1IY5A

Solution structure of wild type omsvp3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
54
structure length
54
Chain Sequence
AVSVDCSEYPKPACTMEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OMSVP3
publication title Inhibitory Specificity Change of Ovomucoid Third Domain of the Silver Pheasant upon Introduction of an Engineered Cys14-Cys39 Bond
pubmed doi rcsb
source organism Lophura nycthemera
molecule tags Hydrolase
total genus 7
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2002-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1iy5A00
1M8BA 1Y1BA 2QQDA 3OVOA 1PPFI 1TBRR 2NU2I 1OMTA 2GKRI 1NUBA 1KMAA 4SGBI 2QQCA 2OVOA 1PJUA 1YTPA 1SGRI 1SGPI 4GI3C 1FYBA 2N17A 1MT1A 2N52A 2M5XA 2KMPA 1SGEI 1UUCA 1TUSA 1CHOI 1OVOA 1Y1CA 1IY5A 2JXDA 1HPTA 2NU1I 3QTLD 2B0UC 3HH2C 1CSOI 2BUSA 1SGNI 2SGPI 2XRCA 1SGYI 1M8CA 1IY6A 2GKTI 2NU4I 2GKVA 1BUSA 2WCYA 1CGII 4OVOA 1HJAI 3TJQA 1OMUA 5JHWC 2SGDI 1CT2I 2KMRA 3SGBI 1YU6C 1LR8A 2SGQI 1PCEA 2V53A 3SEKC 4HGUA 1CGJI 1TBQR 1TURA 1Z7KB 1HDLA 1IW4A 1AN1I 1OYVI 2P6AC 2ERWA 1SGDI 1UVGA 1SGQI 1TIHA 1TGSI 1H0ZA 2JYYA 1UVFA 2KCXA 2N71A 1CT0I 2LEOA 1LR9A 1CT4I 2F3CI 3B4VC 2KMOA 1BMOA 2JZMA 1CE3A 2NU0I 1LR7A 3SGQI 1DS2I 2KMQA 5DAEA 1DS3I 1N13A 2SGFI 1R0RI 2ARPF 2NU3I 2SGEI
chains in the Genus database with same CATH superfamily
1M8BA 2VRWB 1Y1BA 2QQDA 3OVOA 1PPFI 1TBRR 2NU2I 3UFFA 1OMTA 2GKRI 1NUBA 1WTJA 2CWHA 2Y0MA 3FSYA 2PQ8A 2L7XA 1P9ZA 1R79A 1TBNA 2V1CC 5FUVA 3UGDA 1KMAA 1PTQA 4SGBI 2QQCA 2OVOA 4E1PA 1PJUA 3FC3A 3GOXA 1YTPA 2RC4A 1MJAA 1SGRI 3UEJA 1SGPI 1XA6A 1WGCA 1W3SA 2A20A 4GI3C 1FYBA 2N17A 3R5BA 1VDDA 2ENZA 2J9RA 3E59A 1WGTA 3TOBA 1V1HA 2GVIA 5J8FA 1MT1A 2QQ0A 7WGAA 2N52A 2M5XA 2KMPA 3D00A 2YUUA 1SGEI 2WVJA 1UUCA 9WGAA 1TUSA 5CCLA 1CHOI 1ULNA 5HQ8A 1OVOA 1Y1CA 3OL0A 1KBEA 3KY9A 2JXDA 4UXIA 1IY5A 2CJSC 2B8TA 3CXLA 3TO6A 2L8EA 1Z2IA 2DIPA 1HPTA 1P9GA 2DB6A 2NU1I 3QTLD 2B0UC 3HH2C 1CSOI 2UVOA 2BUSA 1FARA 3E2IA 3TO7A 1SGNI 2SGPI 1W4RA 1S20A 2ENNA 2OU2A 2XRCA 1ULMA 1SGYI 2FNFX 1M8CA 4A24A 3MEKA 1XX6A 1X74A 2ELIA 2J87A 1UHAA 1IY6A 2GKTI 2NU4I 2QPOA 3TOAA 2CWFA 2LB7A 2UZ3A 3VDPA 2GKVA 5DAEA 1BUSA 2W0TA 5FUXA 2WCYA 3UOEA 2E73A 1FY7A 3PDNA 4UXJA 1CGII 4OVOA 2X3TA 1HJAI 3TJQA 5EX0A 1U5KA 1OMUA 5JHWC 1Y8FA 2SGDI 1CT2I 4FKDA 2KMRA 3SGBI 2WGCA 3FSXA 1X4SA 1YU6C 3R5DA 1LR8A 2SGQI 1PCEA 2V53A 5FUWA 1HEVA 1ULKA 4WP4A 3SEKC 4HGUA 4DNCA 5HI7A 5FUYA 1CGJI 1TBQR 3OXGA 2YQPA 3TO9A 1TURA 3UEYA 1Z7KB 2CWGA 3VDUA 3RU0A 5E3QA 3R5CA 4AMLA 1HDLA 2ODDA 1IW4A 1AN1I 2DKVA 2V1CA 2OZUA 4MPIA 2ROWA 4UXHA 1OYVI 1MJ9A 1FAQA 2P6AC 2ERWA 1TBOA 1SGDI 3UGLA 1UVGA 1SGQI 1TIHA 1TGSI 1WKXA 2LUYA 1H0ZA 2JYYA 1UVFA 2KCXA 2N71A 1TOTA 3R5AA 5EX3A 3VE5A 1NXUA 2JA1A 4JCVE 2OD1A 3QAHA 4B6DA 1CT0I 2LEOA 5E3PA 1LR9A 1XBTA 1CT4I 5J8CA 3UGIA 2F3CI 1MJBA 2QQEA 3B4VC 2KMOA 3OXLA 4L9MA 1K7VA 1BMOA 1K7UA 3BJIA 1RFHA 5CCMA 2JZMA 1CE3A 2NU0I 1V1IA 2GIVA 1LR7A 3OXFA 1KBFA 2RIJA 3SGQI 1DS2I 2N1AB 2KMQA 2K9HA 1DS3I 1N13A 2ORWA 2ORVA 2SGFI 2E5RA 1PTRA 2X52A 5E3RA 1R0RI 4E1RA 2JW6A 2ARPF 2NU3I 1K7TA 1Q9BA 2SGEI 3QWPA
chains in the Genus database with same CATH topology
1M8BA 2VRWB 1Y1BA 2QQDA 3OVOA 1PPFI 1TBRR 2NU2I 3UFFA 1OMTA 2GKRI 1NUBA 2L7XA 1R79A 1TBNA 2V1CC 5FUVA 3UGDA 1KMAA 1PTQA 4SGBI 2QQCA 2OVOA 4E1PA 1PJUA 3FC3A 3GOXA 1YTPA 1SGRI 3UEJA 1SGPI 1XA6A 2A20A 1W3SA 4GI3C 1FYBA 2N17A 1VDDA 2ENZA 2J9RA 3E59A 1V1HA 2GVIA 1MT1A 2QQ0A 2N52A 2M5XA 2KMPA 3D00A 2YUUA 1SGEI 2WVJA 1UUCA 1TUSA 5CCLA 1CHOI 5HQ8A 1OVOA 1Y1CA 3OL0A 1KBEA 3KY9A 2JXDA 4UXIA 1IY5A 2CJSC 2B8TA 3CXLA 2L8EA 2DIPA 1HPTA 2DB6A 2NU1I 3QTLD 2B0UC 3HH2C 1CSOI 2BUSA 1FARA 3E2IA 1SGNI 2SGPI 1W4RA 2ENNA 2XRCA 1SGYI 2FNFX 1M8CA 4A24A 3MEKA 1XX6A 1X74A 2ELIA 2J87A 1IY6A 2GKTI 2NU4I 2QPOA 2UZ3A 3VDPA 2GKVA 1BUSA 2W0TA 5FUXA 2WCYA 2E73A 3PDNA 4UXJA 1CGII 4OVOA 1HJAI 3TJQA 5EX0A 1U5KA 1OMUA 5JHWC 1Y8FA 2SGDI 1CT2I 4FKDA 2KMRA 3SGBI 1X4SA 1YU6C 1LR8A 2SGQI 1PCEA 2V53A 5FUWA 3SEKC 4HGUA 5HI7A 5FUYA 1CGJI 1TBQR 3OXGA 2YQPA 3UEYA 1TURA 1Z7KB 3VDUA 3RU0A 1HDLA 2ODDA 1IW4A 1AN1I 2V1CA 2ROWA 4UXHA 1OYVI 1FAQA 2P6AC 2ERWA 1TBOA 1SGDI 3UGLA 1UVGA 1SGQI 1TIHA 1TGSI 2LUYA 1H0ZA 2JYYA 1UVFA 2KCXA 2N71A 1TOTA 5EX3A 3VE5A 2JA1A 4JCVE 2OD1A 4B6DA 1CT0I 2LEOA 1LR9A 1XBTA 1CT4I 3UGIA 2F3CI 2QQEA 3B4VC 2KMOA 3OXLA 4L9MA 1BMOA 3BJIA 1RFHA 5CCMA 2JZMA 1CE3A 2NU0I 1V1IA 1LR7A 3OXFA 1KBFA 3SGQI 1DS2I 2N1AB 2KMQA 2K9HA 1DS3I 1N13A 2ORWA 2ORVA 2SGFI 2E5RA 1PTRA 5DAEA 4E1RA 1R0RI 2JW6A 2ARPF 2NU3I 2SGEI 3QWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8B A;  1Y1B A;  2QQD A;  3OVO A;  1PPF I;  1TBR R;  2NU2 I;  1OMT A;  2GKR I;  1NUB A;  1KMA A;  4SGB I;  2QQC A;  2OVO A;  1PJU A;  1YTP A;  1SGR I;  1SGP I;  4GI3 C;  1FYB A;  2N17 A;  1MT1 A;  2N52 A;  2M5X A;  2KMP A;  1SGE I;  1UUC A;  1TUS A;  1CHO I;  1OVO A;  1Y1C A;  1IY5 A;  2JXD A;  1HPT A;  2NU1 I;  3QTL D;  2B0U C;  3HH2 C;  1CSO I;  2BUS A;  1SGN I;  2SGP I;  2XRC A;  1SGY I;  1M8C A;  1IY6 A;  2GKT I;  2NU4 I;  2GKV A;  1BUS A;  2WCY A;  1CGI I;  4OVO A;  1HJA I;  3TJQ A;  1OMU A;  5JHW C;  2SGD I;  1CT2 I;  2KMR A;  3SGB I;  1YU6 C;  1LR8 A;  2SGQ I;  1PCE A;  2V53 A;  3SEK C;  4HGU A;  1CGJ I;  1TBQ R;  1TUR A;  1Z7K B;  1HDL A;  1IW4 A;  1AN1 I;  1OYV I;  2P6A C;  2ERW A;  1SGD I;  1UVG A;  1SGQ I;  1TIH A;  1TGS I;  1H0Z A;  2JYY A;  1UVF A;  2KCX A;  2N71 A;  1CT0 I;  2LEO A;  1LR9 A;  1CT4 I;  2F3C I;  3B4V C;  2KMO A;  1BMO A;  2JZM A;  1CE3 A;  2NU0 I;  1LR7 A;  3SGQ I;  1DS2 I;  2KMQ A;  5DAE A;  1DS3 I;  1N13 A;  2SGF I;  1R0R I;  2ARP F;  2NU3 I;  2SGE I; 
#chains in the Genus database with same CATH topology
 1M8B A;  2VRW B;  1Y1B A;  2QQD A;  3OVO A;  1PPF I;  1TBR R;  2NU2 I;  3UFF A;  1OMT A;  2GKR I;  1NUB A;  1WTJ A;  2CWH A;  2Y0M A;  3FSY A;  2PQ8 A;  2L7X A;  1P9Z A;  1R79 A;  1TBN A;  2V1C C;  5FUV A;  3UGD A;  1KMA A;  1PTQ A;  4SGB I;  2QQC A;  2OVO A;  4E1P A;  1PJU A;  3FC3 A;  3GOX A;  1YTP A;  2RC4 A;  1MJA A;  1SGR I;  3UEJ A;  1SGP I;  1XA6 A;  1WGC A;  1W3S A;  2A20 A;  4GI3 C;  1FYB A;  2N17 A;  3R5B A;  1VDD A;  2ENZ A;  2J9R A;  3E59 A;  1WGT A;  3TOB A;  1V1H A;  2GVI A;  5J8F A;  1MT1 A;  2QQ0 A;  7WGA A;  2N52 A;  2M5X A;  2KMP A;  3D00 A;  2YUU A;  1SGE I;  2WVJ A;  1UUC A;  9WGA A;  1TUS A;  5CCL A;  1CHO I;  1ULN A;  5HQ8 A;  1OVO A;  1Y1C A;  3OL0 A;  1KBE A;  3KY9 A;  2JXD A;  4UXI A;  1IY5 A;  2CJS C;  2B8T A;  3CXL A;  3TO6 A;  2L8E A;  1Z2I A;  2DIP A;  1HPT A;  1P9G A;  2DB6 A;  2NU1 I;  3QTL D;  2B0U C;  3HH2 C;  1CSO I;  2UVO A;  2BUS A;  1FAR A;  3E2I A;  3TO7 A;  1SGN I;  2SGP I;  1W4R A;  1S20 A;  2ENN A;  2OU2 A;  2XRC A;  1ULM A;  1SGY I;  2FNF X;  1M8C A;  4A24 A;  3MEK A;  1XX6 A;  1X74 A;  2ELI A;  2J87 A;  1UHA A;  1IY6 A;  2GKT I;  2NU4 I;  2QPO A;  3TOA A;  2CWF A;  2LB7 A;  2UZ3 A;  3VDP A;  2GKV A;  5DAE A;  1BUS A;  2W0T A;  5FUX A;  2WCY A;  3UOE A;  2E73 A;  1FY7 A;  3PDN A;  4UXJ A;  1CGI I;  4OVO A;  2X3T A;  1HJA I;  3TJQ A;  5EX0 A;  1U5K A;  1OMU A;  5JHW C;  1Y8F A;  2SGD I;  1CT2 I;  4FKD A;  2KMR A;  3SGB I;  2WGC A;  3FSX A;  1X4S A;  1YU6 C;  3R5D A;  1LR8 A;  2SGQ I;  1PCE A;  2V53 A;  5FUW A;  1HEV A;  1ULK A;  4WP4 A;  3SEK C;  4HGU A;  4DNC A;  5HI7 A;  5FUY A;  1CGJ I;  1TBQ R;  3OXG A;  2YQP A;  3TO9 A;  1TUR A;  3UEY A;  1Z7K B;  2CWG A;  3VDU A;  3RU0 A;  5E3Q A;  3R5C A;  4AML A;  1HDL A;  2ODD A;  1IW4 A;  1AN1 I;  2DKV A;  2V1C A;  2OZU A;  4MPI A;  2ROW A;  4UXH A;  1OYV I;  1MJ9 A;  1FAQ A;  2P6A C;  2ERW A;  1TBO A;  1SGD I;  3UGL A;  1UVG A;  1SGQ I;  1TIH A;  1TGS I;  1WKX A;  2LUY A;  1H0Z A;  2JYY A;  1UVF A;  2KCX A;  2N71 A;  1TOT A;  3R5A A;  5EX3 A;  3VE5 A;  1NXU A;  2JA1 A;  4JCV E;  2OD1 A;  3QAH A;  4B6D A;  1CT0 I;  2LEO A;  5E3P A;  1LR9 A;  1XBT A;  1CT4 I;  5J8C A;  3UGI A;  2F3C I;  1MJB A;  2QQE A;  3B4V C;  2KMO A;  3OXL A;  4L9M A;  1K7V A;  1BMO A;  1K7U A;  3BJI A;  1RFH A;  5CCM A;  2JZM A;  1CE3 A;  2NU0 I;  1V1I A;  2GIV A;  1LR7 A;  3OXF A;  1KBF A;  2RIJ A;  3SGQ I;  1DS2 I;  2N1A B;  2KMQ A;  2K9H A;  1DS3 I;  1N13 A;  2ORW A;  2ORV A;  2SGF I;  2E5R A;  1PTR A;  2X52 A;  5E3R A;  1R0R I;  4E1R A;  2JW6 A;  2ARP F;  2NU3 I;  1K7T A;  1Q9B A;  2SGE I;  3QWP A; 
#chains in the Genus database with same CATH homology
 1M8B A;  2VRW B;  1Y1B A;  2QQD A;  3OVO A;  1PPF I;  1TBR R;  2NU2 I;  3UFF A;  1OMT A;  2GKR I;  1NUB A;  2L7X A;  1R79 A;  1TBN A;  2V1C C;  5FUV A;  3UGD A;  1KMA A;  1PTQ A;  4SGB I;  2QQC A;  2OVO A;  4E1P A;  1PJU A;  3FC3 A;  3GOX A;  1YTP A;  1SGR I;  3UEJ A;  1SGP I;  1XA6 A;  2A20 A;  1W3S A;  4GI3 C;  1FYB A;  2N17 A;  1VDD A;  2ENZ A;  2J9R A;  3E59 A;  1V1H A;  2GVI A;  1MT1 A;  2QQ0 A;  2N52 A;  2M5X A;  2KMP A;  3D00 A;  2YUU A;  1SGE I;  2WVJ A;  1UUC A;  1TUS A;  5CCL A;  1CHO I;  5HQ8 A;  1OVO A;  1Y1C A;  3OL0 A;  1KBE A;  3KY9 A;  2JXD A;  4UXI A;  1IY5 A;  2CJS C;  2B8T A;  3CXL A;  2L8E A;  2DIP A;  1HPT A;  2DB6 A;  2NU1 I;  3QTL D;  2B0U C;  3HH2 C;  1CSO I;  2BUS A;  1FAR A;  3E2I A;  1SGN I;  2SGP I;  1W4R A;  2ENN A;  2XRC A;  1SGY I;  2FNF X;  1M8C A;  4A24 A;  3MEK A;  1XX6 A;  1X74 A;  2ELI A;  2J87 A;  1IY6 A;  2GKT I;  2NU4 I;  2QPO A;  2UZ3 A;  3VDP A;  2GKV A;  1BUS A;  2W0T A;  5FUX A;  2WCY A;  2E73 A;  3PDN A;  4UXJ A;  1CGI I;  4OVO A;  1HJA I;  3TJQ A;  5EX0 A;  1U5K A;  1OMU A;  5JHW C;  1Y8F A;  2SGD I;  1CT2 I;  4FKD A;  2KMR A;  3SGB I;  1X4S A;  1YU6 C;  1LR8 A;  2SGQ I;  1PCE A;  2V53 A;  5FUW A;  3SEK C;  4HGU A;  5HI7 A;  5FUY A;  1CGJ I;  1TBQ R;  3OXG A;  2YQP A;  3UEY A;  1TUR A;  1Z7K B;  3VDU A;  3RU0 A;  1HDL A;  2ODD A;  1IW4 A;  1AN1 I;  2V1C A;  2ROW A;  4UXH A;  1OYV I;  1FAQ A;  2P6A C;  2ERW A;  1TBO A;  1SGD I;  3UGL A;  1UVG A;  1SGQ I;  1TIH A;  1TGS I;  2LUY A;  1H0Z A;  2JYY A;  1UVF A;  2KCX A;  2N71 A;  1TOT A;  5EX3 A;  3VE5 A;  2JA1 A;  4JCV E;  2OD1 A;  4B6D A;  1CT0 I;  2LEO A;  1LR9 A;  1XBT A;  1CT4 I;  3UGI A;  2F3C I;  2QQE A;  3B4V C;  2KMO A;  3OXL A;  4L9M A;  1BMO A;  3BJI A;  1RFH A;  5CCM A;  2JZM A;  1CE3 A;  2NU0 I;  1V1I A;  1LR7 A;  3OXF A;  1KBF A;  3SGQ I;  1DS2 I;  2N1A B;  2KMQ A;  2K9H A;  1DS3 I;  1N13 A;  2ORW A;  2ORV A;  2SGF I;  2E5R A;  1PTR A;  5DAE A;  4E1R A;  1R0R I;  2JW6 A;  2ARP F;  2NU3 I;  2SGE I;  3QWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...