4E1RA

Crystal structure of the dimerization domain of lsr2 from mycobacterium tuberculosis in the p 31 2 1 space group
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
55
structure length
55
Chain Sequence
KVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Protein lsr2
publication title The structure of the oligomerization domain of Lsr2 from Mycobacterium tuberculosis reveals a mechanism for chromosome organization and protection.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 11
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.230 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4e1rA00
4E1RA 4E1PA
chains in the Genus database with same CATH superfamily
3D00A 1CSOI 1XBTA 1V1HA 1YTPA 1OMUA 1SGYI 2GKVA 1MJBA 5FUWA 5J8CA 5JHWC 5E3QA 1IY5A 1WTJA 1W3SA 3OXFA 3UOEA 2GVIA 3CXLA 1CT4I 2V53A 1TBOA 1TURA 1SGRI 3OL0A 1R79A 2M5XA 1TIHA 2X3TA 7WGAA 2ARPF 2K9HA 1LR7A 1TOTA 2JW6A 3OXGA 1K7UA 4WP4A 1IY6A 3UFFA 4MPIA 4E1PA 2DIPA 3UEYA 2YQPA 3OVOA 5HQ8A 2J9RA 1YU6C 5FUXA 1U5KA 2E73A 3SGQI 3E2IA 3UEJA 1ULKA 2BUSA 3UGDA 1XA6A 2N17A 4OVOA 1TBNA 1DS3I 2WCYA 1H0ZA 5EX3A 2SGEI 4DNCA 1HJAI 4A24A 1BMOA 1MT1A 5DAEA 2YUUA 1PJUA 1PPFI 4UXHA 2ODDA 1M8CA 1PTQA 1DS2I 2CWGA 3FC3A 3GOXA 2ERWA 2NU2I 3VE5A 3SGBI 1Y1BA 1TGSI 1Z7KB 3R5CA 5J8FA 4E1RA 1X4SA 2JZMA 1OYVI 2VRWB 1AN1I 1KBFA 2UZ3A 9WGAA 3RU0A 3TOBA 3PDNA 1VDDA 5FUYA 1OVOA 2DKVA 2ELIA 1FYBA 1R0RI 2SGFI 1V1IA 3QAHA 2LEOA 2ORWA 1N13A 2N52A 5FUVA 2SGDI 2CJSC 2GKTI 1SGPI 2NU3I 1HEVA 3SEKC 1CGJI 3QWPA 1NUBA 1K7VA 4AMLA 2JYYA 2N71A 1SGDI 2QPOA 3VDPA 1SGQI 2E5RA 2QQ0A 3FSYA 3TO7A 2GIVA 1XX6A 1Y8FA 2NU4I 1PTRA 5CCMA 1FARA 2L7XA 1KMAA 5CCLA 1MJAA 1NXUA 1RFHA 1UUCA 3OXLA 4JCVE 2DB6A 5E3PA 2ENNA 2N1AB 2UVOA 3QTLD 1WGTA 3FSXA 1Q9BA 1CGII 2CWHA 2F3CI 2L8EA 2KCXA 2X52A 2SGPI 3R5DA 1LR8A 1KBEA 5EX0A 2RIJA 2KMRA 2KMPA 3KY9A 1CT0I 1SGEI 3BJIA 4GI3C 4UXIA 2W0TA 2OZUA 3UGLA 2V1CC 2Y0MA 3TO6A 4HGUA 4L9MA 2QQCA 2RC4A 1BUSA 1TBRR 1UHAA 3TO9A 5E3RA 1HPTA 1P9ZA 1LR9A 1CE3A 3R5BA 1ULNA 1UVFA 2KMQA 3B4VC 1TBQR 1TUSA 1X74A 2A20A 2NU1I 1SGNI 1WKXA 2LB7A 1W4RA 2V1CA 2LUYA 2OD1A 2WGCA 2KMOA 3TJQA 1IW4A 1CT2I 4FKDA 2JXDA 2B8TA 1HDLA 2CWFA 2SGQI 1ULMA 2B0UC 1M8BA 2FNFX 2OU2A 1WGCA 1S20A 2QQEA 3HH2C 1PCEA 2J87A 2JA1A 3MEKA 4B6DA 1P9GA 1Z2IA 4SGBI 4UXJA 3TOAA 2OVOA 1CHOI 2GKRI 1UVGA 1Y1CA 2ORVA 2P6AC 2QQDA 2NU0I 2WVJA 3VDUA 2ENZA 3UGIA 1MJ9A 2PQ8A 2XRCA 3E59A 1K7TA 3R5AA 1FY7A 1FAQA 5HI7A 2ROWA 1OMTA
chains in the Genus database with same CATH topology
3D00A 1CSOI 1XBTA 1V1HA 1YTPA 1OMUA 1SGYI 2GKVA 5FUWA 5JHWC 1W3SA 3OXFA 2GVIA 3CXLA 1CT4I 2V53A 1TBOA 1TURA 1SGRI 1R79A 2M5XA 1TIHA 2ARPF 2K9HA 1LR7A 1TOTA 2JW6A 3OXGA 1IY6A 3UFFA 4E1PA 1IY5A 2DIPA 3UEYA 2YQPA 3OVOA 5HQ8A 2J9RA 1YU6C 5FUXA 1U5KA 2E73A 3SGQI 3E2IA 3UEJA 2BUSA 3UGDA 1XA6A 2N17A 4OVOA 1TBNA 1DS3I 2WCYA 1H0ZA 5EX3A 2SGEI 1HJAI 4A24A 1BMOA 1MT1A 5DAEA 2YUUA 1PJUA 1PPFI 4UXHA 2ODDA 1M8CA 1PTQA 1DS2I 3GOXA 3FC3A 2ERWA 2NU2I 3VE5A 3SGBI 1Y1BA 1TGSI 1Z7KB 4E1RA 1X4SA 2JZMA 1OYVI 2VRWB 1AN1I 1KBFA 2UZ3A 3RU0A 3PDNA 1VDDA 5FUYA 1OVOA 2ELIA 1FYBA 1R0RI 2SGFI 1V1IA 2LEOA 2ORWA 1N13A 2N52A 5FUVA 2SGDI 2CJSC 2GKTI 1SGPI 2NU3I 3SEKC 1CGJI 3QWPA 1NUBA 2JYYA 2N71A 1SGDI 2QPOA 3VDPA 1SGQI 2E5RA 2QQ0A 1XX6A 1Y8FA 2NU4I 1PTRA 5CCMA 1FARA 2L7XA 1KMAA 5CCLA 1RFHA 1UUCA 3OXLA 4JCVE 2DB6A 2ENNA 2N1AB 3QTLD 2F3CI 1CGII 2L8EA 2KCXA 2SGPI 1LR8A 1KBEA 5EX0A 2KMRA 2KMPA 3KY9A 1CT0I 1SGEI 3BJIA 4GI3C 4UXIA 2W0TA 3UGLA 2V1CC 4HGUA 4L9MA 2QQCA 1BUSA 1TBRR 1HPTA 1LR9A 1CE3A 1UVFA 2KMQA 3B4VC 1TBQR 1TUSA 1X74A 2A20A 2NU1I 1SGNI 1IW4A 1W4RA 2V1CA 2LUYA 2OD1A 3TJQA 2KMOA 1CT2I 4FKDA 2JXDA 2B8TA 1HDLA 2SGQI 2B0UC 1M8BA 2FNFX 2QQEA 3HH2C 1PCEA 2J87A 2JA1A 3MEKA 4B6DA 4SGBI 4UXJA 2OVOA 1CHOI 2GKRI 1UVGA 1Y1CA 2ORVA 2P6AC 2QQDA 2NU0I 2WVJA 3VDUA 2ENZA 3UGIA 3E59A 2XRCA 1FAQA 3OL0A 5HI7A 2ROWA 1OMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1R A;  4E1P A; 
#chains in the Genus database with same CATH topology
 3D00 A;  1CSO I;  1XBT A;  1V1H A;  1YTP A;  1OMU A;  1SGY I;  2GKV A;  1MJB A;  5FUW A;  5J8C A;  5JHW C;  5E3Q A;  1IY5 A;  1WTJ A;  1W3S A;  3OXF A;  3UOE A;  2GVI A;  3CXL A;  1CT4 I;  2V53 A;  1TBO A;  1TUR A;  1SGR I;  3OL0 A;  1R79 A;  2M5X A;  1TIH A;  2X3T A;  7WGA A;  2ARP F;  2K9H A;  1LR7 A;  1TOT A;  2JW6 A;  3OXG A;  1K7U A;  4WP4 A;  1IY6 A;  3UFF A;  4MPI A;  4E1P A;  2DIP A;  3UEY A;  2YQP A;  3OVO A;  5HQ8 A;  2J9R A;  1YU6 C;  5FUX A;  1U5K A;  2E73 A;  3SGQ I;  3E2I A;  3UEJ A;  1ULK A;  2BUS A;  3UGD A;  1XA6 A;  2N17 A;  4OVO A;  1TBN A;  1DS3 I;  2WCY A;  1H0Z A;  5EX3 A;  2SGE I;  4DNC A;  1HJA I;  4A24 A;  1BMO A;  1MT1 A;  5DAE A;  2YUU A;  1PJU A;  1PPF I;  4UXH A;  2ODD A;  1M8C A;  1PTQ A;  1DS2 I;  2CWG A;  3FC3 A;  3GOX A;  2ERW A;  2NU2 I;  3VE5 A;  3SGB I;  1Y1B A;  1TGS I;  1Z7K B;  3R5C A;  5J8F A;  4E1R A;  1X4S A;  2JZM A;  1OYV I;  2VRW B;  1AN1 I;  1KBF A;  2UZ3 A;  9WGA A;  3RU0 A;  3TOB A;  3PDN A;  1VDD A;  5FUY A;  1OVO A;  2DKV A;  2ELI A;  1FYB A;  1R0R I;  2SGF I;  1V1I A;  3QAH A;  2LEO A;  2ORW A;  1N13 A;  2N52 A;  5FUV A;  2SGD I;  2CJS C;  2GKT I;  1SGP I;  2NU3 I;  1HEV A;  3SEK C;  1CGJ I;  3QWP A;  1NUB A;  1K7V A;  4AML A;  2JYY A;  2N71 A;  1SGD I;  2QPO A;  3VDP A;  1SGQ I;  2E5R A;  2QQ0 A;  3FSY A;  3TO7 A;  2GIV A;  1XX6 A;  1Y8F A;  2NU4 I;  1PTR A;  5CCM A;  1FAR A;  2L7X A;  1KMA A;  5CCL A;  1MJA A;  1NXU A;  1RFH A;  1UUC A;  3OXL A;  4JCV E;  2DB6 A;  5E3P A;  2ENN A;  2N1A B;  2UVO A;  3QTL D;  1WGT A;  3FSX A;  1Q9B A;  1CGI I;  2CWH A;  2F3C I;  2L8E A;  2KCX A;  2X52 A;  2SGP I;  3R5D A;  1LR8 A;  1KBE A;  5EX0 A;  2RIJ A;  2KMR A;  2KMP A;  3KY9 A;  1CT0 I;  1SGE I;  3BJI A;  4GI3 C;  4UXI A;  2W0T A;  2OZU A;  3UGL A;  2V1C C;  2Y0M A;  3TO6 A;  4HGU A;  4L9M A;  2QQC A;  2RC4 A;  1BUS A;  1TBR R;  1UHA A;  3TO9 A;  5E3R A;  1HPT A;  1P9Z A;  1LR9 A;  1CE3 A;  3R5B A;  1ULN A;  1UVF A;  2KMQ A;  3B4V C;  1TBQ R;  1TUS A;  1X74 A;  2A20 A;  2NU1 I;  1SGN I;  1WKX A;  2LB7 A;  1W4R A;  2V1C A;  2LUY A;  2OD1 A;  2WGC A;  2KMO A;  3TJQ A;  1IW4 A;  1CT2 I;  4FKD A;  2JXD A;  2B8T A;  1HDL A;  2CWF A;  2SGQ I;  1ULM A;  2B0U C;  1M8B A;  2FNF X;  2OU2 A;  1WGC A;  1S20 A;  2QQE A;  3HH2 C;  1PCE A;  2J87 A;  2JA1 A;  3MEK A;  4B6D A;  1P9G A;  1Z2I A;  4SGB I;  4UXJ A;  3TOA A;  2OVO A;  1CHO I;  2GKR I;  1UVG A;  1Y1C A;  2ORV A;  2P6A C;  2QQD A;  2NU0 I;  2WVJ A;  3VDU A;  2ENZ A;  3UGI A;  1MJ9 A;  2PQ8 A;  2XRC A;  3E59 A;  1K7T A;  3R5A A;  1FY7 A;  1FAQ A;  5HI7 A;  2ROW A;  1OMT A; 
#chains in the Genus database with same CATH homology
 3D00 A;  1CSO I;  1XBT A;  1V1H A;  1YTP A;  1OMU A;  1SGY I;  2GKV A;  5FUW A;  5JHW C;  1W3S A;  3OXF A;  2GVI A;  3CXL A;  1CT4 I;  2V53 A;  1TBO A;  1TUR A;  1SGR I;  1R79 A;  2M5X A;  1TIH A;  2ARP F;  2K9H A;  1LR7 A;  1TOT A;  2JW6 A;  3OXG A;  1IY6 A;  3UFF A;  4E1P A;  1IY5 A;  2DIP A;  3UEY A;  2YQP A;  3OVO A;  5HQ8 A;  2J9R A;  1YU6 C;  5FUX A;  1U5K A;  2E73 A;  3SGQ I;  3E2I A;  3UEJ A;  2BUS A;  3UGD A;  1XA6 A;  2N17 A;  4OVO A;  1TBN A;  1DS3 I;  2WCY A;  1H0Z A;  5EX3 A;  2SGE I;  1HJA I;  4A24 A;  1BMO A;  1MT1 A;  5DAE A;  2YUU A;  1PJU A;  1PPF I;  4UXH A;  2ODD A;  1M8C A;  1PTQ A;  1DS2 I;  3GOX A;  3FC3 A;  2ERW A;  2NU2 I;  3VE5 A;  3SGB I;  1Y1B A;  1TGS I;  1Z7K B;  4E1R A;  1X4S A;  2JZM A;  1OYV I;  2VRW B;  1AN1 I;  1KBF A;  2UZ3 A;  3RU0 A;  3PDN A;  1VDD A;  5FUY A;  1OVO A;  2ELI A;  1FYB A;  1R0R I;  2SGF I;  1V1I A;  2LEO A;  2ORW A;  1N13 A;  2N52 A;  5FUV A;  2SGD I;  2CJS C;  2GKT I;  1SGP I;  2NU3 I;  3SEK C;  1CGJ I;  3QWP A;  1NUB A;  2JYY A;  2N71 A;  1SGD I;  2QPO A;  3VDP A;  1SGQ I;  2E5R A;  2QQ0 A;  1XX6 A;  1Y8F A;  2NU4 I;  1PTR A;  5CCM A;  1FAR A;  2L7X A;  1KMA A;  5CCL A;  1RFH A;  1UUC A;  3OXL A;  4JCV E;  2DB6 A;  2ENN A;  2N1A B;  3QTL D;  2F3C I;  1CGI I;  2L8E A;  2KCX A;  2SGP I;  1LR8 A;  1KBE A;  5EX0 A;  2KMR A;  2KMP A;  3KY9 A;  1CT0 I;  1SGE I;  3BJI A;  4GI3 C;  4UXI A;  2W0T A;  3UGL A;  2V1C C;  4HGU A;  4L9M A;  2QQC A;  1BUS A;  1TBR R;  1HPT A;  1LR9 A;  1CE3 A;  1UVF A;  2KMQ A;  3B4V C;  1TBQ R;  1TUS A;  1X74 A;  2A20 A;  2NU1 I;  1SGN I;  1IW4 A;  1W4R A;  2V1C A;  2LUY A;  2OD1 A;  3TJQ A;  2KMO A;  1CT2 I;  4FKD A;  2JXD A;  2B8T A;  1HDL A;  2SGQ I;  2B0U C;  1M8B A;  2FNF X;  2QQE A;  3HH2 C;  1PCE A;  2J87 A;  2JA1 A;  3MEK A;  4B6D A;  4SGB I;  4UXJ A;  2OVO A;  1CHO I;  2GKR I;  1UVG A;  1Y1C A;  2ORV A;  2P6A C;  2QQD A;  2NU0 I;  2WVJ A;  3VDU A;  2ENZ A;  3UGI A;  3E59 A;  2XRC A;  1FAQ A;  3OL0 A;  5HI7 A;  2ROW A;  1OMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...