1IY5A

Solution structure of wild type omsvp3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
54
structure length
54
Chain Sequence
AVSVDCSEYPKPACTMEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords OMSVP3
publication title Inhibitory Specificity Change of Ovomucoid Third Domain of the Silver Pheasant upon Introduction of an Engineered Cys14-Cys39 Bond
pubmed doi rcsb
source organism Lophura nycthemera
total genus 7
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2002-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1iy5A00
1DS3I 2KMQA 2NU3I 2XRCA 1OMUA 1CE3A 1SGQI 2GKTI 1DS2I 3TJQA 1R0RI 1BUSA 1UUCA 1TBQR 2KCXA 1OMTA 2P6AC 2NU0I 1CT4I 4HGUA 2N17A 1TIHA 2OVOA 1KMAA 1CSOI 1SGPI 1BMOA 2F3CI 1CGJI 2SGPI 1TURA 2NU2I 1Y1BA 2BUSA 2KMOA 4OVOA 4GI3C 2LEOA 2GKRI 5DAEA 5JHWC 2B0UC 2GKVA 1CT2I 2QQDA 1Y1CA 1TGSI 3HH2C 2JYYA 1N13A 1SGNI 2WCYA 1LR9A 1AN1I 2NU1I 1TBRR 4SGBI 1CHOI 1LR7A 2SGEI 1UVGA 1Z7KB 1IY5A 1CT0I 3B4VC 3SEKC 1M8BA 2JXDA 1LR8A 1HPTA 1HJAI 2ARPF 1SGYI 2N71A 2JZMA 1TUSA 2SGFI 3SGBI 1YU6C 2V53A 2QQCA 1OYVI 1YTPA 1CGII 1OVOA 1PJUA 1H0ZA 1SGEI 1UVFA 2SGDI 1FYBA 1IW4A 1IY6A 2SGQI 1MT1A 2ERWA 2NU4I 3OVOA 2KMPA 1HDLA 3QTLD 1NUBA 2N52A 1SGRI 3SGQI 2KMRA 1PPFI 2M5XA 1SGDI 1PCEA 1M8CA
chains in the Genus database with same CATH superfamily
1DS3I 3UGDA 2KMQA 2NU3I 2XRCA 1S20A 1OMUA 5E3QA 2ENZA 5EX0A 5FUVA 3FC3A 2OU2A 2QQ0A 1CE3A 4DNCA 3UGIA 1SGQI 2GKTI 4B6DA 2ORVA 1DS2I 9WGAA 3QWPA 2ENNA 3TJQA 1NXUA 1R0RI 1UUCA 3TO6A 1BUSA 2WGCA 1ULMA 2UZ3A 1TBQR 2KCXA 1OMTA 4AMLA 2P6AC 2L7XA 1KBEA 3R5BA 5E3RA 3TOAA 1HEVA 2NU0I 2ROWA 1CT4I 2ELIA 3TOBA 1UHAA 4HGUA 2YQPA 1Y8FA 2N17A 1TIHA 4E1RA 1MJBA 2J87A 2CWHA 2OD1A 2OVOA 3TO7A 1KMAA 4WP4A 5J8CA 1K7VA 1CSOI 1SGPI 2RC4A 1WTJA 5HQ8A 1MJAA 1BMOA 2DB6A 2F3CI 5FUWA 1CGJI 3KY9A 2SGPI 2WVJA 1TURA 2L8EA 2NU2I 3OL0A 5CCLA 1Y1BA 2BUSA 2KMOA 4OVOA 2J9RA 4GI3C 2LEOA 2GKRI 3R5AA 4JCVE 5DAEA 5JHWC 1W3SA 2B0UC 2GKVA 5E3PA 1CT2I 2DIPA 4UXJA 3UFFA 2A20A 1TOTA 2QQDA 1Z2IA 1P9ZA 2E73A 2JA1A 1XA6A 5FUYA 4E1PA 7WGAA 2GIVA 1Y1CA 3OXFA 2VRWB 1TGSI 3HH2C 2JYYA 1N13A 1SGNI 2RIJA 4A24A 2WCYA 1LR9A 4MPIA 1AN1I 1FARA 1W4RA 5J8FA 2NU1I 1TBRR 2OZUA 2QPOA 1CHOI 3D00A 4SGBI 2YUUA 2FNFX 1FY7A 1PTRA 3VDPA 1LR7A 2SGEI 1UVGA 1Z7KB 1IY5A 1CT0I 1V1HA 2W0TA 3UEYA 1RFHA 3B4VC 3SEKC 3RU0A 1M8BA 2CJSC 2JXDA 2N1AB 1LR8A 4UXIA 1HPTA 5HI7A 1MJ9A 3UGLA 1HJAI 3R5CA 2ARPF 2B8TA 1U5KA 2V1CC 3UEJA 1FAQA 1SGYI 2N71A 3R5DA 2JZMA 1Q9BA 2V1CA 3UOEA 2Y0MA 1K7UA 1TUSA 2PQ8A 2SGFI 3MEKA 1TBNA 2GVIA 1ULNA 3BJIA 3SGBI 1YU6C 2ORWA 2X3TA 1X74A 2V53A 5CCMA 1VDDA 3VDUA 1X4SA 2E5RA 2QQCA 2CWFA 1V1IA 1XX6A 1OYVI 1YTPA 1CGII 1OVOA 1PJUA 1K7TA 3CXLA 1H0ZA 1TBOA 1SGEI 1XBTA 2DKVA 3QAHA 3FSXA 1UVFA 1KBFA 3E59A 2LB7A 1P9GA 4FKDA 2SGDI 4L9MA 4UXHA 1FYBA 1IW4A 1IY6A 2SGQI 1MT1A 2ERWA 2NU4I 3FSYA 3OXGA 1ULKA 3VE5A 2X52A 3OVOA 5FUXA 2KMPA 5EX3A 1WGCA 1HDLA 2K9HA 3QTLD 1NUBA 1PTQA 2JW6A 2N52A 1WKXA 1SGRI 1WGTA 3SGQI 2KMRA 1PPFI 2ODDA 2M5XA 2CWGA 3GOXA 3OXLA 1SGDI 3PDNA 2QQEA 3TO9A 1R79A 3E2IA 1PCEA 2LUYA 2UVOA 1M8CA
chains in the Genus database with same CATH topology
1DS3I 3UGDA 2KMQA 2NU3I 2XRCA 5FUVA 1OMUA 5EX0A 2ENZA 3FC3A 2QQ0A 1CE3A 3UGIA 1SGQI 2GKTI 4B6DA 2ORVA 1DS2I 3QWPA 2ENNA 3TJQA 1R0RI 1BUSA 1UUCA 2UZ3A 1TBQR 2KCXA 1OMTA 2P6AC 2L7XA 1KBEA 2NU0I 2ROWA 1CT4I 2ELIA 4HGUA 2YQPA 1Y8FA 2N17A 1TIHA 4E1RA 2J87A 2OD1A 2OVOA 1KMAA 5HQ8A 1CSOI 1SGPI 1BMOA 2DB6A 2F3CI 5FUWA 1CGJI 3KY9A 2SGPI 2WVJA 1TURA 2L8EA 2NU2I 3OL0A 5CCLA 1Y1BA 2BUSA 2KMOA 4OVOA 2J9RA 4GI3C 2LEOA 2GKRI 4JCVE 5DAEA 5JHWC 1W3SA 2B0UC 2GKVA 1CT2I 2DIPA 4UXJA 3UFFA 2A20A 1TOTA 2QQDA 2JA1A 2E73A 5FUYA 1XA6A 4E1PA 1Y1CA 3OXFA 2VRWB 1TGSI 3HH2C 2JYYA 1N13A 1SGNI 4A24A 2WCYA 1LR9A 1AN1I 1FARA 1W4RA 2NU1I 1TBRR 2QPOA 1CHOI 3D00A 4SGBI 2YUUA 2FNFX 1PTRA 3VDPA 1LR7A 2SGEI 1UVGA 1Z7KB 1IY5A 1CT0I 1V1HA 2W0TA 3UEYA 1RFHA 3B4VC 3SEKC 3RU0A 1M8BA 2CJSC 2JXDA 2N1AB 1LR8A 4UXIA 1HPTA 5HI7A 3UGLA 1HJAI 2ARPF 2B8TA 1U5KA 2V1CC 3UEJA 1FAQA 1SGYI 2N71A 2JZMA 2V1CA 1TUSA 2SGFI 3MEKA 1TBNA 2GVIA 3BJIA 3SGBI 1YU6C 2ORWA 1X74A 2V53A 5CCMA 1VDDA 3VDUA 1X4SA 2E5RA 2QQCA 1V1IA 1XX6A 1OYVI 1YTPA 1CGII 1OVOA 1PJUA 3CXLA 1H0ZA 1TBOA 1SGEI 1XBTA 1UVFA 1KBFA 3E59A 4FKDA 4L9MA 2SGDI 4UXHA 1FYBA 1IW4A 1IY6A 2SGQI 1MT1A 2ERWA 2NU4I 3OXGA 3VE5A 3OVOA 5FUXA 2KMPA 5EX3A 1HDLA 2K9HA 3QTLD 1NUBA 1PTQA 2JW6A 2N52A 1SGRI 3SGQI 2KMRA 1PPFI 2ODDA 2M5XA 3GOXA 3OXLA 1SGDI 3PDNA 2QQEA 1R79A 3E2IA 1PCEA 2LUYA 1M8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DS3 I;  2KMQ A;  2NU3 I;  2XRC A;  1OMU A;  1CE3 A;  1SGQ I;  2GKT I;  1DS2 I;  3TJQ A;  1R0R I;  1BUS A;  1UUC A;  1TBQ R;  2KCX A;  1OMT A;  2P6A C;  2NU0 I;  1CT4 I;  4HGU A;  2N17 A;  1TIH A;  2OVO A;  1KMA A;  1CSO I;  1SGP I;  1BMO A;  2F3C I;  1CGJ I;  2SGP I;  1TUR A;  2NU2 I;  1Y1B A;  2BUS A;  2KMO A;  4OVO A;  4GI3 C;  2LEO A;  2GKR I;  5DAE A;  5JHW C;  2B0U C;  2GKV A;  1CT2 I;  2QQD A;  1Y1C A;  1TGS I;  3HH2 C;  2JYY A;  1N13 A;  1SGN I;  2WCY A;  1LR9 A;  1AN1 I;  2NU1 I;  1TBR R;  4SGB I;  1CHO I;  1LR7 A;  2SGE I;  1UVG A;  1Z7K B;  1IY5 A;  1CT0 I;  3B4V C;  3SEK C;  1M8B A;  2JXD A;  1LR8 A;  1HPT A;  1HJA I;  2ARP F;  1SGY I;  2N71 A;  2JZM A;  1TUS A;  2SGF I;  3SGB I;  1YU6 C;  2V53 A;  2QQC A;  1OYV I;  1YTP A;  1CGI I;  1OVO A;  1PJU A;  1H0Z A;  1SGE I;  1UVF A;  2SGD I;  1FYB A;  1IW4 A;  1IY6 A;  2SGQ I;  1MT1 A;  2ERW A;  2NU4 I;  3OVO A;  2KMP A;  1HDL A;  3QTL D;  1NUB A;  2N52 A;  1SGR I;  3SGQ I;  2KMR A;  1PPF I;  2M5X A;  1SGD I;  1PCE A;  1M8C A; 
#chains in the Genus database with same CATH topology
 1DS3 I;  3UGD A;  2KMQ A;  2NU3 I;  2XRC A;  1S20 A;  1OMU A;  5E3Q A;  2ENZ A;  5EX0 A;  5FUV A;  3FC3 A;  2OU2 A;  2QQ0 A;  1CE3 A;  4DNC A;  3UGI A;  1SGQ I;  2GKT I;  4B6D A;  2ORV A;  1DS2 I;  9WGA A;  3QWP A;  2ENN A;  3TJQ A;  1NXU A;  1R0R I;  1UUC A;  3TO6 A;  1BUS A;  2WGC A;  1ULM A;  2UZ3 A;  1TBQ R;  2KCX A;  1OMT A;  4AML A;  2P6A C;  2L7X A;  1KBE A;  3R5B A;  5E3R A;  3TOA A;  1HEV A;  2NU0 I;  2ROW A;  1CT4 I;  2ELI A;  3TOB A;  1UHA A;  4HGU A;  2YQP A;  1Y8F A;  2N17 A;  1TIH A;  4E1R A;  1MJB A;  2J87 A;  2CWH A;  2OD1 A;  2OVO A;  3TO7 A;  1KMA A;  4WP4 A;  5J8C A;  1K7V A;  1CSO I;  1SGP I;  2RC4 A;  1WTJ A;  5HQ8 A;  1MJA A;  1BMO A;  2DB6 A;  2F3C I;  5FUW A;  1CGJ I;  3KY9 A;  2SGP I;  2WVJ A;  1TUR A;  2L8E A;  2NU2 I;  3OL0 A;  5CCL A;  1Y1B A;  2BUS A;  2KMO A;  4OVO A;  2J9R A;  4GI3 C;  2LEO A;  2GKR I;  3R5A A;  4JCV E;  5DAE A;  5JHW C;  1W3S A;  2B0U C;  2GKV A;  5E3P A;  1CT2 I;  2DIP A;  4UXJ A;  3UFF A;  2A20 A;  1TOT A;  2QQD A;  1Z2I A;  1P9Z A;  2E73 A;  2JA1 A;  1XA6 A;  5FUY A;  4E1P A;  7WGA A;  2GIV A;  1Y1C A;  3OXF A;  2VRW B;  1TGS I;  3HH2 C;  2JYY A;  1N13 A;  1SGN I;  2RIJ A;  4A24 A;  2WCY A;  1LR9 A;  4MPI A;  1AN1 I;  1FAR A;  1W4R A;  5J8F A;  2NU1 I;  1TBR R;  2OZU A;  2QPO A;  1CHO I;  3D00 A;  4SGB I;  2YUU A;  2FNF X;  1FY7 A;  1PTR A;  3VDP A;  1LR7 A;  2SGE I;  1UVG A;  1Z7K B;  1IY5 A;  1CT0 I;  1V1H A;  2W0T A;  3UEY A;  1RFH A;  3B4V C;  3SEK C;  3RU0 A;  1M8B A;  2CJS C;  2JXD A;  2N1A B;  1LR8 A;  4UXI A;  1HPT A;  5HI7 A;  1MJ9 A;  3UGL A;  1HJA I;  3R5C A;  2ARP F;  2B8T A;  1U5K A;  2V1C C;  3UEJ A;  1FAQ A;  1SGY I;  2N71 A;  3R5D A;  2JZM A;  1Q9B A;  2V1C A;  3UOE A;  2Y0M A;  1K7U A;  1TUS A;  2PQ8 A;  2SGF I;  3MEK A;  1TBN A;  2GVI A;  1ULN A;  3BJI A;  3SGB I;  1YU6 C;  2ORW A;  2X3T A;  1X74 A;  2V53 A;  5CCM A;  1VDD A;  3VDU A;  1X4S A;  2E5R A;  2QQC A;  2CWF A;  1V1I A;  1XX6 A;  1OYV I;  1YTP A;  1CGI I;  1OVO A;  1PJU A;  1K7T A;  3CXL A;  1H0Z A;  1TBO A;  1SGE I;  1XBT A;  2DKV A;  3QAH A;  3FSX A;  1UVF A;  1KBF A;  3E59 A;  2LB7 A;  1P9G A;  4FKD A;  2SGD I;  4L9M A;  4UXH A;  1FYB A;  1IW4 A;  1IY6 A;  2SGQ I;  1MT1 A;  2ERW A;  2NU4 I;  3FSY A;  3OXG A;  1ULK A;  3VE5 A;  2X52 A;  3OVO A;  5FUX A;  2KMP A;  5EX3 A;  1WGC A;  1HDL A;  2K9H A;  3QTL D;  1NUB A;  1PTQ A;  2JW6 A;  2N52 A;  1WKX A;  1SGR I;  1WGT A;  3SGQ I;  2KMR A;  1PPF I;  2ODD A;  2M5X A;  2CWG A;  3GOX A;  3OXL A;  1SGD I;  3PDN A;  2QQE A;  3TO9 A;  1R79 A;  3E2I A;  1PCE A;  2LUY A;  2UVO A;  1M8C A; 
#chains in the Genus database with same CATH homology
 1DS3 I;  3UGD A;  2KMQ A;  2NU3 I;  2XRC A;  5FUV A;  1OMU A;  5EX0 A;  2ENZ A;  3FC3 A;  2QQ0 A;  1CE3 A;  3UGI A;  1SGQ I;  2GKT I;  4B6D A;  2ORV A;  1DS2 I;  3QWP A;  2ENN A;  3TJQ A;  1R0R I;  1BUS A;  1UUC A;  2UZ3 A;  1TBQ R;  2KCX A;  1OMT A;  2P6A C;  2L7X A;  1KBE A;  2NU0 I;  2ROW A;  1CT4 I;  2ELI A;  4HGU A;  2YQP A;  1Y8F A;  2N17 A;  1TIH A;  4E1R A;  2J87 A;  2OD1 A;  2OVO A;  1KMA A;  5HQ8 A;  1CSO I;  1SGP I;  1BMO A;  2DB6 A;  2F3C I;  5FUW A;  1CGJ I;  3KY9 A;  2SGP I;  2WVJ A;  1TUR A;  2L8E A;  2NU2 I;  3OL0 A;  5CCL A;  1Y1B A;  2BUS A;  2KMO A;  4OVO A;  2J9R A;  4GI3 C;  2LEO A;  2GKR I;  4JCV E;  5DAE A;  5JHW C;  1W3S A;  2B0U C;  2GKV A;  1CT2 I;  2DIP A;  4UXJ A;  3UFF A;  2A20 A;  1TOT A;  2QQD A;  2JA1 A;  2E73 A;  5FUY A;  1XA6 A;  4E1P A;  1Y1C A;  3OXF A;  2VRW B;  1TGS I;  3HH2 C;  2JYY A;  1N13 A;  1SGN I;  4A24 A;  2WCY A;  1LR9 A;  1AN1 I;  1FAR A;  1W4R A;  2NU1 I;  1TBR R;  2QPO A;  1CHO I;  3D00 A;  4SGB I;  2YUU A;  2FNF X;  1PTR A;  3VDP A;  1LR7 A;  2SGE I;  1UVG A;  1Z7K B;  1IY5 A;  1CT0 I;  1V1H A;  2W0T A;  3UEY A;  1RFH A;  3B4V C;  3SEK C;  3RU0 A;  1M8B A;  2CJS C;  2JXD A;  2N1A B;  1LR8 A;  4UXI A;  1HPT A;  5HI7 A;  3UGL A;  1HJA I;  2ARP F;  2B8T A;  1U5K A;  2V1C C;  3UEJ A;  1FAQ A;  1SGY I;  2N71 A;  2JZM A;  2V1C A;  1TUS A;  2SGF I;  3MEK A;  1TBN A;  2GVI A;  3BJI A;  3SGB I;  1YU6 C;  2ORW A;  1X74 A;  2V53 A;  5CCM A;  1VDD A;  3VDU A;  1X4S A;  2E5R A;  2QQC A;  1V1I A;  1XX6 A;  1OYV I;  1YTP A;  1CGI I;  1OVO A;  1PJU A;  3CXL A;  1H0Z A;  1TBO A;  1SGE I;  1XBT A;  1UVF A;  1KBF A;  3E59 A;  4FKD A;  4L9M A;  2SGD I;  4UXH A;  1FYB A;  1IW4 A;  1IY6 A;  2SGQ I;  1MT1 A;  2ERW A;  2NU4 I;  3OXG A;  3VE5 A;  3OVO A;  5FUX A;  2KMP A;  5EX3 A;  1HDL A;  2K9H A;  3QTL D;  1NUB A;  1PTQ A;  2JW6 A;  2N52 A;  1SGR I;  3SGQ I;  2KMR A;  1PPF I;  2ODD A;  2M5X A;  3GOX A;  3OXL A;  1SGD I;  3PDN A;  2QQE A;  1R79 A;  3E2I A;  1PCE A;  2LUY A;  1M8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...