5FUWA

Catalytic domain of thymidine kinase from trypanosoma brucei with dtmp or dthd
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
168
Chain Sequence
AHGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTGDTLTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 53
structure length 168
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuwA01
1I4TD 1L7VC 4RFVA 4Z8YA 1M7GA 4LBVA 3UMRA 1UJ2A 4QGFA 3RWOA 1KO1A 5M04A 2VTKA 1Z2AA 1EWQA 2YV5A 5A4JA 3G82C 3BK7A 5JJLA 1KI3A 1XMVA 3AQ4A 2J0QA 4QG7A 1RE0A 2ZQ5A 3FGNA 4TTRA 2F9LA 3KX2A 4G5GA 5DGXA 1NLFA 5EQTA 1YR7A 3T5DA 3VTKA 3WNBA 1S96A 4A9AA 1KBEA 2R65A 4HLQB 4PSVA 3KFVA 1Z28A 5DHAA 4UXIA 1QHGA 3WYGA 1Q57A 3QI2A 4TTQA 2ZRHA 5FPYA 3IQWA 4EKDA 1XMIA 4FMCB 1PLJA 3U44B 3UIEA 2GZHA 3GLIB 1GRNA 3B5JA 4N1AA 3WYFA 3SQXA 3LVQE 1VECA 1A82A 2VSXA 1TPZA 3NEYA 1Z8FA 4FIDA 4OJQA 4Q1DA 1XTIA 1W44A 3X1YA 1KI1A 3LAWA 4XOIA 4GI7A 4LCBA 2X77A 3VX3A 3LNCA 4PO1A 2J0VA 5LDDC 1DEKA 3KJIA 3KXLA 4TT3D 3TIFA 2JGNA 5G40A 2ZJ2A 1VYVA 3BS4A 2YWEA 3TJZA 2GAOA 3KUDA 4Z1MD 1ZC3A 3W3ZB 1AS2A 3HPQA 2O5VA 1MO6A 3THYB 3AH8A 3QEOA 1Q3TA 2LKCA 3FHOA 4BFVA 2V55B 4XJXA 2PJZA 2JATA 4EFNA 3LQRA 1E9EA 4PHGA 4Z54A 1GITA 3B9QA 5ANRB 4BLQA 2OAQ1 3X1WA 3TBKA 4Z51A 2A5GA 1QG4A 3R9IA 4EFMA 2YWFA 4CRWB 2QGZA 4RD6A 2VQSA 3I4LA 2IYUA 5JWRA 4UNQA 4DCTA 1LF0A 1L8QA 4P4UA 4MH0R 2V6IA 4ESVA 3M4YA 3VMFA 5FUWA 1F2UA 2VP6A 4D4MA 2CJWB 3K0CA 1CJTC 2W0SA 4B6DA 2W58A 2ZS8A 1TL7C 4ZCIA 3QSYA 4A92A 5TXGA 2DHRA 4MRNA 4P3YA 1NVUQ 1XD9A 2BCGY 2IYSA 1T8TA 5DI9A 4DUGA 2IL1A 3IO3A 2QRNA 3RS3A 4BECA 1P7CA 1MRSA 1OFUX 2X19A 4KSBA 2BEKA 3QPVA 4HLUC 2AXNA 2IC5A 1Z6XA 3BE4A 1Z83A 2Q3HA 3PITA 5A5GA 5IF9A 4V0MA 1JBKA 4JLMA 3FKQA 1W5TA 2ECKA 2ERXA 3THXA 3KTAB 2ORWA 3AVOA 4URYR 3U7EB 4TT3A 3ZVMA 1ELOA 2QPTA 1E2GA 3X1DA 4C7OA 3C41J 4M1MA 5K8TA 5KDOA 2GHIA 4Z1MA 4IFEA 1IXRC 2IYLD 4CT5A 3B8HA 1P73A 3A1VA 4TQ9A 3W6NA 2Z43A 5JMTA 3QIAA 5AJVB 2I1VB 1W2HA 3BFXA 1T4GA 5DSZA 3QKRB 1TF2A 2HYDA 2F43B 3LV8A 4JMPA 1KTVA 1N6LA 1S1MA 3W34A 1UKZA 1CU1A 3DOEA 3U60B 4R98A 1Z22A 3K09C 5L3QB 4NDZA 3T06B 3KQHA 4M1KA 1UBGA 5CDFA 1OJLA 1OFIA 2QAJA 2H16A 1D6JA 221PA 4TZ6A 1T5LA 4YXWD 3EZFA 3P27A 4G5SA 3U6KA 1WRBA 4PC6A 1VYUA 4BASA 4DT1B 4URVR 4URZR 5CB8A 5CB6A 4CF7A 5B30A 3QNUA 1U9IC 2G9NA 3TNFA 3JZAA 3GMTA 5KU1A 1II8A 3OESA 3HU3A 1Z6GA 1OHHA 4WAUA 4QBGB 1BOFA 4OHVA 1SVLA 1OIVA 5JSZA 4ARZA 1TADA 1ESMA 2J59A 4B75A 3GQBA 3KFXA 2XTNA 1OSNA 2CE7A 4POAA 1TQDA 4GSYA 1NJGA 2OM2A 4LHZA 3Q7QA 5HE8A 2PLFA 3O8DA 4D6PA 2O8FA 1OXUA 1FP6A 4JYCA 1NG9A 2D2EA 3RAPR 4A0GA 5B2ZA 4DWJA 5GADl 2F3RA 4CW7A 1UDWA 2FV8A 4KSCA 1CP2A 4JL8A 2H17A 1QHSA 2XJ9A 2DY1A 2OCAA 3FKSD 3U3RA 4MA4A 5FTKA 1HV8A 5TDHA 4FXPA 2FA9A 1Y8FA 2EW1A 1G6HA 2PEZA 3TK1A 4DSNA 5G3YA 1D9ZA 2BVNA 4G5QA 5B64A 3I32A 1I4DD 1T3LA 3KL4A 3C8UA 1KJWA 1U0LA 1GNPA 3RRYA 1HEIA 5KPJA 3IEVA 3UGLA 5KO2A 2P6RA 1P5ZB 2C9OA 2RCNA 3IBGA 2C9CA 1P2TA 5G53C 1MT0A 3C5HA 4P4SA 1CBUA 3CX7A 4X8OA 2NPIA 3JVUA 5JRJA 1R0YA 2HJGA 4Q7KA 1MH1A 1R7RA 3L8YA 3R20A 2WZQA 4YXWA 2C98A 3EW9A 3VR1A 4DBLC 1Z0JA 1G8YA 2QPOA 2ZJZA 1EWRA 3BD9A 4AC9A 1KDTA 2ZU0C 4LK2A 3B9PA 3R8FA 2QTHA 3KUCA 4Q00A 4O25A 2ZAOA 2P3SA 3MCAA 2R6DA 3EPHA 2R6FA 3K9NA 4TYWA 4D4JA 1NN3A 1OIXA 3Q5EA 2F6RA 1V5WA 2FF7A 3VHXA 2B7CA 4AD8A 3P1JA 1YKSA 3RSLA 2ODEA 1ZUHA 1FX0A 3TSZA 4R7ZA 1W47A 2LWIA 4E07A 1XF9A 3GJ4A 3MWYW 2IXFA 2VIIA 3U7GA 2GZAA 4QBHA 3NH6A 4P0TA 1AQUA 1N5IA 1E98A 1WP9A 4HEJA 1KHTA 2FE4A 4DDVA 1GOTA 1XD2B 2GXUA 2PMDA 4BFZA 5FOSA 1SULA 4OHZA 1ZUNB 1KSHA 5AK0A 3C5CA 3FKSA 3LW7A 4EIWA 2BJVA 2CK3D 1ZC4A 5JS8A 2G88A 4HLCA 4A0HA 4C4PA 2V3CC 2ZR9A 5AJXA 5F9FA 5JS7A 3HDTA 1CR4A 1DAIA 2IW3A 2OCBA 4IVQA 2IS1A 3BFKA 3SYKA 1P2UA 3FOZA 4ASUA 2O8CA 1UBFA 2OT3B 2NZ8A 1ZNZA 1HA3A 3AVQA 2AL7A 5IK2A 3LD9A 4Q1AA 5KDDA 4L9SA 3L0IB 2JLQA 4KFTA 3KJGA 2W2VA 2ANBA 4MGIR 5L8VA 2RH5A 4DLUA 4EJSB 1G6OA 2QSZA 4B3FX 1GNRA 4C0JA 3O8CA 1KAOA 1S8FA 2ZITA 5H70A 3AVYA 4DB4A 2NG1A 4ZO4A 5DISB 1DELA 3C16C 4Q1EA 3SEAA 1ZYUA 3MFYA 4HI0E 4A0RA 3DVLA 1PJRA 1Z2CA 2QM8A 3KB1A 4DLRA 3HYRA 2GCOB 1JALA 3CIOA 1IAQA 3EZ2A 3GD7A 3I92A 1HY3A 3AB3A 3AGQA 1CULC 5F9HA 2EFEB 4DIEA 5HZKA 2IUSA 3T15A 4RJLA 3GJ0A 3LY5A 3IBYA 2ZSFA 3AF4A 1KDRA 3NDPA 1NKSA 2GJ9A 4M1SA 4XVUA 4QBFA 4KFRA 1Z63A 1VHTA 1YZKA 3U7FB 1P9NA 1ZD8A 4PTLA 1R8QA 4Q9KA 4AURA 4MUAA 4QHSA 4BFYA 5FPHA 2FZLA 1TQ2A 3TUJC 4XTRA 4P32A 2CNWD 2ODNA 2LCFA 4OHWA 3AEZA 1Y3AA 3SC3A 1FMJA 4IOMA 3WNDA 4EPYA 3B85A 2N46A 3Q8XB 4LRWA 4BLRA 3UMSA 1KMHB 1XEXB 2AD5A 4JLKA 2NQ2C 4D4KA 1UAAA 2C8VA 1FNMA 1E2NA 2IYVA 2GJKA 4XD7D 4MRVA 4TZ0A 4KI0A 5JJIA 3C14C 4TYQA 5C1BA 2YKGA 4WA7A 2D7CA 2Z0MA 1ZJ6A 3JVVA 1XD8A 1EG7A 4RSGA 4LI0A 4I1UA 2IYQA 1TMKA 3WNCA 1HTWA 5IT5A 4EPVA 2D62A 4IVPA 1RPZA 1ONBA 3NBZC 2DBYA 1HQCA 1X8KA 4CIDA 1X8JA 4ZIRB 2A78A 5JWHA 1Z07A 4FMCF 1OKKD 4JZKA 5KPDA 1PTRA 1CKEA 1SKYE 4B2LA 2OZEA 3LBHA 1XP8A 4TSFD 3PUZA 5FTMA 3V9PA 4XSGA 3QG5A 1JXOA 3CM0A 2FNAA 4A15A 4R2IA 3TAUA 4FWTA 1Q1EA 1RKBA 1XEWX 2VF8A 3AF1A 2GESA 3A58B 4B48A 1XPRA 5L3SA 3ZGXA 3UWKA 4Q9IA 1KGDA 1J99A 3EA0A 3I72A 1OIWA 4M9XA 3CB4A 1UADA 5DHFA 3UATA 1DOAA 1XZQA 3AKYA 1DAKA 3I8XA 5HTKA 1O3YA 5CIWA 3CNOA 1NVXQ 3OEHD 4MGZR 3CPHA 1N5KA 3CLVA 4AI6A 3PUWA 4F38A 1E9CA 5HPYB 5JWOA 5E7IA 2CHQA 4II7A 1LW7A 3R9WA 2WAYA 1GL9B 2F1HA 1E2JA 1I2MA 1XRJA 1AZTA 2AFIE 1RW4A 1RRFA 1BH2A 3BERA 2EWVA 3FPAA 1RC8A 4TL7A 3CW2A 1NN5A 1G5TA 2NGRA 1KOFA 4QJ5A 4TL8A 2HV8A 4XD7A 4EQ6B 1K5GA 5EUMA 3U4QB 4FD2A 2HT6A 4BZXA 1W46A 3SDZA 3DPUA 1WE2A 2GK6A 3VKGA 3KKNA 2JLYA 1T0JB 3LO5A 1Q1BA 1JEDA 1SXJB 1I2DA 2WWWA 2WJYA 3CF2A 1UKVY 4NKRA 5HCNA 3VHLB 4RZXA 1XMSA 3RDPA 1IY2A 1VG1A 3TUIC 1E1QD 1HT1E 4A8JB 2Q9AA 3WMGA 3GJ7A 2PEYA 3OAAD 1FAQA 1UKYA 1KJYA 1NBMA 5EE5B 1EFRD 4IW3B 1VIYA 3K53A 4YC7A 5BQ5A 4IDPA 1Z3IX 1GDDA 1GNQA 3QENA 1OKKA 4B74A 4C9BA 1XTRA 1B23P 3K0AA 3OIWA 2XXAA 1YVDA 2HF8A 1I4LD 1ZM9A 4LJ9A 4PC3A 4TSFA 1NY6A 4M8NE 3AP3A 2AKYA 1KI2A 2GKSA 2JJ2D 4ZI2A 2OV2A 3HJNA 2CL6X 1OH5A 2NOAA 3G0HA 2XSZD 3FE2A 4WXRA 3ZVNA 2GDJA 2GK7A 2O0HA 1VCNA 1E2MA 3DL0A 3KZ1E 4QC2A 4DJTA 2ZYWX 1CJKC 4Q9LA 4M0LA 4JL5A 4LOAA 4NBSA 2FWRA 3LWNA 1OV4A 1P9WA 2H1LA 3I8SA 3OEHA 4IOLA 3T1QA 1G18A 2CDNA 3P4XA 4W5JA 4RZ3A 3P26A 2JA1A 4MITA 3PEVA 3R9XA 3L0OA 2OUKA 1IN6A 1W4CA 3LLUA 2G3YA 4Q4JB 2AWOA 1COWA 2E9SA 3TQFA 4BLOA 2V54A 4MDEA 3BH6A 2QZ4A 2AK3A 4B3XA 1LS6A 1J90A 1R6BX 4JS0A 3SFVA 3NBYC 1IY1A 2VHTA 1KY2A 4YLGA 1WF3A 4HAUA 3ZZ0A 4HYYA 4GNKA 2GJSA 1P4SA 3S1AB 3K0FA 1SVSA 2V7QD 4P33A 3ZQJA 4GL2A 4AG5A 4K46A 5KYKA 1AKYA 5TY0A 2BEJA 3G5UA 4GT1A 3LX8A 4D25A 4BFTA 3ZVLA 2O8BA 2UZ3A 3SQWA 3BC1A 3RYTC 3D8BA 2JAQA 3OAAA 2PH1A 4LHVA 1FUKA 1M74A 2JJ1D 5JI3E 2ZI6A 4JKIA 3AKDA 4YMVA 1QHNA 1G19A 4N3NA 2ODWA 1XA6A 2CHGA 3EPLA 4BEBA 3GLIE 1RRGA 1KZGB 4W9MC 4GRAA 1U8YA 1R5BA 4JT4A 4PPGA 3PCRB 3FMFA 2VH5R 2FPKA 1EX7A 2FPMA 2JJ2A 4LHXA 3NC1C 3LLMA 5A0FA 5B58C 3ETLA 1FQKA 4NHOA 1F2UB 1KK1A 1RJ9A 1P60A 2OXCA 2CCGA 2ZE8A 4PO8A 5AR1A 5KOYA 1P2SA 2XB4A 3HPRA 3FFBA 3GJ8A 3ZS8A 3EARA 1PUJA 1DAGA 4LY6A 5EP3A 5F3WB 1KK2A 1GRRA 2H92A 1RRPA 1UFQA 2REOA 3RANA 2Q0HA 2H5EA 2ZVQX 4JVNA 2IWRA 3AM1A 2YZ2A 1Z06A 3CZPA 3THWB 4JLOA 1F2TA 2NO0A 2QEQA 1CS4C 1XTJA 1Z0FA 1Z5ZA 2UZIR 2V4ZA 4DSOA 3AVPA 5C18A 5BYKA 3EIHA 3OIUA 2OCPA 1JXMA 1W4BA 3THXB 3K70B 1HYQA 5FUVA 2QROA 6Q21A 3DM9B 1YZNA 4GBMA 5CJPA 4C7OB 4PZZA 5K8IA 2ZSDA 1YHNA 4QNMA 4NE2A 2REXB 5E7JA 4LSGA 5CIQA 4W5HA 3H2YA 4A1FA 4PHHA 1DAHA 1R5NA 4NYMR 1OYWA 2A5FA 3SHFA 5D3MA 2QMEA 5IHPA 3QBTA 1N6HA 1G1MA 1KO8A 1SVIA 4B34A 4YQFA 5FH9A 3BJIA 1MKYA 2RHDA 1N0UA 4BEJA 5FR1A 2QT0A 5HKKD 1C9KA 2B21A 2AXPA 2BV3A 1VTKA 2W6JA 2ZYUX 2FGJA 5D3QA 2IYZA 1JR3D 4JLDA 3T61A 2WJGA 2P65A 3ZH9B 4OI4A 2YHSA 3F5FA 4U7DA 1II8B 4NMMA 1N6OA 1MO3A 1S3GA 3GLHA 1D2NA 4ON9A 1XXHA 4HZUA 4TLDA 4DDWA 1WQ1R 2GF0A 3TW8B 1DADA 4A2WA 4KVAA 4AYXA 2CL7X 2XAUA 5JSZB 5CITA 1GM5A 2ATVA 4LC1A 4YMSA 4ARZB 4LV5B 3IGFA 4P31A 1E9RA 1IY0A 4Z8XA 3O8RA 2IWHA 2ENZA 4A6XA 5KUTA 4IXMA 2WIAA 1Q21A 4Q1CA 2AWNA 2PLRA 3PIRA 1E9FA 1YRBA 3MSXA 2JLWA 2O8FB 1NY5A 2E73A 2UVQA 3K1JA 1GAJA 4TMVA 1NKTA 1BO6A 1NLZA 5E7MA 3BGWA 4FMDF 1D8TA 1WBDA 2R6GA 1E0SA 5DO9A 2WSSD 3I73A 2W6ID 5EE0A 4DDTA 2NO7A 4US0R 4QOSA 3VFDA 4JVSB 1SHZA 3LBIA 4OQLA 4E22A 4CDGA 5C4GB 1CR2A 3U7HB 5JHGB 1AKEA 3NVAA 2R9VA 4C0SA 1D5CA 4HB3A 3IEUA 2ZRGA 4ZCLA 4NCHA 1N6KA 4P4SB 1M34E 3U61B 4YMTA 1XB2A 1A2KC 2AKAB 3FHTA 1E9DA 4BFSA 3DKVA 1MO4A 4I81A 3UG7A 4I4LA 5FOTA 1GL7A 4JKYA 4IDHA 2WJHA 5EE9A 2QT1A 1II0A 3PQCA 2DYKA 4Q4AA 3PENA 3T1OA 1UEJA 4FCTA 2J7PD 3NEJA 3GP8A 1ZMXA 2P5TB 4PX9A 4AKEA 4HUTA 4HSEA 1TAGA 3NHAA 4PSAA 3LXXA 1OXTA 4ILEA 4HATA 2A5YB 4ZDJA 3QVVA 3TAHA 2QP9X 1IBRA 4TMXA 2OO7A 2LKDA 2WV9A 1FX0B 1DAEA 4MYTA 4OQMA 1E2HA 5E95A 2BMFA 4EPTA 4S2EA 1X3SA 2IYTA 5L3RA 4QM7A 4D0NA 2DFNA 2Y8EA 4H1VA 621PA 4QXAA 5CYPA 4RD2A 1KO5A 2BMDA 2QNRA 5IRCD 4ZDIA 3KQUA 3AVTA 1KI8A 3OZXA 1KDOA 1G3MA 1SXJC 3ICQB 3FWYA 1RIFA 2W6IA 2RGBA 2GXQA 3TR0A 3UPUA 4A8JC 3QG1A 4LJYA 1YU9A 1SQ5A 2BBSA 3A36A 1ZIOA 2K5UA 2ZTSA 3RS4A 4QFMA 1G64A 1N3BA 3NHBA 2AX4A 2WIBA 2O8CB 4OBEA 5DI3A 1G3RA 4OK6A 1JQLB 4AKHA 2QP3A 4CEHA 1HQYE 3ZQ6A 5GJCA 2FSGA 2TMKA 421PA 1PLKA 3I5XA 1T9HA 3ZZTA 3FMPB 5EXPA 1TTTA 5JEEA 3NC0C 5TB5A 521PA 1M7HA 3R7WA 3TQCA 1FTSA 4KJZA 2O8DA 1S9DA 3WMEA 4C0QC 3TR5A 1TX4B 2GXSA 2J7PA 1VCIA 2WPDD 1TUIA 3A4NA 3MG9A 4IOKA 1DO2A 4H1UA 1OPXA 2J7KA 1JB1A 1JAIA 1UDXA 1YZUA 2C99A 3QKSA 2BMJA 1XMJA 4GFDA 4LYAA 4DLYA 3TUZC 2WAXA 3D31A 1NBME 2JLVA 1C1YA 1MR3F 5JI2E 3GLGA 2ZJ8A 4RD1A 4JLPA 4M1OA 4LUCA 5DLQC 2FZ4A 4MYUA 3CPEA 4M22A 2IX3A 2F3TA 3A8TA 4Q9HA 1T3SA 3U6BA 5GVRA 2XX3A 1U8AA 5EXXA 4MKGA 4BFWA 1Q1QA 4I99A 5HZHA 4W7SA 1CJUC 2KJQA 5KNBA 1F48A 1G4AE 1KI7A 2I3BA 4QHYA 5DIFA 2ZAMA 3AP1A 2B7BA 3QVUA 2QBYA 1K5DA 2ZRFA 5J4LA 3LH5A 2GETA 3DHWC 1GSIA 2WM9B 721PA 1TBNA 2G1JA 2OSBA 4S35A 1ZUIA 1HURA 3T34A 5KSPA 1DPFA 4IEEA 2RGCA 4DCNA 3RVBA 2XZOA 2ZRJA 4K8OA 3RSOA 2GRJA 4B43A 3BAFA 4IEIA 3EAQA 3GJ3A 4D4LA 3CUEF 1FOEB 2FEOA 4V02A 4F92B 5JCZA 3M1IA 3K0CC 5EZ5A 4PPFA 2WPDA 4RVCA 2EQBA 4UXJA 1ZVQA 5SZKB 2C96A 1E2IA 1BIFA 2G77B 2JIZD 2DWPA 3BB3A 1QZXA 5E4FA 1XEFA 1Q22A 1DG3A 5EP2A 3BXZA 2VHJA 4V0OA 2PMKA 2JEOA 5EP1A 2QAGA 3QF4A 3BB1A 2BHRA 2WVJA 1ZIPA 3ZD7A 2GNOA 3WBKA 2EFCB 821PA 2RGNA 2BKUA 1YJ5A 3K70C 1M8PA 5L3SB 4UNRA 4K81B 4CZ2A 4I1VA 4MGYR 2VHQA 4QRHA 5FL7D 3RNLA 3RRZA 3W5JA 1H65A 3VU9A 2ZR0A 5E3HA 3ONWA 4QL3A 1CEEA 2W00A 2ANCA 3CRW1 2IEYA 1E2DA 2RGGA 1K6MA 4IOJA 1QDEA 2W0MA 2FN4A 1TF7A 2VP9A 3CKLA 4ZKDA 2Q3MA 4Q7LA 1ZNWA 4Q48A 1RYFA 4U00A 3VQTA 2OAP1 3CH4B 4G0NA 2JLUA 1KI6A 1Z0KA 2XNSA 3U3MA 4DRZA 4GOJA 4CEJA 3KKMA 1D9XA 5BXQC 1WB9A 1KY3A 4WW0A 3I61A 1AN0A 2NTYC 4IHQA 3QKTA 2DCUA 2DFLA 4Q7JB 3ZZUA 4D82A 1JJVA 4Y0AA 4DCUA 2HCBA 1FARA 4FN5A 5DN6D 3HU2A 1E0KA 2V9PA 4PZLA 1EESA 1E9BA 2JIZA 3IHWA 4OK5A 3CRQA 4BPBA 4ACBA 2ZEJA 2PT7A 1NRJB 4KITB 1RFHA 3IILA 1XWIA 3VNVA 1EFHA 5FBRB 2FG5A 3K0AB 3N2EA 2XXAB 2Z4SA 3UGDA 2CJWA 1ZNXA 4D81A 2QRZA 1SVOA 2ZYTX 4C30A 1AGPA 2FGKA 4E09A 1SZPA 1E0AA 4FMDB 4DCVA 2J3EA 4XSHA 3BH0A 3O47A 4C0LA 2PT5A 2ZE6A 4HAWA 4JLNA 4L9WA 4C0KA 2IS6A 1NIPA 1KSGA 4NCJA 1FUUA 1SXJE 4Y0VA 2VLIA 1IN5A 1X8LA 1QHYA 1XXHE 4UJ5A 3CH5A 2QTFA 2RGDA 3B1WA 1FFHA 2B92A 4Q66C 3UMFA 4TL9A 3WRXC 3MAAC 5GJVC 4MKIA 4M1YA 3PV0A 2ORVA 2ZJAA 3A1UA 4G5OA 3V4FA 3CONA 2FEMA 4TYYA 3WP1B 3W3AA 3UEJA 1YR9A 2ZUCA 1VG8A 1R0WA 5DNYB 1W0JD 2ZR7A 2ZSAA 4O0MA 2ZPTX 2J5XA 2VA8A 4C2UA 5JJKA 5B57C 1EFUA 4O2LA 3RABA 3QKRA 1E3MA 1FL9A 2OBLA 3K0FB 2F43A 2CK3A 2GEDA 4B47A 1N6IA 3WMFA 5KDLA 4MKHA 5DN6A 3Q5DA 3QXSA 2WWGA 4PAQA 1K8RA 2CMKA 4ZPXA 3EZ7A 3RRMA 4PQYA 3TRFA 2ZI7A 3SBDA 3HR7A 4OL0A 3T1VA 1G8FA 2PZGA 2CLCX 1E69A 4D26A 3OF5A 1CR1A 3AVWA 1G3QA 4JSYA 1NMYA 4AWXA 2PCLA 5G41A 1U99A 2N1BA 3LXRA 2QSYA 4MGKR 1G291 1AA9A 1IN7A 4IVRA 4KXFB 2PX3A 1AM4D 1P72A 2Q3FA 2IBMA 2FJUA 2Q6TA 4A2QA 3EIQA 1U2RA 2BWJA 3DEFA 4H9GA 5AJYA 4AKIA 1RJ9B 2HT1A 2HJVA 1W4AA 1ZU5A 1ZNYA 4Q9JA 4URWR 4O3MA 4OQNA 2WHXA 3PEWA 5CM9C 2FNFX 1JEEA 3Q85A 5P21A 1UBCA 1C4OA 1W0KD 4HDCA 4M4SA 2ZE5A 3K9HA 2P6UA 2A30A 2CCKA 4V0LA 4W5WA 3DMNA 1WBBA 2GAAA 3EXAA 2DB3A 2Z6VA 2GBLA 3VR6A 1ZCAA 4LGMA 3R8CA 3SZRA 2JASA 5JEDA 4PPNA 2QQEA 1OW3B 1MABA 4L15A 1G20E 4MQBA 4F91B 3E5HA 4RZ2A 2C78A 3EWSA 3NWJA 1XDBA 1UEIA 4HLDA 1EGAA 1E2QA 2XNDD 1KKLA 3W90A 4CEIA 2GA8A 5IDVA 5JECA 2O8EA 2FSHA 2VHUA 1AGRA 1CJVC 2H57A 4C0AC 3B78A 5KNCA 2CNWA 3ZD6A 3A1SA 1WXQA 3QPUA 2VSFA 2CLSA 4LBZA 2G0TA 2IHYA 3GFOA 4TQAA 2F1IA 4ZV4A 2KE5A 2WTUA 1OH7A 1XBTA 1ZM3A 2WWFA 4DLSA 2ZRKA 4TL6A 2FFBA 4TTPA 1KO7A 4XIGS 3NBXX 3QXHA 4RD0A 5FOVA 1UPTA 4PC2A 3UG6A 2ROWA 1ZP6A 5BN5A 1W36B 5EE3A 3MGCA 1RFLA 4E5UA 1W5SA 2WICA 4JBWA 1RRCA 4GMDA 3MWJA 4V0ME 3RWMB 2FU5C 3AVXA 2I1QA 1WCV1 2BC9A 5FPKA 3K9LA 3ECCA 1US8A 1VCMA 3B1YA 3GLHB 4UJ3A 3SJAA 1XXHB 4HZUB 3A6PC 2WSMA 1E0JA 2KSQA 2OCYC 3SHWA 1ESNA 1A2BA 2F55A 2V1XA 4WBSA 4B3GA 4GZLA 3RS7A 3NH9A 1W0KA 1KI4A 1SVKA 2GEVA 2XEXA 2ZVPX 3GCGA 5J4YA 4OHYA 1YZTA 4Q4HA 1RYHA 2SHKA 1IONA 2BMEA 3HU1A 3IIKA 1YZLA 3VAAA 1N0VC 2ZYVX 4WZAE 3NXSA 4IDOA 2EFHB 2R6AA 3OIYA 5CDFE 1G16A 2Z5FA 3L0PA 2ASEA 4G5RA 4R71A 4UNPA 4Q7MB 4B2IA 1XPOA 3IUYA 4LJ7A 2IEZA 4QBIA 2ONKA 5BW8A 2ZRPA 2XNDA 3QJYA 2O0KA 4JLBA 2D74A 1NLYA 1OYYA 2FH5B 2ELIA 4DSTA 2J1LA 4MDFA 2FMXA 2QM7A 1N2CE 4LZZA 4F93B 2YVUA 1NMZA 1YR6A 1DAFA 4KCGA 2A5DA 1HH4A 4D0GA 3KKOA 1OB5A 4BRUA 3GEHA 4YMUA 2QG6A 4HAZA 1FPMA 4EJSA 1FNNA 2C03A 1GUAA 2MMGA 1XU4A 2DB6A 2DFKB 3U3OA 5TV2A 1LY1A 4AY2A 4IFBA 5DH9A 2OBMA 2QTVB 5TMPA 4IJMA 1E2EA 3BH7A 3L43A 5C2JB 3DDCA 4Q4AB 4BUJA 1P6XA 3W9YA 3GJ5A 1NN0A 3IPXA 2CL0X 1T91A 5J47A 4AK9A 4IDQA 1VYTA 2ZROA 4JSTA 1UF9A 2ERYA 3B7GA 3ZIAD 1IJFA 3FHCB 1E1QA 4MKFA 4Q02A 4JJKA 1GZSA 4Q18A 4ZDWA 1A7JA 3GLFA 1EFRA 1TNDA 2GILA 3W8RA 5H1YA 3WBJA 3I3SR 4A2PA 3SJBA 3SI7A 2QMUA 2F9MA 2X8AA 4C0BA 2C95A 1S2MA 1TQ6A 1IHUA 4QNRA 2QENA 4MRRA 3CWQA 1LNZA 3UKDA 3P4YA 1R10A 3KKQA 3WXMA 1KAGA 3TSOA 4EPWA 2OFOA 4G01B 4RY2A 4PFSA 1VG9B 5SZIA 2XSZA 3SYNA 2H7VA 4LV8B 1X1SA 2JLRA 1Z0IA 3QQ5A 4Q1FA 4XWOA 2J45A 4NTZA 3CF0A 4B44A 3TVDA 4EAQA 5C4MA 4NYJR 3TMKA 4LHYA 3UXMA 4PSKA 4RFSA 4F4JA 1XEXA 1HE1C 1WDTA 2PX0A 2VHCA 2ZU6A 2EWWA 2CLDX 5DI3B 2WWHA 2X2FA 1Z6AA 3SFZA 4D0LB 2R2AA 2ZRMA 4C0HA 2PL3A 4M1TA 1IJEA 1R0ZA 4TYPA 4L9MA 2WWYA 2IT1A 2QMHA 1IXZA 1G8GA 3B1XA 3IHLA 4UQOA 1R2QA 3KJHA 3EX7C 3NIBA 5FFMA 2FDCA 4B33A 2CXXA 4LPKA 3R7WB 1B0UA 3REFA 4M9SA 1EX6A 2O8DB 1M2OB 2XGJA 1U8ZA 5UKDA 2V7QA 2ZJ5A 3T1TA 3SR0A 3VR4A 3AF2A 3SNHA 4QJ4A 3W6OA 3NG1A 4BWYA 1GP2A 2ZANA 4RKFA 2VO1A 5TVKA 3SS8A 1E9SA 3ZIAA 4PR0A 4WZ6A 2GF9A 3FMIA 3MWLA 2D4HA 2CBZA 3TSWA 2GEUA 3E2IA 3KKPA 3QKSB 2JJ1A 3VKHA 4NCIA 2QPAA 4URXR 4ZDKA 2ORIA 3GLGB 4MYHA 2YUUA 4LYFA 2YOGA 3PG5A 1N25A 4GZMA 4I1SA 4DEYA 1KO4A 1KYIA 4Q1BA 4DZZA 4PANA 2A9KA 2NO1A 3ADKA 5FTJA 2YC4C 2YOFA 4LC0A 4MRSA 1NJFA 1J70A 1XPUA 3FMOB 4KLNA 5AUOB 4L4UA 3BRWD 4NYIR 2JLZA 5C46F 4YMWA 1KIMA 2OILA 4U5XA 1PLLA 1T8UA 4RD3A 1NVVR 2OLJA 1ZAKA 3ZVRA 3VR5A 1OXVA 4KODA 2QBYB 4C3ZA 2VRWA 4V03A 2IF0A 3T5GA 4BLPA 1Q3HA 4M2LA 2D06A 1E2LA 4LJ8A 4JVMA 1KSFX 1L2TA 1RVDA 2GVDC 1HT2E 2W2XA 4QHTA 3TKLA 4EDHA 2HYIC 1Z08A 3A37A 4DC9A 4AYWA 3K0SA 2PZFA 1IN4A 2DPXA 1YQTA 4JVLA 4OJKA 2W2TA 1CTQA 1E2PA 2YWHA 4RCYA 1LTQA 1ETUA 1OE0A 4LJAA 4XVQA 4A6PA 1Q12A 121PA 2WJVA 1F6BA 2VP5A 1E2KA 4ITRC 4TWZA 4B71A 2WKQA 4FCVA 3PXGA 1E96A 2QGNA 1X6VA 2BM0A 4JJZA 5AJZA 4JLAA 4HLUA 1PZNA 1PVOA 1JR6A 2IXGA 3BWDD 4YDSA 3VNUA 1Y63A 1R5OA 3D6TB 2A2ZA 3A4MA 5FOUA 1NG1A 3DM5A 4PZYA 3ADBA 1YZGA 3CF6R 2A5JA 3OFND 5KSOA 2H18A 2VP4A 3J81k 5CJ2A 3PUVA 1P62B 4HUQA 3ZDQA 1EFTA 1CRPA 2RB4A 5FPSA 1QHHA 2ZI9A 2O0JA 2QAGB 3BB4A 3QF4B 2P2LA 1PUIA 5HKKA 3H4MA 4HAVA 2XJ4A 3RS5A 1E4YA 1ZW6A 2UKDA 4WVFA 5JZVA 1JR3A 2WOJA 2VP0A 4DUGD 4OHXA 1OXXK 3LFUA 3A4LA 3BORA 2OEPA 4IDNA 2GJ8A 1IOZA 1XNJA 1MOZA 3QPWA 2OXRA 3K09A 3VU9B 3EZ9A 1GIAA 3OE7D 4Q4JA 4B6FA 3EPKA 3ZLJA 1ZM4A 4F4CA 4MYCA 1GILA 1J8MF 1KI9A 3P20A 3WYAA 1N5JA 3BFVA 1KZ7B 4ERNA 2BBOA 4LBWA 4QKQA 2VL7A 1ZD1A 2EYQA 1UM8A 2ZJYA 2DFTA 5HR5A 1U9IA 3K70D 5ELXA 2B6HA 1G7RA 3N5CA 3NTUA 4KAXA 1L4UA 2R62A 1KI6B 4R9UC 4WXPA 3S1AA 3BJIC 4DB2A 1W36C 3CZQA 3SN6A 1PTQA 1EFCA 1NIJA 2EYUA 4CEJB 3QE0A 2DWQA 1VIAA 2ZRBA 3TGPA 1KNXA 3NKVA 2F1RA 1FZQA 2XB2A 3CRMA 2XOKD 1NVWQ 5LD2B 1MO5A 1YRAA 1TEXA 3SJZA 4EFLA 1M1YE 2CEAA 3UWOA 1YE8A 1NSTA 1OXSC 2IF2A 2WSSA 4WZBE 4XWKA 1CF4A 3AKCA 3C15C 2QI9C 2ZRDA 3DO6A 2ZSBA 3MMPA 4M21A 1II9A 3TE6A 4HZIA 1ZCBA 4B6EA 4M53A 3B6EA 5BN3A 2QP4A 2WWXA 3M0EA 3OFNA 2FSIA 3PFIA 4OQFA 2VEDA 1AQYA 5DYGA 3SOPA 2ZRIA 4L8GA 5FPTA 1JJ7A 1EXMA 4QGGA 4B2PA 2MSCB 4PQFA 2OESA 1E9AA 2ZRAA 4HAXA 2HUPA 1OHHD 4KU4A 1OF1A 2ZRCA 3B2EA 4PQRA 3VR3A 3GEIA 2XITA 4A0FA 3RS0A 2MSDB 4LYHA 1E2FA 1G4UR 4TMZA 1G7SA 2ONJA 5FTLA 1Z6YA 3JZMA 3THWA 2QE7D 4LJ6A 4G3XA 3OE7A 4L16A 4RKEA 1E79D 1D2EA 4NL4H 1E1RD 1JQJC 3ADDA 2H8KA 2AD1A 3CRRA 4ABYA 2YC2C 4N0DA 1L4YA 3K8YA 4DKXA 1ZINA 3DKPA 5DE3A 5EP4A 4B73A 4B76A 2QN6A 1Z29A 4OK3A 3MJHA 4DLZA 5K8UA 4ZKEA 3HYTA 4KYIB 3GEEA 3B1VA 1WMSA 3UANA 5AJWA 1UBEA 4TMKA 1NSFA 1G8PA 2ZETA 4JIMA 1A4RA 1IXSB 3IQXA 4LJ5A 5SZJA 1W4RA 2XOKA 3QEJA 5J40A 1XCMA 4N0EA 4ESHA 3I62A 3X1ZA 3U2QA 4BFUA 2VYFA 3N2IA 3LVRE 1TEVA 4F4IA 2KWIA 3IIJA 1JPJA 2P0EA 3TLXA 3BBPA 3REGA 3D3QA 3LDAA 3E1SA 4PC1A 2Z83A 2FFAA 1IQPA 2VP2A 4LWZA 2CCJA 1QHIA 1GG2A 1QVAA 2FX3A 5J4KA 2J0UA 1SVWA 3OIVA 3AVVA 3MWKA 4ZCMA 1T6NA 2REBA 5CK4A 3EA5A 3WRYC 4X8MA 2XTZA 1RZ3A 3LA6A 1Q20A 5BN4A 2YOHA 5CYOA 3L8ZA 4KBFA 3WY9A 4FKDA 2ENNA 1KSJA 1J8YF 3IIMA 1F3OA 1ZBDA 1W7AA 4PPQA 1QBKC 2IUUA 5BYJA 4BRWA 1A5TA 2QE7A 1DBSA 3WHKA 1E79A 1N6NA 3GFTA 1XTSA 1E1RA 3IKJA 4HB4A 1DS6A 3EZ6A 4NYJQ 1OFHA 1YZQA 3CX8A 1U81A 2WMOB 2R44A 3SBEA 4LDJA 4KO8A 4OKSA 3W8NA 3GLFE 1PV4A 1R4AA 2GCPA 1SGWA 3L2OB 1LB1B 1MABB 1XJCA 3KDSE 1X86B 4A82A 1NP6A 2IS2A 4DLXA 3QOFA 2YINC 3UK6A 4ASUD 2OHFA 5FUXA 4CEIB 1JAHA 3Q9LA 3U44A 1GRQA 3GLIA 2O8EB 5IK2D 4KVGA 1KJZA 5AWFC 4B35A 2NPFA 2JCSA 3PEYA 2J87A 2G1KA 2RGXA 3GJXC 4AG6A 5F98A 1KK3A 2IHBA 4JLVA 3D7MA 4GP7A 4DXAA 2E1RA 3KQNA 1P3JA 2ZUDA 4HB0A 1FQJA 4NYMQ 1F60A 4RCZA 3EPJA 5HCIA 1TU3A 4KBGA 4DLWA 2ZS9A 1ANKA 3FFAA 4HDOB 5KNDA 4BLSA 3THYA 1VPLA 2IYXA 4B3CA 3F8TA 5FBLB 1W2GA 4R2HA 1M7BA 2ZI5A 1U94A 1US8B 2ZJOA 4TQUS 4DCSA 3SE0A 4NZYA 4TLCA 4NP6A 2FSFA 2L0XA 3C7KA 3CWZA 4E03A 1XFAA 3QXXA 1S3SA 4KYUA 2D2FA 2NO6A 4NYIQ 4KLZA 3A1TA 5J4VA 1XJ0A 2E87A 2IUTA 2QA5A 2NZJA 1NVVQ 1Z47A 4Q4HB 2HDNB 1W1WA 2WOOA 4PAMA 1MRNA 3H84A 1QG2A 3RRNA 4XVRA 4LYJA 4X8LA 2XZLA 2B8TA 1G41A 5SZHB 3RC3A 4GDFA 2HLDD 1J2JA 2HXSA 2AK2A 2ODBA 2RHMA 2ZREA 2FFQA 3IPYA 4CGZA 2A3RA 1GL6A 2IXEA 2VF7A 4LHWA 1GVNB 2C2HA 2HF9A 5FL7A 4OI0A 4BZPA 2ZRNA 2Z4RA 2YYZA 3B60A 3MD0A 2QY9A 3GLHE 2R6CA 5FOWA 1JI0A 2BIFA 3V4RA 4AYTA 3Q3JB 1R0XA 4Q4LA 3CNNA 1TU4A 4PHFA 3ZJYA 4BE7B 3FDIA 3A1WA 3KTAA 2Q9BA 4GPTA 1G5RA 1KK0A 1VMAA 3CX6A 1OH6A 3SU8A 3W6PA 3EWAA 1J7KA 2QAGC 2YWGA 2QQ0A 1W48A 2C5LA 3LRPA 3MJRA 3RS2A 1E6CA 4L5BA 4HDQB 2NIPA 2ZRLA 2AN9A 3L0SA 3M6AA 5JLJA 5H8WA 2RGNC 5G3ZA 1Q1ZA 2GTPA 4DDUA 1HE8B 4GOXA 2I4IA 2EVWX 5DYIA 4XH9B 5AUPB 5L3VA 5CK5A 3TH5A 2Q9CA 4TLBA 5L3QA 3Q72A 3H1TA 3CR7A 2D3WA 4EUNA 2O8BB 2QL6A 2ZM5A 4US1R 4IKEA 2CVHA 5FTNA 1F5NA 2FPLA 4DT1A 1NNEA 3GLFB 1JECA 4X8HA 1YR8A 3T12A 4OYHA 3FVQA 4BGDA 1XEWY 5KSYA 3MRSA 1AK2A 4JBXA 1ZM7A 1G7TA 1BS1A 2R8RA 4TMWA 5LBIA 2GJAA 3AV0B 3CXLA 2HLDA 2ZS7A 3ASZA 2MSEB 4LV6A 1MV5A 2ATXA 5FI1B 4FCWA 2IK8A 2OFXA 1OH8A 2GXAA 1P61B 2RMKA 2QMOA 2A7QA 2PBRA 2ZUBA 1ZU4A 2F7SA 1SHKA 1JR3E 1XCPA 1XTKA 4UXHA 3AP2A 3EASA 3PUXA 1BYUA 5LD2C 1T3HA 4YDHB 2GWHA 3V00A 4DSUA 1NL3A 1NN1A 3HR8A 3NBFA 4AKGA 3O8BA 3EIEA 4UNSA 1DARA 1G17A 2OE2A 4RFSB 3ASYA 3QXCA 5JCPA 3ADCA 1G5PA 3X1XA 2CHVA 1S0UA 3OEED 3B13B 2BKEA 4URUR 4BQSA 4UNNA 1F2TB 3L82B 2OFWA 3X2SA 2OG2A 1SVMA 4JT2A 2JJ8A 4BFXA 2BDTA 1G21E 3PEUA 5F2EA 2O52A 1SKQA 4RZUA 1DE0A 4LX0A 1W0JA 4MRPA 5LPNA 4QM6A 1GKUB 2KB0A 1LVGA 2ZSEA 4JYBA 5AUQA 5BWMA 4TN1A 1NBMD 4YONB 1JNYA 2QUZA 1T0HB 1X1RA 4A4DA 2D7DA 3F0TA 1XZPA 2KBFA 2HCJB 3AVUA 2PJRA 5CLQA 2EFGA 3H0KA 3UGIA 4WIAA 2JLXA 4QGHA 1O87A 3CRVA 1DTSA 2VPPA 2ZI4A 3DZDA 5FBWB 1G3IA 5D3MB 3BOSA 1H8ED 3PVSA 3LX5A 5KSZA 2PZEA 1U0HC 3QUSA 4PC7A 2OBNA 1VCOA 5J4HA 2AFHE 1S1CA 3DZ8A 5JBQA 1ODFA 4P4TA 2YNMA 2AHOA 5FUYA 3QF7A 3ND8A 1G9XA 1R8SA 4Q03A 2V8OA 1G7CA 5GJWC 2XTMA 2W83A 2BOVA 3CBQA 1ZD9A 4PO9A 3AF0A 4BZQA 1OLOA 2WMNB 1CRQA 1COWD 5EE1A 5FBVB 3ND9A 2GZDA 4F7WA 2IYRA 5TARA 3N70A 1N6PA 3ZS9A 1VKJA 2F1JA 2P5SA 4Q19A 3VR2A 2EU8A 2OLKA 2VRWB 1CJMA 1N6RA 1V43A 1XD2A 2IYWA 3ICEA 4NCNA 3OEEA 3AUYA 4EPRA 2BCJQ 2WWIA 3NDBB 3KJEA 2DWOA 3QBVA 3GLGE 4KV9A 1WA5A 5H68A 4NCKA 3KXKA 4NU0A 3FB4A 1E32A 1KNQA 3PR1A 3U3KA 4C2TA 2WJIA 1GKIA 2HEIA 1GFIA 3ZYCA 1E4VA 4FI3C 4A36A 1VDZA 4FW9A 1E99A 3I1FA 4LBYA 5EXTA 4PHTA 1TQ4A 2GCNA 3RC8A 2G6BA 2WJJA 1BYIA 2G0NA 4JBYA 2J9RA 2CVFA 4OQXA 4AIIA 1AJEA 1BKDR 1KDPA 2GVZC 1P9RA 1Q44A 4XWAA 5KTYA 2N42A 1DO0A 3LBNA 2QORA 3U3JA 1XX6A 4HUQB 1H8EA 4HAYA 4RD4A 4CVNA 3WP0A 1QHHB 2GBLC 2BBTA 3AKEA 1IN8A 1CIPA 2BM1A 5LB2A 3GJ6A 1LFDB 4G1UC 1FMLA 3AUXA 4FINA 5EZ6B 1OB2A 1NI3A 1ZRHA 2GCOA 2P6NA 4TMTA 1KBFA 4O2RA 1OT3A 1Z0DA 3IO5A 2X2EA 4D2IA 1XCGB 4GP6A 1NMXA 2ZE7A 1D2MA 1FP7A 3PJRA 2PCJA 2FOLA 3VX4A 4PAOA 1AS3A 2JDID 2J0SA 4FWIB 3RHFA 1N0WA 3CNLA 5FI0B 1LF5A 2RGAA 3DOFA 4B3DA 3BIFA 3K9GA 4MUBA 2EFDB 4OI2A 5CM8B 5CLLA 3EG5A 4CT4B 4IRUB 2CE2X 5LB4A 1QRAA 1KMQA 3AF3A 2KI5A 1AS0A 3B1ZA 3H86A 1TF5A 4JL6A 1DG1G 1AIPA 2V1UA 2ZI3A 4PXAA 2X1VA 1XJQA 1U0JA 5FOXA 1BMFD 3KY9A 4XTCS 1SKYB 3CPJB 4DLVA 1FTNA 4Q01A 1P75A 1G3UA 2RKOA 2VSOA 3UFFA 4NH0A 4QGAA 3EC1A 3KXIA 3U5ZB 3QXJA 2B8WA 3HP1A 2ZXUA 2NO9A 4NONA 5FBQB 1KMHA 1Z0AA 3P32A 5GJBA 1W36D 2NMVA 2C77A 4KFSA 2C9YA 1ZM2A 4V0NA 1QVRA 4M9ZA 3GPLA 2W6JD 3W5IA 3F3YA 1QF9A 3QY0A 4CEHB 1AZSC 2JLSA 2J46A 3VKWA 5JHHB 1H8HD 3WHLA 3THOA 3LQQA 1CXZA 4FMBB 1E94E 1LS1A 1QHXA 2ZIAA 1SXJD 5EUQB 3CR8A 1S4QA 3AGPA 3DMDA 4DHEA 3FYHA 5K8LA 5GVSA 1XTQA 4GOKA 4IXNA 4M1WA 3I5YA 1TUEA 2BBWA 5EXSA 4DIDA 1GWNA 2QU8A 4LPSA 1KKMA 5FR2A 2WKPA 4U02A 4ZIRA 1DAMA 3OHMA 4I1OA 2DR3A 4DEXA 3KQLA 2J41A 1VG0B 4D80A 1P2VA 4JLJA 2RGEA 2WBLC 2AR7A 1GTVA 1R79A 2IA5A 2V6JA 4TLEA 3E70C 2BJWA 2JDIA 1Q0UA 3KB2A 1S9HA 4V0KA 4Q47A 3LW8A 3B82A 5FL3A 4OI1A 1VHLA 4ZI3A 2ZJBA 4TYNA 4KHZA 4LJ4A 4EJSC 2WKRA 1M6NA 3C4JA 4NPHA 1LV7A 2Q21A 4J0QA 5HE9A 4GMXA 4DVGA 3SJCA 3UEYA 5AUNB 1W49A 3IDQA 1NF3A 1UKEA 4B32A 2IS4A 4QJ3A 1T5IA 5J5CA 3TW4A 2YJTD 4EPXA 1U98A 4BLTA 1BMFA 1N5LA 3FTQA 3SYLA 5KHOC 1G8HA 4WOPA 4M9QA 1U90A 4DLTA 1DVRA 3T35A 3MUFA 1HUQA 1GKYA 4ACAA 3RLFA 3CO5A 4CYMA 2KBEA 1JPNA 3PUYA 1CR0A 1Z6TA 2C04A 5EJEA 2IYYA 3KQKA 8OHMA 2GVIA 3TVTA 4EQ6A 1OFTA 2J0UB 1EK0A 4Q5IA 3K0EA 3U4QA 4Q21A 4TLAA 5JFGA 1H8HA 4UKDA 1CLUA 4HB2A 1A1VA 2FFHA 3Q7PA 1SXJA 3MLEA 2XZPA 5JRZA 4US2R 1TBOA 1FW6A 4A8JA 3HWSA 1IM2A 2G83A 4B3BA 2P67A 4KFUA 2HXYA 2MMCA 3EC2A 3GFPA 3QKUA 2VBCA 2RAPA
chains in the Genus database with same CATH superfamily
3JQAD 1MT3A 2PD6A 3F71A 3A3PA 3BUSA 2B83A 1I4TD 1XDUA 4RM2A 3QX7A 1YU6C 4ZVOA 3ZLUA 1M7GA 4TUYF 1YXMA 3G2LA 4J9VA 1UJ2A 4WLVA 4ZYZA 4JXJA 4QGFA 5EWMA 1J8FA 5B6IA 4YRMA 2VTKA 2UYQA 1EE9A 3TNDA 3G82C 4R1QA 2O7NA 3BK7A 1XPJA 1UBJS 5JJLA 5AW2A 1R0RI 3AQ4A 4U2EA 1FS5A 3HGTA 3FGNA 3L7DA 1JJBA 1QK5A 1X9IA 2OAEA 3KX2A 4G5GA 4EP1A 1WL8A 5EQTA 4S05A 3G89A 4KREA 3RJ9A 1KQNA 4UTZA 1L7XA 4GKKB 3P0JA 5HDQA 3R9KA 1D0SA 1TB4A 4NVRA 4XWGA 4K9RA 3RC7A 5DHAA 4ZGGA 5HRCA 1Q0TA 2XUQA 2YV1A 3GCDA 4AF6A 3IUEA 1J24A 1QHGA 3GPCA 2XA1A 5U4QA 4TS3A 3WYGA 1Y9EA 1Z2NX 4MWBA 1C8BA 4EY7A 5JPDA 1JFVA 4EKDA 1JDVA 1OX4B 4ZO8A 1GNLA 1MQAA 3U44B 3EIWA 3UIEA 2JEYA 3WYFA 1K4YA 2YRWA 2DXIA 1DCTA 2BGLA 1JTEA 4DY4A 3DF7A 5DXJA 4XDHA 4OJQA 4Q1DA 1W44A 3X1YA 1KI1A 3LAWA 4GYKA 4MW6A 4WKPA 4DBVO 2FZKA 1H69A 1TCBA 2X77A 3BK2A 4LCBA 3V2GA 1GUDA 1NHGA 1YTUA 4FHZA 2ZWMA 5TX7A 4YCLA 5C9ZA 4DMKA 3EG9B 5FKJA 5H80A 1VKZA 2BYTA 5TGDA 2D3TA 2GR9A 3CMMA 1DZ3A 3FIUA 3ZHRA 2ZJ7A 5A3RA 2VEOA 1AS2A 3HPQA 3V8MA 2XMRA 4DC1A 3AH8A 2AXQA 3TW0A 2AFVA 3AEQA 4KLCA 3WGMA 4DYHA 1FDUA 5K3FA 2N1AB 4WK0B 5F7XA 2XUPA 4J0IA 2JATA 4KR3A 1QGUA 3WSWA 4EFNA 3L1IA 1DTWA 4EAAA 2PPLA 3AV3A 4YMLA 1HPTA 4WJZA 5ALDA 5ANRB 5ITVA 4BLQA 1LBQA 2OAQ1 3VYRB 4W1QA 4NFHA 2C4HA 4XW2A 4Z51A 5EHXA 1LC3A 1GADO 2DY0A 4UAGA 3ZK9A 3O3CA 4MHSA 2XE4A 2QGZA 2O14A 4B3MB 2DBZA 2P27A 3RSFA 5JWRA 3IP7A 1S01A 4LDPA 5LZ5A 3LUHA 4JUBA 3ILYA 3U39A 4DCTA 3D7LA 4H1TA 3FFTA 1N5MA 2NQ8A 4MVJH 4M0MA 2GDZA 2GYYA 1ZD4A 3ZKWA 4BMNA 4DWWA 2GT1A 3VDPA 4ESVA 4IS2A 5FUWA 3TIVA 2VP6A 1T9GS 1YS9A 3ROEA 3RYCA 2Z09A 4A8TA 4CNBA 3WBFA 1T5SA 4ARIA 2J5RA 3W1VA 2NPOA 3ELYA 3RYFB 2PQ6A 4H60A 1NT4A 3GLSA 3BK1A 1FUYB 1IC6A 3ND5A 4P3YA 2IYSA 5TIIA 3BWYA 2NSHA 3T3HA 1X1BA 3WGOA 1UBRS 3QX8A 4ZOEA 4BECA 3D3NA 2FUG1 4GEKA 1QRTA 5AW3A 2CXNA 3ZOZA 3HG7A 5GONF 3DT6A 2MYUA 1OH7A 4BJ6A 5TF4A 2IC5A 2YJ6A 1M1UA 5U9CA 5DEOA 2OC9A 3OURA 1UFVA 2YBEA 4DMHA 3JAMA 2QN2A 2BMVA 2QX7A 4EYQA 2E4WA 3BBLA 4QAQA 3SR3A 1W5TA 2QYOA 3EDMA 2AR9A 2ERXA 4EUEA 1YKGA 4TS9A 1H1LA 4ZRNA 3X1DA 1RYMA 1OZFA 2N3ZA 3C41J 5ED4A 2B99A 2HTFA 4M1MA 1PWHA 3TSYA 3ZIUA 1V7PC 2GHIA 2OBFA 3PJEA 1ILWA 5TQ2A 1IXRC 3BDAA 2FEXA 3B8HA 4OHBA 3A1VA 2O23A 1G6KA 4TQ9A 2OR3A 4CT5A 3QFRA 1F14A 3BMNA 3TGLA 1PQ4A 1NQVA 2P8JA 1YRQA 2NUTB 3EVTA 3KQQA 1TF2A 2FMKA 4N4AA 4JMPA 3W34A 5IVIA 3G13A 1CU1A 5K4HA 9MHTA 3CUVA 3LBFA 3WLAA 1UBGA 2EBUA 4HGPA 2IP2A 5CDFA 5HQ3A 1OFIA 4G4GA 1I7DA 2VUUA 3M6IA 3LDHA 5EXDA 1XFDA 2NU2I 1QOZA 1ZG3A 4G5SA 1BX1A 1WRBA 4IGKA 1VYUA 1VSTA 4NCXA 4DT1B 4EG0A 4URVR 5CB6A 1V5GA 4P3KA 1IBKB 5B1SA 4Y6OA 1QH0A 2J08A 3A4YA 4F5YA 2EBWA 2VDVE 3FD8A 1UWVA 3TCXB 5M7EA 2VJOA 4N48A 3AW8A 1H85A 3BXEA 3OESA 5LCXA 3T1NA 2PGDA 5DM2A 2P40A 3KXDA 1OHHA 2QXUA 3C3JA 3TW8A 3H9EO 1SVLA 1V39A 1CUHA 4OJNA 5ESRA 1OIVA 5TJ9A 1KZ9A 2HMAA 3RTEA 2P90A 3S4YA 3EGCA 5JSZA 2NAFA 4LXGA 1TADA 3I4FA 2ENUA 2Q1YA 4FLEA 1CP3A 2XF8A 2CE7A 4DNFA 1BHO1 5FP0A 1OVMA 4QXQA 1C50A 3Q7QA 1W76A 4NZZA 1Z8NA 2HRRA 5GWXA 2O8FA 1FP6A 3JRWA 3MWFA 4P7BA 4EARA 4EB8A 2SGDI 1CQIB 4XDGA 2J3QA 2GPYA 4B7AA 5L6MB 1PEKE 2DMRA 3ABIA 1DWUA 5LQNA 3FKSD 1ENPA 1T5BA 1G8AA 1XZNA 4PG5A 3L0BA 1GN9A 1HV8A 5FTKA 2XUKA 4CN9A 4M46A 3RCBA 2FA9A 1Y8FA 3WOHA 3DC7A 3UMVA 1G6HA 2XECA 2YCBA 5B55A 5JY1A 1H2AS 1I14A 4DSNA 1Y82A 3IAM6 3AHHA 3I32A 3GUCA 2Q4TA 3VPAA 3C8UA 3OLCX 4L5JA 4KVZA 4R2LA 5KPJA 3IEVA 1NBHA 2WUGA 3PI6A 1XZAA 3IMCA 2RCNA 4JFAA 1Q84A 3C5HA 4OMFG 3H4VA 5C1IA 3K32A 1EP1B 1O97C 2VWGA 3CX7A 4KDFA 3SZGA 4JX9A 2NPIA 3JVUA 3KTDA 1R0YA 2HJGA 1CGII 3DA8A 3PA6A 3R20A 2GKVA 3L8YA 3V1YA 5LOVF 2WZQA 4YXWA 3EW9A 4LZWA 3K20A 1KMAA 2Z98A 4YI5A 1T3ZA 3M3HA 1E5LA 3BD9A 1JQKA 1QYCA 1UM9B 4LQ4A 1Q17A 3B9PA 1ZD3A 4D5GA 2VUSA 4ALIA 4I4TA 2ZZKA 2R6DA 4H6XA 2A7XA 1W73A 2R6FA 1H4TA 5ARCA 4PQEA 3ZJUA 3EPHA 3DBLB 3MRVA 3DWGA 1F5SA 2F6RA 3DNMA 2Q2VA 1V5WA 4WT7A 1IBMB 1SGRI 3VISA 2B7CA 3ANSA 3FXAA 3OPYI 5U1PA 3RSLA 4AD8A 1I94B 1EVEA 1O9GA 3EFEA 5C1OA 1N5DA 3DONA 3VU0A 4R7ZA 4X61A 2LWIA 3ORSA 3U7GA 3GJ4A 3DMHA 3MWYW 2NVUB 6ADHA 1D04A 4WNAA 3MTEA 5K0SA 5KTSA 3WJ1A 2CD7A 4ND8B 4KV7A 3NH6A 2J9ZB 2XCQA 3C5VA 2QJTA 2NXEA 1JQDA 3IUPA 1LH0A 3K9CA 1KFJB 1SBIA 4P54A 1X3LA 4XEUA 2PMDA 1TTQB 4FONA 4UTOA 2FPUA 3ILXA 3D0QA 1E8MA 1I3NA 1KSHA 3GB9A 5AK0A 4IBOA 4RK6A 3L7BA 2BJVA 4D9CA 2GM4A 1NXWA 3C6KA 3FLMA 5WRFA 4BFCA 1EJ0A 4HLCA 3CKMA 2V3CC 5CT5A 1ZVMA 1VGVA 4CG1A 1PWEA 3DE7X 5JCOA 2QOEA 1HDGO 1LNSA 5CGZA 1A8UA 4KMOA 4QTXA 4MI9A 3UAXA 2OQIA 4X94A 1P2UA 2O8CA 1IZZA 1YB1A 5KQGA 1JHDA 1UBFA 3T4EA 1Q0RA 4PS1A 2ID4A 3M33A 3MCVA 4K9PA 2G70A 5F64A 1F51E 3OLXA 5JBNA 1Y8AA 3VC7A 1XLTC 2RDMA 2QW8A 2N0SA 5HRAA 1N8SA 2JLQA 2XOEA 4QDUA 1FDRA 3EJ6A 2WFAA 1TUGA 4C01A 2RH5A 1HDZA 1VBFA 4OB7A 3UMGA 4YRKA 4B3FX 2FK7A 2R2GA 1RBMA 5CX4A 2ZITA 4B6RA 3AVYA 3ZHZA 4BMVA 4IIGA 4R9RA 4ZO4A 2P6AC 1QC5A 2QUKA 1Q16A 3PEEA 1CWUA 1MIHA 4FT4A 4FKBA 3OIDA 3C5EA 1WF6A 4UU1A 4A0RA 4W5TA 1Z2CA 1PNQA 4WFIA 3SE7A 4XGIA 2QM8A 4IIHA 5JQGA 3U1VA 4AQ7A 1Z18A 1JHZA 2BKXA 1JH8A 2XD4A 3C3YA 3AHEA 4X6XA 4QFCA 1AQJA 1EUQA 2ZTVA 3I92A 3KSAC 3OTOB 2OXEA 4QUEA 5IT0A 4HYEA 2G28A 3OF2A 1V95A 1W94A 3LC7O 4JELA 4AWAA 5F9HA 1X2EA 3EXIB 1UQUA 3VR6D 5ER6A 4BLWA 4N5LA 3GJ0A 3N76A 4MP8A 3IBYA 1RJWA 3EH1A 2AVNA 4ZVMA 2WD7A 3ZU6A 3NDPA 4HQ6A 3C87A 3H1FA 5EESA 5KX5F 4YI3A 4H7EA 2VNAA 4LX8A 1VHTA 1XN4A 3R23A 2Z95A 5FA5A 3Q41A 3L4KA 1AHNA 3VO8A 1MW9X 1ZD8A 3QFFA 3BJEA 3U7FB 4NEQA 4MMXB 4DCCA 3GNSA 2HTEA 2FZLA 4O08A 3P9KA 3UJ8A 1N2EA 1P2FA 2ODNA 3QTLD 3CTMA 3LUJA 3AEZA 1NLUA 4ZANA 1L5MA 1SKAA 3NVKI 4B6PA 3HN6A 4IIEA 3SC3A 3LLCA 1ABEA 1MB3A 4YLYA 2N46A 1FXSA 4JQZA 4JNCA 1VL5A 1FP4B 3FJYA 3TLBA 1Q14A 2VZEA 4U63A 4W4TA 3BX1A 3UMSA 1P9LA 1XEXB 4JBLA 2WIDA 3HJTA 5EIXA 4CR8A 5G4KB 1PJSA 1UAAA 1VI6A 1Z62A 2YIMA 3F5MA 2IYVA 1ZR4A 4LYDA 2O4UX 4G5FA 3CN7A 4XD7D 3CFYA 1JFTA 4KI0A 3FR7A 4L02A 3L7YA 4NX2A 4RE5A 4WA7A 2Z0MA 1ZJ6A 1ZN9A 4RSGA 3MPUA 1EG7A 2P6PA 4I5IA 1CUEA 2IEDA 1HTWA 4BO7A 1KF0A 3I64A 1NYLA 1LLCA 2EBHX 5C80A 2JIOA 3M5CA 4IVPA 1ONBA 4FE7A 3NBZC 2JC3A 1RTTA 4MYDA 1IUOA 3UC5A 4X6UA 1X8KA 4KK4A 5CPFA 2MT9A 3LCRA 1Z3CA 4QOFA 3HB7A 5DXAA 3ESRA 5IBRA 5JWHA 4BCBA 1OKKD 2FXIA 1PTRA 1SKYE 5JYCA 3M7IA 3OJCA 5I9MA 3RIGA 1W3SA 3ZXSA 4QSMA 1K88A 1IATA 4Z1OA 1XELA 4XSGA 4ZJZA 1FBTA 4MW1A 1EQAA 1LI4A 1KEEB 1PR5A 4R2IA 3HCAA 1RRKA 3RM3A 1Z7BA 2ZLBA 3PQ7A 1XEWX 4C5CA 3CE9A 1P7YA 1XPRA 3QUBA 3G5LA 3UWKA 2HA6A 3JZFA 1KGDA 2FMFA 1Z68A 2VDQB 4Q9IA 4JJ7A 5DHTA 4M9XA 3CB4A 1HMYA 3EGOA 1XZQA 3I8XA 1DAKA 1Z13A 5E4TA 4K6CA 1J23A 4JEHA 1WLYA 3CNOA 4HTAA 3P9ZA 3CPHA 3CY6A 5CM2Z 4RC9A 5GY7A 1T2NA 3GUVA 4E5PA 3W2HA 2W8ZA 3N0XA 2AOTB 1QIDA 1T9CA 2HREA 2R6ZA 1DKRA 1E18A 3EDQA 3MIIA 4I50A 2AOVA 2BKVA 4R0NA 4EVQA 4KXVA 2BPOA 4YBRA 2L2QA 1QKIA 4YJGB 5E7IA 5LFAA 2B1RA 3WGLA 4GUAA 4H31A 1GL9B 1NFRA 2F1HA 4QARA 4RM3A 4TXNA 4UDYX 1FXWA 5EJ6A 2OHJA 1RRFA 3BERA 3FPAA 3DTYA 1RC8A 4IIUA 3CW2A 1G5TA 2M9MA 3EQ7A 2ISCA 2BFOA 1QFSA 3L79A 1WKBA 3FBWA 4QLBA 3U4QB 1O08A 2H07A 2HT6A 4DBLE 2LIVA 3C6ZA 3DPUA 1SUBA 1WE2A 2DHDA 1NWHA 1QKKA 3I2HA 3MINA 3NS7A 1T0JB 4TT8A 4ZI5A 2OYSA 3CF2A 4AROA 1NZFA 2B4RO 1Y1KE 4XIFA 4Q37A 2Q9AA 4A8JB 4M7PA 4EKYA 4H7FA 4CF6A 4UOZA 2QT9A 5I9SA 3F3KA 4NZPA 5DGHA 4KMRA 5EE5B 1GAXA 1MG5A 4IW3B 5IX8A 3K53A 4YC7A 1QPZA 4IDPA 4H6VA 1GDDA 4JSRA 2JBWA 3QENA 5BW6B 3OTGA 5FHQA 1XTRA 1B23P 4RZQA 1GJRA 2GYUA 1BD4A 3DAYA 1O2DA 3IXLA 4C07A 4GRDA 4LJ9A 3PGVA 4PC3A 2DIPA 1D4ZA 2HAEA 2PGXA 4TSFA 5AQ1A 2AKYA 1Z17A 1NXQA 1HFWA 2J3LA 2JJ2D 3ZWPA 2H63A 4EZEA 1OT5A 3HJNA 4V2IA 1OH5A 3ZXUB 4FD3A 1K4KA 2VDUE 1P0QA 1R1DA 1YDWA 3MEKA 3HJRA 2B0CA 2DQSA 3S7TA 1ZL2A 3O83A 1V37A 2G8NA 4M0LA 5KTNA 4JL5A 4GDMA 2FWRA 4RPKA 5DM1A 4HF7A 3LWNA 3QWPA 1P9WA 2H1LA 3PGXA 4RZ3A 1D09A 3ZDDA 2C4TA 2QLMA 3PEVA 3T9FA 3ZWKA 4IIJF 1GAWA 3C6BA 1UOQA 3HSYA 4X7RA 3T4XA 3G02A 3V9PA 1UP4A 3DMYA 3LLUA 3DOHA 2AWOA 2X1LA 3CNEA 1KYYA 4M76B 3GG2A 4W7HA 4YACA 4MDEA 5GM2A 3M70A 3OLVA 4PFJA 1WVGA 2YJ4A 4BKMA 3UT5B 1LS6A 4JS0A 3SFVA 3L3BA 1NR5A 5IHXA 5AOBA 1RM5A 1WF3A 4B1FA 1BMTA 2FCAA 1X7ZA 3OCVA 3WISA 1TECE 1BEUB 3MGBA 2ZBPA 2Q7OE 3JRNA 2R48A 3K0FA 4QDTA 4GL2A 4BX0A 4LHSA 5I7HA 4YCNA 4PLWA 5TY0A 5KVVA 2QTWB 3OZFA 3ZEAA 3BXPA 2FAXA 4E11A 2QF7A 2DT5A 2YNMC 1P4JA 4PU0A 3RYTC 1V45E 3OAAA 2PH1A 1E66A 3EZYA 4BNMA 2V4UA 5JI3E 1K63A 4CLHA 2HJHA 2VR1A 1B6TA 1BDBA 2ST1A 3SM9A 4EITA 1I9GA 1FRVA 4C6TB 2A9JA 2ODWA 1CGJI 3E22A 4GSKA 3K6KA 1GZ4A 2FHPA 4WESB 2XR1A 3VI3B 4W9MC 4BNLA 4JT4A 1V3UA 1EIZA 3PPWA 4TN5A 1L4FA 1WXHA 4AJ1A 2FPMA 5EJIA 4EA9A 3NC1C 2BFAA 3IAS1 3EGXA 1SGNI 3VPFA 3PXXA 4JI6B 1FRZA 1OAOC 3ETLA 2R7AA 1M6EX 4NHOA 4ZAXA 4ZHSA 5IUKC 2Q07A 1BE1A 1KK1A 1XZCA 5AKGA 2YYAA 2ZE8A 3BE8A 3H6KA 3IE0A 5AR1A 2BDEA 1P2SA 1M8GA 1YOBA 3CEMA 3GJ8A 3M49A 4O2AA 4MQFA 3RWBA 3V9AA 2GB4A 3LUKA 4OU5A 1DAGA 4ZCQA 3WG9A 5IYZA 2JAUA 1A4XA 5D85A 5F3WB 2A67A 1GRRA 2I4RA 1UFQA 3BRSA 4PZPA 2Q0HA 3JQ9C 3KNZA 4JA2A 4XDZA 3HFSA 4AB1A 4EYSA 2V6BA 4JVNA 2IWRA 3J81A 2YZ2A 1QCZA 3THWB 1ODSA 2C4UA 2QEQA 3L6UA 1L5KA 2AUMA 1XTJA 1Z5ZA 4YV0A 3BTUA 2V4ZA 3INGA 4UTNA 3WO1A 2FPIB 2YYYA 4U2BA 5E38A 3EIHA 1Q1AA 1W4BA 2C42A 4BNHA 4BMOB 2QTTA 3K70B 4K2HA 3TOVA 1HYQA 3RAEC 2QROA 4LF7B 1IY9A 4GBMA 4Q16A 1RJFA 5CJPA 5DLPA 4PZZA 4UUNA 3OX2A 4J16C 1TZJA 4PY2A 4P5DA 4QNMA 3TIIA 4EMTA 3FCOA 3I6YA 4OGLA 3N07A 3VNAA 3A6LA 3BCHA 1FVFA 4MVJE 4GL4A 4RLQA 2R84A 5AD1A 4CJXA 3OQVA 5CIQA 5IJAA 3DL2A 1D1SA 4G09A 4PHHA 3F9CA 5FFNA 5CVTA 3LYHA 3NWEA 4RGVA 4CM8A 2AFRA 1PT7A 1OFUA 3SHFA 5JD6A 5D3MA 4WLFA 4LZLA 4M8SA 4G67A 4OHOA 4Z0HO 5CXSA 4B34A 4YQFA 3T9CA 3TXXA 3KKEA 3E82A 2RHDA 3H6HA 4BEJA 3HCWA 2O1WA 1WG8A 4QYIA 1K3TA 4ICIA 1LGYA 4YRRA 5BURA 2VF4X 4JODA 3K9FC 2PTHA 5EGSA 1IZ7A 1VTKA 3VO9A 5IAOA 2Y1XA 5D3QA 1DKQA 4F7DA 3LQ2A 3H5RA 1PZHA 3NPAA 3ZH9B 1CY6A 2E0IA 4OI4A 1C9NA 3OQIA 5DLEA 4MEAA 1P4HA 4P5EA 1S3GA 4RVNA 3B5IA 2NU8A 5KYUB 4XARA 4XQ9A 1Y80A 1ZA1A 1XGKA 3B1JA 4HZUA 4DDWA 5BN4B 3H2HA 3FNRA 3AUKA 1SELA 2J3HA 4YMSA 3LHDA 4LV5B 4BKUA 4UVIA 5JNUA 3DBRA 1IYZA 2XQGA 3I9LA 1YCHA 4RE6A 4QU0A 3O8RA 2Y4NA 1F4LA 3LOUA 5FLXA 1F4VA 3A2LA 2WIAA 3IVCA 1Q21A 4JYAB 1QQAA 4EO7A 3O73A 3ENKA 2C0QA 1Y1LA 3PIRA 3NATA 4XAQA 1P5FA 3D6UA 1DWOA 4R40A 3SIWA 1NY5A 1HEYA 1F1JA 3BL5A 2UVQA 3DFFA 4NFYA 4DIOA 3K1JA 5JSUA 4MQ6A 2IEAA 4DPMA 4F3YA 3K2EA 5BSHA 2REQB 2OORC 1OX5A 3DV0B 3QWIA 1TOAA 5E7MA 1B1AA 4I1YA 1P6UA 1R9JA 2QSJA 3FROA 3OOWA 4W1PA 5FWXB 3VU8A 2B4YA 1Y4DE 4F04A 4MR8B 1SZCA 2NX2A 1FTYA 4OXQA 5I4CA 3ETNA 2II6A 4KX5A 1JHRA 3B3JA 3LK6A 2NO7A 3VGPA 3D8UA 4US0R 3EGDA 2I4MA 2VP3A 1F9EA 3PCXA 2C3PA 1LU9A 3LBIA 5AK4A 4OQLA 5FAKA 3MCUA 4EB0A 3U7HB 5JHGB 2A59A 1KIFA 2R8EA 1BOOA 2R9VA 1D5CA 1YR1A 2RSLA 2X5JO 2YHUA 3HBNA 4C0SA 2CSUA 3ELWA 4CM6A 2ZRGA 4ZCLA 5A05A 4AT1A 1N6KA 2J09A 3JR3A 1EPUA 4P4SB 5DTQA 4BV3A 4BMZA 3MT9A 3EGEA 13PKA 1XB2A 2OD7A 5CH5A 1KYZA 4NK5A 4F1WA 3DKVA 3E59A 3RUFA 2P91A 1J97A 2BFBB 2EZTA 2QTVA 2IPAB 4I4LA 3VR3D 1AUXA 2RC5A 4JKYA 4A7PA 3HK2A 2QT1A 3PQCA 3HP4A 5ALJA 5KU7A 4RTNA 1UEJA 4YAOA 4TKLA 1I2BA 1FPQA 1B8VA 1KH1A 2PNJA 1NJ8A 4PX9A 4R2MA 1LDMA 2DP4E 3BQ9A 1QRDA 2RHCA 2WKWA 1VDDA 3F5SA 2RIJA 3NHAA 3UK0A 1QAQA 2PUBA 3R75A 3CLTC 2XIQA 3OZRA 4O1MA 4OKNA 5ETJA 4F2WA 2VQDA 1DEAA 2VSQA 3BD6A 1XHEA 4QIHA 3UT6A 3OOEA 1IBRA 4TMXA 4FGJA 1X38A 3FZEA 3IQGX 5KJ6A 1JFFB 4R8SA 1AE1A 3U4HA 1KQFA 3D6JA 1PJTA 2D1FA 1KMMA 3FSGA 2O05A 1C3JA 4DG8A 3H11B 2YICA 1NXPA 4P7JA 1PQYA 4JI0B 1HLPA 2A9PA 4H7DA 4X90A 3WZ2A 4DYDA 2YQPA 4QXAA 4M38A 1AKWA 1BXGB 2IV3A 2QNRA 1HSOA 2DWCA 2MTBA 4RHFA 4GBED 5A3SA 3AVTA 3DQQA 1SBYA 3OZXA 3QA3E 1KDOA 1P18A 4WTOA 3DTVD 1NYQA 3W9UA 4CCWA 4ROTA 1FIUA 1RIFA 3GRPA 2EX0A 2RGBA 2W6IA 3E9EA 3G5TA 1L5LA 4A8JC 3KVRA 5C81A 3H2ZA 1O77A 1T5TA 1YU9A 3QG1A 4GPZA 1DIAA 2NV6A 2ZTLA 2ZTSA 1OVGA 3B6KA 4MPJA 1XVIA 2WIBA 1SIBE 4OBEA 4P83A 5CDHA 5FEUA 2QLNA 1YQWA 3SJ7A 4U7FA 4E2YA 3I9FA 5GJCA 4BB5A 1PLKA 3W5VA 3Q7RA 4Q7QA 3VZDA 1QBGA 1T9HA 3Q0TA 2PZJA 3ZZTA 3UJ6A 5LSAA 4N8DA 5EXPA 5EJ9A 2IODA 1SY7A 4KUGA 1MMFB 2B2NA 3SIPA 4BNYA 4EHNA 5EPOA 1DEXA 1M7HA 3GBVA 4IHJB 3R7WA 5E3QA 1QB8A 1MHPA 1CUDA 1S20A 1JKXA 1M2OA 2PL9A 2AX3A 3O1IC 4MEJA 4QOHA 3MAJA 5ADUS 5JAMA 1SUSA 3A4NA 3GAAA 5K09A 3MIZA 1OAKA 2SCUA 2ZBRA 4NAUA 2PBZA 1DO2A 5EINA 5AH0A 4H1UA 3MN1A 4B3IA 2H3HA 2D1RA 1JAIA 2DKFA 4GFDA 4LYAA 3QKSA 2QTBA 1XMJA 4DLYA 5TPZD 1DDIA 3JWPA 2YIJA 3D31A 3NTLA 4XD2A 2VS1A 3RGWS 4DIUA 2JLVA 4DCMA 2W93A 4PW0A 5ITSA 2AJBA 4RXTA 1JMVA 3R0XA 5AVZA 3T9DA 4Y2GA 2LB7A 4DCPA 4M1OA 1SCBA 1ULHA 4HGRA 5DLQC 2Y99A 3CPEA 3KK0A 3ETHA 1W93A 4GM4A 5IJ9B 1V35A 1QGZA 4BJ1A 4FFNA 1T3SA 3QMWA 5GVRA 2XTAA 3WIBA 1Q1QA 4UE6A 2CEKA 1L4KA 2Z3WA 2KJQA 4EHJA 2DPGA 1G4AE 1H2FA 5LYJB 2G9ZA 3QLUA 4Q3EA 1PRYA 3QVUA 5HDBB 1R8XA 3LUAA 1K5DA 4HBZA 5J4LA 2HY7A 2OK8A 3AEKB 3F6EX 2I2WA 1OI2A 1EJ6A 5JO0A 2UZ4A 3LUGA 1N78A 3OCJA 2R7NA 3I9OA 1UFRA 3WL8A 3ZG6A 4DE5A 2HDWA 721PA 2G1JA 2YWCA 1FU8A 1CZHA 1VE7A 2OSBA 3OZDA 4S35A 3ROQA 2HXGA 5DNCA 1MX5A 2AMJA 2ZPUA 4IEEA 1Y6ZA 1WJGA 3B3GA 1MEJA 1WPQA 1IAVA 2AZMA 1ADGA 3G2NA 3B3AA 3P0HA 4HNHA 3ICOA 1SJ9A 1XC7A 3GJ3A 1AUPA 4MKZA 4AF7A 3KKLA 2FEOA 1UAGA 4KOAA 4V02A 4B4UA 1MENA 1A9YA 4KPYA 1IZ9A 1R4ZA 4JBNA 2ZKLA 3UC9A 2D6FA 4UXJA 5LNK1 2C96A 2E7ZA 2QQGA 1SXIA 3V4ZA 3FJOA 2EFJA 4BO4A 4ED9A 2C2OA 2FP3A 2IHKA 3H2BA 4P3XA 1ADFA 5EPEA 3VE5A 5IULC 2V96A 4NULA 5HIKA 3OBBA 5CNMA 1VSBA 4UFNA 3VPDA 3T3MB 1A9QA 3RT9A 4DM7A 1WXFA 3ANNA 2PUHA 4PLFA 2VHJA 1LKZA 4V0OA 2PMKA 3OJWA 4UBKA 5J2UB 1RI5A 3QF4A 2YN4A 3H8WA 3RFTA 3NWOA 1PFVA 4YCCA 3PIDA 2NZVG 3VJMA 1X7YB 1E3WB 2BR5A 3K70C 1M8PA 2HHHB 4WLUA 5G02A 4UNRA 3FCEA 4CZ2A 4BO0A 3FF4A 4I1VA 4MGYR 4M8KA 1OX4A 1H65A 1MVLA 3GFQA 3G1UA 3HACA 1ESEA 4RKQA 4YAJA 1P91A 3S28A 2ZR0A 1RXWA 1YUBA 2ANCA 2Z58A 3CRW1 3FTFA 1UDAA 4DRXA 2BF4A 4BX3A 1IG3A 1K0UA 1K6MA 4KVFA 1VSUA 2GBPA 1VB3A 2IZ5A 1OC2A 1LSJA 2OQRA 3CKLA 2XMSA 1SGQI 3P0IA 3QH4A 2PUEA 3EQ8A 2BW0A 2DBVO 4M86A 1HDXA 1YFKA 2F4NA 4FYPA 4YRJA 3TTTA 3ZIDA 5DP1A 2WM8A 1XYGA 5E2IA 2JLUA 1MOPA 2PR2A 1R4MB 4BQIA 1SQ6A 3DLHA 2XYRA 2MU1A 3OTQA 5HXAA 3RKUA 1ZOLA 4N5DA 1UPCA 5EAIA 2XUJA 3C8MA 2O0LA 1KY3A 3I61A 1SURA 2Y9PB 4AJOA 4U6QA 4UBMA 3PK0A 1CT0I 5KBYA 1ZR2A 3ZZUA 2DFLA 4IGAA 3A3OA 1JJVA 2AEEA 4KNVA 3RPEA 1M2GA 2HCBA 2NXCA 4G63A 1NJ1A 1ZCFA 5DN6D 2CFRA 1UBSB 3CMCO 5LQMA 3W5DA 5IW8A 4C1NA 1FNDA 2AGVA 1JDTA 2V9PA 3KELA 4ZPJA 2W6NA 1OOEA 2ORED 4BO5A 4QGSA 1E9BA 4OK5A 4RJJA 3LQKA 2J6HA 4BPBA 2ZEJA 3B48A 4YHBA 4QOIA 1XWIA 1E6WA 1EJBA 1YGYA 2I1WA 2JFNA 3ICVA 4ZT2A 1NX9A 3QE3A 3WKCA 1EFHA 2BSXA 2XUOA 2ZT5A 1DIBA 3ANLA 3K0AB 4PHCA 4L07A 4UDOA 5FBRB 1L7DA 2Z4SA 4HJRA 4HNAA 4LE1A 4MA5A 1YCDA 3BZWA 3KZMA 5TQVA 1SVOA 4EB3A 5L4LA 1Z7GA 3FYUB 5CEJA 5JNSA 1F7UA 4FTWA 1RMQA 1E0AA 3BN3A 4FMDB 3I9JA 4CMAA 3PGMA 1S2NA 2HZBA 3AY7A 1EX9A 3BH0A 2VKQA 5EC8A 3SYMA 1CCWA 3WB1A 1G8SA 3ZCXA 4C0LA 4C6SA 4CTNA 3GFFA 3ZJTA 2K2WA 2ZXFA 1Y3HA 1J8QA 1NA5A 1S89A 4NCJA 1OI7A 3OVOA 4ZEOA 1SXJE 4PZAA 2Z2JA 2YBDA 5F1YA 4Q93A 4UJ5A 1Z56C 1FFHA 5BWOA 3T7CA 2I55A 4TL9A 4PYNA 4FHDA 2ORVA 4MDHA 2ZJAA 2P2GA 2CFCA 3A1UA 4G5OA 3AZQA 4N6GA 3TLYA 1FYVA 4JUCA 4BY9E 4N76A 3JVEA 3DYIA 3L6RA 1TPYA 4OBWA 3WP1B 2DC1A 3AY0A 3U13A 1WXWA 3DVSX 4XM1A 1L7MA 1PS9A 2B6NA 1NVGA 1R8YA 4BYMA 2B8JA 2J5XA 1XLWA 2VA8A 4Z3KA 1DC7A 1KORA 3FPBA 4JC5A 3WMWA 1EFUA 3PD0A 1KBZA 1XCLA 1T3TA 2NUTA 3WMRA 5C7OO 1WPRA 3R7FA 1GN8A 2XA2A 2FN3A 4F8JA 4MKHA 1M5TA 2B94A 4JUAA 3Q5DA 1NQAO 1VE3A 4Z9AA 2BR4A 4E51A 6GPBA 2R8ZA 2JI6A 1MQ9A 5FHRA 4BEWA 4J8PA 3RRMA 1XKXA 2WV7A 4MICA 3KQWA 4FDAA 4OL0A 4WK4B 3WTBA 3E9ZA 1C3OA 1UQTA 1DCMA 2CLCX 4FC7A 4D26A 3OF5A 1NAHA 5DW3A 2BEWA 1EVIA 1NMYA 1FJHA 2N1BA 2QTAA 4CR6A 3SNKA 3RARA 3HBMA 1G291 5AKZA 3N7AA 3AR6A 1IWPB 3HADA 4FQ8A 2OV1A 1XVTA 4RK5A 3TD6A 1AM4D 4G07A 2GAJA 3JYOA 4KIFA 2Q28A 1W85A 5IH7A 5MN4A 3JD0A 5LLSA 1U2RA 3DEFA 5AJYA 4AKIA 1QIFA 4N7BA 4MUEA 5DGCA 3WLLA 2P4EA 1E4OA 1TYEB 1VBKA 2QW1A 3CUUA 4J6FA 1ZU5A 4GD3Q 3PXAA 2J4FA 1ZNYA 1IL0A 3FTNA 4YP1A 3NBUA 4URWR 4MJ3A 4O3MA 7MHTA 4XUGB 5P21A 3V5NA 1ODCA 2W48A 3K0HA 3QPCA 4V0LA 2P2NA 4G8JA 3GBSA 2QRUA 4X1IB 3ZCQA 4HQFA 5LJLA 3O0DA 3K7EA 2CVZA 3VR6A 4K9NA 3GJZA 3UNXA 2BL4A 1CR6A 1L5NA 5JEDA 3DTNA 4PPNA 2QQEA 3WGIA 1OW3B 1C8VB 2C8KA 2G4VA 3LXMA 4JR0A 1G20E 3WVNA 3CT4A 2BI8A 2WW8A 1Z16A 4G6ZA 3OT1B 4HEQA 1Y6QA 2ADMA 3DNPA 4HGQA 1NVMB 1YJAA 2ZFUA 4HLDA 1EGAA 1ST2A 3VR4H 1KKLA 4QATA 1X92A 8AT1A 4HQNA 4OQDA 4CEIA 1T10A 4TTIA 3TZCA 1AZLA 1H4QA 1SGYI 3F3SA 2FSHA 2VHUA 2L82A 1AGRA 5AHKA 3FZNA 3UFXB 3C1UA 1OA0A 2VSFA 2VWQA 3UJHA 1N3LA 2F90A 2G0TA 3MGAA 2Q5FA 4RABA 2CUTA 3GFOA 5CXUA 1T2EA 5IZCA 3PQ5A 2Q4RA 4UEQA 4TQAA 2PBLA 3SC2B 4ZV4A 5LMUB 4EJ6A 2HW8A 4W6QA 1XBTA 5AP9A 2PV7A 4O2BF 4XIGS 2PQ0A 3QXHA 2HM7A 4I55B 1UPTA 4RD0A 5FOVA 5BN5A 2OOKA 3MGCA 1C7ZA 3HRIA 5EE3A 3TQQA 4KQWA 2ECPA 4L8VA 4BO3A 3Q1KA 4V0ME 1KOLA 4R6WA 1R8JA 3AVXA 2J85A 4PLGA 5F12A 4O02B 4AJ2A 1US8A 1VCMA 2ZB3A 4QTTB 4D9BA 1TGSI 1D1TA 2VAWA 3GLHB 3GRUA 4O8ZA 3VR5H 4MWGA 1JEQB 5CFQA 3LPCA 4GZ6A 1ESNA 2C2XA 1MH9A 1JSRA 1KJQA 2W9XA 2NNLD 3NH9A 1W0KA 1JHXA 1XTUA 5A9TA 2ZVPX 2GEVA 5J4YA 3SK0A 1GZVA 4ZRMA 1ZHFA 1RR6A 2D0DA 1RYHA 2J5QA 1IONA 2FEKA 3IIKA 1YB2A 3K5IA 4IDOA 4QE3A 3IP5A 4I4IA 1ZEJA 3B2NA 1GXSB 1Q9BA 4R71A 3SIXA 1SOAA 3KSDO 4Q7MB 5TLSA 4UUOA 1SRQA 4JU8A 4LJ7A 1NUQA 1Z37A 5ALSA 4ZOBA 4ZAVA 1PVVA 2LNDA 5HCUA 3QJYA 3DDOA 3FUVA 4FZRA 3O95A 1A50B 1OYYA 4EI8A 2B8EA 3DL7A 1A7UA 4GWLA 2XWJI 2X3YA 4DZTA 2FMXA 3EQ9A 1PKEA 1S6YA 3WAJA 1YR6A 4TMFA 4F2GA 1T2UA 4PCVA 4QO7A 4XA8A 4DSTA 1RQRA 3IAM1 3Q2KA 5EIFA 1UL1X 2A1TR 4JGGA 3D6FA 1FNNA 3BF7A 3HO8A 3R4CA 4QELA 2DB6A 3GCXA 4UTXA 1QS0B 2KCXA 2WM3A 2P9QA 1Q77A 4UCXA 2VJLA 2QGFA 1PBNA 1GQ2A 1YRHA 3TEFA