4E1RA

Crystal structure of the dimerization domain of lsr2 from mycobacterium tuberculosis in the p 31 2 1 space group
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
55
structure length
55
Chain Sequence
KVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lsr2
publication title The structure of the oligomerization domain of Lsr2 from Mycobacterium tuberculosis reveals a mechanism for chromosome organization and protection.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 11
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.230 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4e1rA00
4E1PA 4E1RA
chains in the Genus database with same CATH superfamily
1CT0I 1XA6A 2OD1A 2SGEI 2W0TA 4WP4A 3TO9A 4E1RA 1Z7KB 1FYBA 3FSXA 1PTRA 1WTJA 2ENNA 2YQPA 1PPFI 1IY6A 3E2IA 1LR8A 2DB6A 2GKTI 2J87A 3QAHA 1XBTA 1WGCA 2JYYA 3TJQA 2UZ3A 1TBRR 2SGPI 1FY7A 1FAQA 1IW4A 2XRCA 2GKVA 3TO6A 2ORVA 5E3QA 2BUSA 1TBOA 2QPOA 2JA1A 2NU4I 1SGYI 1UVGA 2E5RA 1AN1I 1SGDI 1VDDA 2KCXA 1SGEI 1TGSI 2NU1I 3E59A 1UHAA 2CWGA 3HH2C 1HDLA 1X4SA 1SGNI 1KMAA 1Y8FA 2N17A 2CWHA 2KMOA 2WCYA 1PCEA 2N1AB 2OVOA 5J8FA 2VRWB 1TBQR 2M5XA 5EX3A 7WGAA 3SGQI 2KMQA 2X52A 5CCLA 1Z2IA 2KMRA 3TOBA 2OU2A 4B6DA 1ULMA 5DAEA 1R79A 3MEKA 2LEOA 3R5DA 2RIJA 1U5KA 4AMLA 2Y0MA 5J8CA 2V1CC 3UFFA 2ORWA 2P6AC 1KBFA 1LR7A 4HGUA 1HPTA 1M8BA 1Y1CA 2B8TA 1X74A 1UVFA 2SGDI 3VE5A 1MJBA 3RU0A 1FARA 2ARPF 5HI7A 2SGFI 1XX6A 2FNFX 3R5BA 2NU3I 4DNCA 3VDPA 1DS3I 1RFHA 2LUYA 3UGIA 4E1PA 5HQ8A 3QWPA 4GI3C 1S20A 1BUSA 1CE3A 2CJSC 2DIPA 3CXLA 1IY5A 1CT4I 1P9ZA 2QQCA 1TBNA 5EX0A 4JCVE 3VDUA 9WGAA 3OXGA 4FKDA 1DS2I 2B0UC 1OVOA 1V1HA 1OMUA 2K9HA 1WKXA 1HEVA 1PJUA 1CHOI 1BMOA 1HJAI 1MJ9A 1PTQA 1TUSA 1W4RA 2ENZA 2KMPA 4UXIA 3UEYA 2JZMA 3FC3A 1LR9A 2UVOA 5FUXA 1Q9BA 2YUUA 3BJIA 2QQDA 2V1CA 1R0RI 3OVOA 3R5AA 1K7TA 2PQ8A 3UGLA 2QQEA 2GVIA 2N52A 3TO7A 5E3PA 3SGBI 1SGPI 1TOTA 2DKVA 1ULKA 2LB7A 3FSYA 3B4VC 3PDNA 1CT2I 2E73A 5E3RA 2X3TA 5FUVA 2ROWA 1P9GA 2L8EA 2SGQI 4L9MA 1CGJI 3OL0A 1K7UA 1N13A 3KY9A 3UEJA 1W3SA 2NU2I 2N71A 3D00A 2GIVA 1ULNA 4UXJA 5CCMA 1UUCA 1OMTA 1TURA 2OZUA 2NU0I 3OXLA 2V53A 1Y1BA 4OVOA 2GKRI 2A20A 1YU6C 4A24A 1MT1A 2JXDA 5FUWA 1KBEA 2JW6A 3SEKC 2ELIA 1MJAA 1SGRI 1M8CA 1WGTA 3QTLD 4UXHA 2L7XA 1SGQI 1TIHA 3TOAA 2F3CI 2RC4A 3UOEA 5FUYA 3UGDA 2CWFA 4SGBI 1CGII 3R5CA 1NXUA 3GOXA 1YTPA 2ERWA 4MPIA 5JHWC 1OYVI 2WVJA 2QQ0A 1K7VA 1NUBA 2ODDA 1V1IA 1CSOI 2J9RA 2WGCA 1H0ZA 3OXFA
chains in the Genus database with same CATH topology
1CT0I 1XA6A 2OD1A 2SGEI 2W0TA 1FYBA 4E1RA 1Z7KB 1PTRA 2ENNA 2YQPA 1PPFI 1IY6A 3E2IA 1LR8A 2DB6A 2GKTI 2J87A 1XBTA 2JYYA 3TJQA 2UZ3A 1TBRR 2SGPI 1IW4A 2XRCA 2GKVA 2ORVA 2BUSA 1TBOA 2QPOA 2JA1A 2NU4I 1SGYI 1UVGA 2E5RA 1AN1I 1SGDI 1VDDA 2KCXA 1SGEI 1TGSI 2NU1I 3E59A 3HH2C 1HDLA 1KMAA 1X4SA 1SGNI 1Y8FA 2N17A 2KMOA 2WCYA 1FAQA 1PCEA 2N1AB 2OVOA 2VRWB 1TBQR 2M5XA 5EX3A 3SGQI 2KMQA 5CCLA 2KMRA 4B6DA 5DAEA 1R79A 3MEKA 2LEOA 1U5KA 2V1CC 3UFFA 2ORWA 2P6AC 1KBFA 1LR7A 4HGUA 1HPTA 1M8BA 1Y1CA 2B8TA 1X74A 1UVFA 2SGDI 3VE5A 3RU0A 1FARA 2ARPF 5HI7A 2SGFI 1XX6A 2FNFX 2NU3I 3VDPA 1DS3I 1RFHA 2LUYA 3UGIA 4E1PA 5HQ8A 3QWPA 4GI3C 1BUSA 1CE3A 2CJSC 2DIPA 3CXLA 1IY5A 1CT4I 2QQCA 1TBNA 5EX0A 4JCVE 3VDUA 3OXGA 4FKDA 1DS2I 2B0UC 1OVOA 1V1HA 1OMUA 2K9HA 1PJUA 1CHOI 1BMOA 1HJAI 1PTQA 1TUSA 1W4RA 2ENZA 2KMPA 4UXIA 3UEYA 3FC3A 2JZMA 1LR9A 5FUXA 3OVOA 2YUUA 3BJIA 2QQDA 2V1CA 1R0RI 3UGLA 2QQEA 2GVIA 2N52A 3SGBI 1SGPI 1TOTA 3B4VC 3PDNA 1CT2I 2E73A 5FUVA 2ROWA 2L8EA 2SGQI 4L9MA 1CGJI 3OL0A 1N13A 3KY9A 3UEJA 1W3SA 2NU2I 2N71A 3D00A 4UXJA 5CCMA 1UUCA 1OMTA 1TURA 2NU0I 3OXLA 2V53A 1Y1BA 4OVOA 2GKRI 2A20A 1YU6C 4A24A 1MT1A 2JXDA 5FUWA 1KBEA 2JW6A 3SEKC 2ELIA 1SGRI 1M8CA 3QTLD 4UXHA 2L7XA 1SGQI 1TIHA 2F3CI 5FUYA 3UGDA 4SGBI 1CGII 3GOXA 1YTPA 2ERWA 5JHWC 1OYVI 2WVJA 2QQ0A 2ODDA 1NUBA 1V1IA 1CSOI 2J9RA 1H0ZA 3OXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1P A;  4E1R A; 
#chains in the Genus database with same CATH topology
 1CT0 I;  1XA6 A;  2OD1 A;  2SGE I;  2W0T A;  4WP4 A;  3TO9 A;  4E1R A;  1Z7K B;  1FYB A;  3FSX A;  1PTR A;  1WTJ A;  2ENN A;  2YQP A;  1PPF I;  1IY6 A;  3E2I A;  1LR8 A;  2DB6 A;  2GKT I;  2J87 A;  3QAH A;  1XBT A;  1WGC A;  2JYY A;  3TJQ A;  2UZ3 A;  1TBR R;  2SGP I;  1FY7 A;  1FAQ A;  1IW4 A;  2XRC A;  2GKV A;  3TO6 A;  2ORV A;  5E3Q A;  2BUS A;  1TBO A;  2QPO A;  2JA1 A;  2NU4 I;  1SGY I;  1UVG A;  2E5R A;  1AN1 I;  1SGD I;  1VDD A;  2KCX A;  1SGE I;  1TGS I;  2NU1 I;  3E59 A;  1UHA A;  2CWG A;  3HH2 C;  1HDL A;  1X4S A;  1SGN I;  1KMA A;  1Y8F A;  2N17 A;  2CWH A;  2KMO A;  2WCY A;  1PCE A;  2N1A B;  2OVO A;  5J8F A;  2VRW B;  1TBQ R;  2M5X A;  5EX3 A;  7WGA A;  3SGQ I;  2KMQ A;  2X52 A;  5CCL A;  1Z2I A;  2KMR A;  3TOB A;  2OU2 A;  4B6D A;  1ULM A;  5DAE A;  1R79 A;  3MEK A;  2LEO A;  3R5D A;  2RIJ A;  1U5K A;  4AML A;  2Y0M A;  5J8C A;  2V1C C;  3UFF A;  2ORW A;  2P6A C;  1KBF A;  1LR7 A;  4HGU A;  1HPT A;  1M8B A;  1Y1C A;  2B8T A;  1X74 A;  1UVF A;  2SGD I;  3VE5 A;  1MJB A;  3RU0 A;  1FAR A;  2ARP F;  5HI7 A;  2SGF I;  1XX6 A;  2FNF X;  3R5B A;  2NU3 I;  4DNC A;  3VDP A;  1DS3 I;  1RFH A;  2LUY A;  3UGI A;  4E1P A;  5HQ8 A;  3QWP A;  4GI3 C;  1S20 A;  1BUS A;  1CE3 A;  2CJS C;  2DIP A;  3CXL A;  1IY5 A;  1CT4 I;  1P9Z A;  2QQC A;  1TBN A;  5EX0 A;  4JCV E;  3VDU A;  9WGA A;  3OXG A;  4FKD A;  1DS2 I;  2B0U C;  1OVO A;  1V1H A;  1OMU A;  2K9H A;  1WKX A;  1HEV A;  1PJU A;  1CHO I;  1BMO A;  1HJA I;  1MJ9 A;  1PTQ A;  1TUS A;  1W4R A;  2ENZ A;  2KMP A;  4UXI A;  3UEY A;  2JZM A;  3FC3 A;  1LR9 A;  2UVO A;  5FUX A;  1Q9B A;  2YUU A;  3BJI A;  2QQD A;  2V1C A;  1R0R I;  3OVO A;  3R5A A;  1K7T A;  2PQ8 A;  3UGL A;  2QQE A;  2GVI A;  2N52 A;  3TO7 A;  5E3P A;  3SGB I;  1SGP I;  1TOT A;  2DKV A;  1ULK A;  2LB7 A;  3FSY A;  3B4V C;  3PDN A;  1CT2 I;  2E73 A;  5E3R A;  2X3T A;  5FUV A;  2ROW A;  1P9G A;  2L8E A;  2SGQ I;  4L9M A;  1CGJ I;  3OL0 A;  1K7U A;  1N13 A;  3KY9 A;  3UEJ A;  1W3S A;  2NU2 I;  2N71 A;  3D00 A;  2GIV A;  1ULN A;  4UXJ A;  5CCM A;  1UUC A;  1OMT A;  1TUR A;  2OZU A;  2NU0 I;  3OXL A;  2V53 A;  1Y1B A;  4OVO A;  2GKR I;  2A20 A;  1YU6 C;  4A24 A;  1MT1 A;  2JXD A;  5FUW A;  1KBE A;  2JW6 A;  3SEK C;  2ELI A;  1MJA A;  1SGR I;  1M8C A;  1WGT A;  3QTL D;  4UXH A;  2L7X A;  1SGQ I;  1TIH A;  3TOA A;  2F3C I;  2RC4 A;  3UOE A;  5FUY A;  3UGD A;  2CWF A;  4SGB I;  1CGI I;  3R5C A;  1NXU A;  3GOX A;  1YTP A;  2ERW A;  4MPI A;  5JHW C;  1OYV I;  2WVJ A;  2QQ0 A;  1K7V A;  1NUB A;  2ODD A;  1V1I A;  1CSO I;  2J9R A;  2WGC A;  1H0Z A;  3OXF A; 
#chains in the Genus database with same CATH homology
 1CT0 I;  1XA6 A;  2OD1 A;  2SGE I;  2W0T A;  1FYB A;  4E1R A;  1Z7K B;  1PTR A;  2ENN A;  2YQP A;  1PPF I;  1IY6 A;  3E2I A;  1LR8 A;  2DB6 A;  2GKT I;  2J87 A;  1XBT A;  2JYY A;  3TJQ A;  2UZ3 A;  1TBR R;  2SGP I;  1IW4 A;  2XRC A;  2GKV A;  2ORV A;  2BUS A;  1TBO A;  2QPO A;  2JA1 A;  2NU4 I;  1SGY I;  1UVG A;  2E5R A;  1AN1 I;  1SGD I;  1VDD A;  2KCX A;  1SGE I;  1TGS I;  2NU1 I;  3E59 A;  3HH2 C;  1HDL A;  1KMA A;  1X4S A;  1SGN I;  1Y8F A;  2N17 A;  2KMO A;  2WCY A;  1FAQ A;  1PCE A;  2N1A B;  2OVO A;  2VRW B;  1TBQ R;  2M5X A;  5EX3 A;  3SGQ I;  2KMQ A;  5CCL A;  2KMR A;  4B6D A;  5DAE A;  1R79 A;  3MEK A;  2LEO A;  1U5K A;  2V1C C;  3UFF A;  2ORW A;  2P6A C;  1KBF A;  1LR7 A;  4HGU A;  1HPT A;  1M8B A;  1Y1C A;  2B8T A;  1X74 A;  1UVF A;  2SGD I;  3VE5 A;  3RU0 A;  1FAR A;  2ARP F;  5HI7 A;  2SGF I;  1XX6 A;  2FNF X;  2NU3 I;  3VDP A;  1DS3 I;  1RFH A;  2LUY A;  3UGI A;  4E1P A;  5HQ8 A;  3QWP A;  4GI3 C;  1BUS A;  1CE3 A;  2CJS C;  2DIP A;  3CXL A;  1IY5 A;  1CT4 I;  2QQC A;  1TBN A;  5EX0 A;  4JCV E;  3VDU A;  3OXG A;  4FKD A;  1DS2 I;  2B0U C;  1OVO A;  1V1H A;  1OMU A;  2K9H A;  1PJU A;  1CHO I;  1BMO A;  1HJA I;  1PTQ A;  1TUS A;  1W4R A;  2ENZ A;  2KMP A;  4UXI A;  3UEY A;  3FC3 A;  2JZM A;  1LR9 A;  5FUX A;  3OVO A;  2YUU A;  3BJI A;  2QQD A;  2V1C A;  1R0R I;  3UGL A;  2QQE A;  2GVI A;  2N52 A;  3SGB I;  1SGP I;  1TOT A;  3B4V C;  3PDN A;  1CT2 I;  2E73 A;  5FUV A;  2ROW A;  2L8E A;  2SGQ I;  4L9M A;  1CGJ I;  3OL0 A;  1N13 A;  3KY9 A;  3UEJ A;  1W3S A;  2NU2 I;  2N71 A;  3D00 A;  4UXJ A;  5CCM A;  1UUC A;  1OMT A;  1TUR A;  2NU0 I;  3OXL A;  2V53 A;  1Y1B A;  4OVO A;  2GKR I;  2A20 A;  1YU6 C;  4A24 A;  1MT1 A;  2JXD A;  5FUW A;  1KBE A;  2JW6 A;  3SEK C;  2ELI A;  1SGR I;  1M8C A;  3QTL D;  4UXH A;  2L7X A;  1SGQ I;  1TIH A;  2F3C I;  5FUY A;  3UGD A;  4SGB I;  1CGI I;  3GOX A;  1YTP A;  2ERW A;  5JHW C;  1OYV I;  2WVJ A;  2QQ0 A;  2ODD A;  1NUB A;  1V1I A;  1CSO I;  2J9R A;  1H0Z A;  3OXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...