3UM9A 3FSRA 3UT0A 1D0VA 3E3MA 2F8SA 2WJAA 3W0LB 4JYCA 3B1YA 1G5QA 1YI8A 3TS1A 1QVZA 5KTOA 2Z04A 2CLLB 2ZBQA 3SWWA 3AKCA 1DMRA 1LLQA 3KZ1E 1CPYA 5FFNA 1WPXA 4PO8A 1JTFA 1ZD1A 1DUSA 4N39A 2Y3IA 1FMLA 5AM3A 4EUSA 5HMMA 4L6AA 2BP7A 4FKZA 4Y2UA 2E7ZA 1N3BA 2DFKB 1CKEA 4KZKA 4MS1A 1V1JA 1WZIA 1JPJA 1S2LA 1VSTA 4S1NA 5DCYA 1L8QA 4YJFB 4ZU6X 4FHEA 3SSMA 4F71A 5CFRA 5JEEA 2IWRA 5J5CA 1P0FA 2DWOA 3SEQA 1CYDA 1JVSA 2OM2A 1UPFA 2X6TA 2YN0A 2XUHA 3JQCA 3N0RA 5JZVA 1HI9A 1Y80A 1QWOA 2EFYA 1SUSA 2ZPUA 1QCYA 3BEDA 3EUAA 4CKCB 3IMEA 3STWA 3K70B 4E0BA 1XZ8A 3J7TA 2QM3A 3A1SA 2IHKA 3AFGA 3ZJ5A 2GRUA 1WPQA 1IJBA 4DSTA 1IBSA 3R23A 1K6MA 4WOJA 1ECCA 4UBJA 3G68A 3ILXA 5BSMA 5CA0F 2UZ4A 4YJ2B 4BLUA 2ZG6A 2DG2A 1XZGA 1T2FA 4KXXA 2XB4A 2XDQA 2QN8A 2JHFA 4GGOA 4XB6B 4EITA 5L8VA 1IOVA 4U7TB 1WGTA 1JJIA 1NVBA 1H69A 5FWYB 2X9VA 3CF4G 4Q4JB 3SGQI 4BN4A 3AIIA 3F6EX 4RFVA 4AL4A 5KTPA 1I7NA 5KCZA 1AUVA 1UJ4A 4HMQA 3GRPA 3MWGA 4HXGA 5KYXA 4M9RA 1UKEA 3A6KA 2AI2A 3SS7X 5BYAA 2HUPA 4B6JA 2ZYRA 3KR0A 3R3SA 1N6RA 2GILA 3IA2A 1QG0A 3OIYA 2W2KA 2R8OA 5JE8A 3IALA 5EA2A 1ANKA 2O4CA 1ZP6A 4JLBA 3IHTA 4PFJA 2XH8A 1Z56C 4AQYB 4GL2A 3WAKA 3JS5A 3FTQA 4P1ZA 2GJAA 3CNNA 3WLIA 4CEJB 2X8WA 4QUAA 3NRCA 2KLBA 2G9VA 2XMDA 4S24A 1UKZA 1YONA 2PGIA 1Q1GA 2CDCA 3H5TA 3IUPA 4K9LA 1Z7GA 1YL5A 4KWTA 4QO7A 3KPUA 3D9QX 1C3XA 5AVWA 3UTDA 2D5AA 1LDMA 3TRJA 1QQTA 1AZWA 1ZIYA 2IXBA 1XMOB 1Y4ZA 4W5RA 5CFZA 1QH8A 3OQOA 3SZRA 3QIAA 2HA6A 2QL7A 3VPXA 2R6JA 2GK3A 1RVV1 4BATA 2IODA 4PGHA 3UHFA 3HA3A 3AEXA 4FT4A 3ICEA 3ST7A 2DZDA 4B0OA 1RE1A 3U4CA 3OI7A 1RYZA 3W6OA 4BYMA 3C39A 4B3JA 1XVIA 2J3QA 2P9TA 1ZYUA 2PMFA 3P71T 4MI3A 2NTYC 2CUKA 3NWOA 4A0GA 1LX6A 1T2DA 2AX4A 2UYQA 5CU7A 2RKOA 4RK5A 3TAHA 4BCBA 4ZZ2A 1A9ZA 2C7QA 3ESCA 2J3HA 4P4TA 1DJOA 2C2KA 3RS3A 3V2UA 6LDHA 5EJ5A 3QEBZ 4CEIB 4DABA 1QIHA 1Z4LA 4FFMA 4Q1DA 4IJVA 3ZY2A 4PNZA 3NX4A 1ZOIA 1PJCA 4ZC1A 5HIAA 3VNAA 4KLAA 2GM5A 4KN9S 4MK4A 2GA8A 3BMOB 4GFDA 1MTZA 2C9DA 4OQ4A 1CS4C 3FPKA 4QOFA 1H66A 4PYNA 1OWNA 1GRVA 2PD4A 1SXIA 2P2CA 4ZGGA 4HJXA 4DSUA 4A3SA 2ATIA 4HYEA 1B8PA 3QPDA 2ZSHA 1RQ7A 5JRZA 1RQ2A 2C8VA 2XZOA 1XKLA 5ECWA 1W1UA 2ZWIA 1DDOA 4Y2XA 5T4EA 1B6TA 4LHEA 5KQSA 2G9QA 5FWXB 1PR4A 4QUHA 2I3DA 3Q0IA 3D64A 1TM4E 5EHGA 3T1OA 1K7VA 3OESA 4V0SA 1XFAA 3VH3A 4CF6A 5B3AA 1VLLA 5EIFA 2WM2A 3TLXA 1CRZA 5IVIA 1NWHA 1XRNA 3L7KA 4IDDA 1GU0A 4GXQA 4NBLA 1X87A 2NU6A 4BQPA 4LWOA 3WWDA 1Y81A 2BL4A 3FHOA 3HNPA 4PPFA 2G17A 4EWLA 2H29A 4OVOA 1N2SA 1OU4A 3JRXA