3HH2C

Crystal structure of the myostatin:follistatin 288 complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
288
structure length
278
Chain Sequence
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/cytokine
molecule keywords Growth/differentiation factor 8
publication title The structure of myostatin:follistatin 288: insights into receptor utilization and heparin binding
pubmed doi rcsb
source organism Mus musculus
total genus 62
structure length 278
sequence length 288
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3hh2C04
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3hh2C03
3.30.60.250 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3hh2C02
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 3hh2C01
1TGSI 2NU4I 1CHOI 1YU6C 1YTPA 2LEOA 1R0RI 1UZJA 1KSQA 1CT4I 1SGNI 2M5XA 2JXDA 2SGDI 1CE3A 2QQDA 1LR8A 1DS2I 2N52A 2W86A 2KMOA 2GKRI 3B4VC 1NUBA 1LR7A 1Y1BA 2SGQI 4SGBI 2NU0I 2XRCA 2QQCA 2NU3I 1UZQA 1OMTA 1TBQR 1N13A 1MT1A 1UVGA 1BUSA 1UZKA 1Y1CA 1APJA 2P6AC 4OVOA 1CGII 1PCEA 1CGJI 1LR9A 2F3CI 2OVOA 1CT0I 1SGQI 3SGQI 3SGBI 3QTLD 1Z7KB 1SGEI 1TUSA 1SGDI 1M8BA 1OVOA 1TBRR 1BMOA 2ARPF 1DS3I 1SGPI 3HH2C 1SGYI 2SGFI 1H0ZA 1PJUA 1M8CA 5JHWC 1IY6A 1OMUA 1SGRI 5DAEA 3SEKC 1CSOI 1CT2I 4HGUA 2KMPA 2KMRA 2V53A 1IW4A 2NU2I 1TURA 1OYVI 2BUSA 2GKTI 1HJAI 2NU1I 3OVOA 2B0UC 2GKVA 3TJQA 2KMQA 1UUCA 1TIHA 1HPTA 2N17A 2SGEI 1PPFI 2SGPI 1UZPA 1HDLA 1FYBA 2N71A 1UVFA 2ERWA 2WCYA 1KMAA 1AN1I 2JZMA 1IY5A 4GI3C 2JYYA 2KCXA
chains in the Genus database with same CATH superfamily
1TGSI 1PTRA 2NU4I 1CHOI 2ELIA 3R5DA 5FUWA 1YU6C 1TBOA 1YTPA 3OXLA 5CCMA 2N1AB 2GIVA 2LEOA 2RC4A 3TO9A 1R0RI 1MJ9A 1WTJA 3TO6A 1UZJA 1VDDA 2JA1A 1KSQA 5HI7A 1PTQA 2CJSC 1CT4I 1Q9BA 1RFHA 1SGNI 2WVJA 2JW6A 2JXDA 2M5XA 2YQPA 2SGDI 3UEJA 2YUUA 1CE3A 2QQDA 1LR8A 1DS2I 2N52A 3QWPA 1K7UA 2QQEA 1FY7A 1R79A 2L8EA 2W86A 4AMLA 2KMOA 2GKRI 1XBTA 1X74A 5E3RA 2E73A 3B4VC 2PQ8A 3FC3A 1NUBA 3QAHA 1X4SA 5EX0A 2V1CC 1LR7A 2ODDA 3GOXA 1W4RA 3TOBA 1Y1BA 2RIJA 2SGQI 3R5CA 4UXHA 3MEKA 3VDUA 4SGBI 2NU0I 2XRCA 2QQCA 1Y8FA 2NU3I 3R5AA 4DNCA 2QPOA 1UZQA 2J9RA 1OMTA 4UXJA 3UGIA 1KBEA 1TBQR 3D00A 1N13A 1MT1A 1UVGA 3OL0A 4JCVE 1Y1CA 9WGAA 2P6AC 4FKDA 4OVOA 5J8CA 1BUSA 1CGII 1APJA 1V1IA 2QQ0A 1WGCA 1PCEA 2A20A 2CWGA 3E59A 1CGJI 1LR9A 2F3CI 1Z2IA 2OVOA 3UGDA 1CT0I 1SGQI 5J8FA 3SGQI 2V1CA 3SGBI 3QTLD 1Z7KB 1SGEI 3OXGA 1UZKA 1TUSA 1SGDI 2ROWA 2X3TA 1M8BA 1OVOA 2B8TA 2OU2A 1TBRR 1BMOA 1FARA 2ARPF 1DS3I 1SGPI 1TBNA 1W3SA 1SGYI 3FSXA 2SGFI 3HH2C 3VDPA 3UFFA 1H0ZA 1PJUA 1UHAA 2E5RA 1M8CA 5JHWC 1IY6A 2WGCA 2ENNA 2ORVA 5FUYA 3TO7A 1OMUA 1SGRI 5DAEA 3SEKC 1KBFA 1MJAA 2J87A 1CSOI 2DIPA 3RU0A 5CCLA 1ULMA 3OXFA 1CT2I 4HGUA 3KY9A 2DB6A 3CXLA 2KMPA 2KMRA 5FUXA 1FAQA 1WKXA 3PDNA 2V53A 1IW4A 2NU2I 1TURA 3UEYA 1OYVI 2BUSA 2GKTI 1U5KA 1HJAI 3BJIA 2K9HA 2NU1I 4UXIA 1MJBA 1XA6A 1S20A 1ULKA 3OVOA 3E2IA 4E1PA 3TOAA 4A24A 1P9GA 2B0UC 2GVIA 2UZ3A 2GKVA 5EX3A 3R5BA 5FUVA 1K7TA 1WGTA 4MPIA 2OD1A 7WGAA 5HQ8A 2OZUA 1P9ZA 1ULNA 3TJQA 2ORWA 2KMQA 2Y0MA 2LB7A 1K7VA 1UUCA 2DKVA 2X52A 2CWFA 5E3PA 3UOEA 3FSYA 1TOTA 1TIHA 4L9MA 1HPTA 1HEVA 2N17A 2SGEI 2FNFX 1PPFI 2SGPI 4B6DA 1UZPA 1XX6A 1HDLA 1FYBA 3UGLA 4E1RA 2N71A 1V1HA 2W0TA 3VE5A 1UVFA 2ERWA 2WCYA 1KMAA 1AN1I 2ENZA 2CWHA 2JZMA 1NXUA 1IY5A 4WP4A 2L7XA 5E3QA 4GI3C 2JYYA 2LUYA 2VRWB 2KCXA 2UVOA
chains in the Genus database with same CATH topology
1TGSI 1PTRA 2NU4I 1CHOI 2ELIA 5FUWA 1YU6C 1TBOA 1YTPA 3OXLA 2N1AB 2LEOA 1R0RI 1UZJA 1KSQA 1VDDA 2JA1A 5HI7A 1PTQA 2CJSC 1CT4I 1RFHA 1SGNI 2WVJA 2YQPA 2JW6A 2JXDA 2M5XA 3UEJA 2SGDI 2YUUA 1CE3A 2QQDA 1LR8A 1DS2I 2N52A 3QWPA 2QQEA 1R79A 2L8EA 2W86A 2KMOA 2GKRI 1XBTA 1X74A 2E73A 3B4VC 3FC3A 1NUBA 1X4SA 5EX0A 2V1CC 1LR7A 2ODDA 3GOXA 1W4RA 1Y1BA 3VDUA 2SGQI 4UXHA 3MEKA 4SGBI 2NU0I 2XRCA 2QQCA 1Y8FA 2NU3I 1UZQA 2QPOA 2J9RA 1OMTA 4UXJA 3UGIA 1KBEA 1TBQR 3D00A 1N13A 1MT1A 1UVGA 3OL0A 4JCVE 1Y1CA 1BUSA 2P6AC 4FKDA 4OVOA 1UZKA 1APJA 1CGII 1V1IA 2QQ0A 2A20A 1PCEA 3E59A 1CGJI 1LR9A 2F3CI 2OVOA 3UGDA 1CT0I 1SGQI 3SGQI 2V1CA 3SGBI 3QTLD 1Z7KB 1SGEI 3OXGA 1TUSA 1SGDI 2ROWA 1M8BA 1OVOA 2B8TA 1TBRR 1BMOA 1FARA 2ARPF 1DS3I 1SGPI 1TBNA 1W3SA 1SGYI 3HH2C 2SGFI 5CCMA 3VDPA 3UFFA 1H0ZA 1PJUA 2E5RA 1M8CA 5JHWC 1IY6A 2ENNA 2ORVA 5FUYA 1OMUA 1SGRI 5DAEA 3SEKC 1KBFA 2J87A 1CSOI 2DIPA 3RU0A 5CCLA 3OXFA 1CT2I 4HGUA 3KY9A 2DB6A 3CXLA 2KMPA 2KMRA 5FUXA 1FAQA 3PDNA 2V53A 1IW4A 2NU2I 1TURA 3UEYA 1OYVI 2BUSA 2GKTI 1U5KA 1HJAI 3BJIA 2K9HA 2NU1I 4UXIA 1XA6A 3OVOA 4E1PA 3E2IA 4A24A 2B0UC 2GVIA 2UZ3A 2GKVA 5EX3A 5FUVA 2OD1A 5HQ8A 3TJQA 2ORWA 2KMQA 1UUCA 1TOTA 1TIHA 4L9MA 1HPTA 2N17A 2SGEI 2FNFX 1PPFI 2SGPI 4B6DA 1UZPA 1XX6A 1HDLA 1FYBA 3UGLA 4E1RA 2N71A 1V1HA 2W0TA 3VE5A 1UVFA 2ERWA 2WCYA 1KMAA 1AN1I 2ENZA 2JZMA 1IY5A 2L7XA 4GI3C 2JYYA 2LUYA 2VRWB 2KCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TGS I;  2NU4 I;  1CHO I;  1YU6 C;  1YTP A;  2LEO A;  1R0R I;  1UZJ A;  1KSQ A;  1CT4 I;  1SGN I;  2M5X A;  2JXD A;  2SGD I;  1CE3 A;  2QQD A;  1LR8 A;  1DS2 I;  2N52 A;  2W86 A;  2KMO A;  2GKR I;  3B4V C;  1NUB A;  1LR7 A;  1Y1B A;  2SGQ I;  4SGB I;  2NU0 I;  2XRC A;  2QQC A;  2NU3 I;  1UZQ A;  1OMT A;  1TBQ R;  1N13 A;  1MT1 A;  1UVG A;  1BUS A;  1UZK A;  1Y1C A;  1APJ A;  2P6A C;  4OVO A;  1CGI I;  1PCE A;  1CGJ I;  1LR9 A;  2F3C I;  2OVO A;  1CT0 I;  1SGQ I;  3SGQ I;  3SGB I;  3QTL D;  1Z7K B;  1SGE I;  1TUS A;  1SGD I;  1M8B A;  1OVO A;  1TBR R;  1BMO A;  2ARP F;  1DS3 I;  1SGP I;  3HH2 C;  1SGY I;  2SGF I;  1H0Z A;  1PJU A;  1M8C A;  5JHW C;  1IY6 A;  1OMU A;  1SGR I;  5DAE A;  3SEK C;  1CSO I;  1CT2 I;  4HGU A;  2KMP A;  2KMR A;  2V53 A;  1IW4 A;  2NU2 I;  1TUR A;  1OYV I;  2BUS A;  2GKT I;  1HJA I;  2NU1 I;  3OVO A;  2B0U C;  2GKV A;  3TJQ A;  2KMQ A;  1UUC A;  1TIH A;  1HPT A;  2N17 A;  2SGE I;  1PPF I;  2SGP I;  1UZP A;  1HDL A;  1FYB A;  2N71 A;  1UVF A;  2ERW A;  2WCY A;  1KMA A;  1AN1 I;  2JZM A;  1IY5 A;  4GI3 C;  2JYY A;  2KCX A; 
#chains in the Genus database with same CATH topology
 1TGS I;  1PTR A;  2NU4 I;  1CHO I;  2ELI A;  3R5D A;  5FUW A;  1YU6 C;  1TBO A;  1YTP A;  3OXL A;  5CCM A;  2N1A B;  2GIV A;  2LEO A;  2RC4 A;  3TO9 A;  1R0R I;  1MJ9 A;  1WTJ A;  3TO6 A;  1UZJ A;  1VDD A;  2JA1 A;  1KSQ A;  5HI7 A;  1PTQ A;  2CJS C;  1CT4 I;  1Q9B A;  1RFH A;  1SGN I;  2WVJ A;  2JW6 A;  2JXD A;  2M5X A;  2YQP A;  2SGD I;  3UEJ A;  2YUU A;  1CE3 A;  2QQD A;  1LR8 A;  1DS2 I;  2N52 A;  3QWP A;  1K7U A;  2QQE A;  1FY7 A;  1R79 A;  2L8E A;  2W86 A;  4AML A;  2KMO A;  2GKR I;  1XBT A;  1X74 A;  5E3R A;  2E73 A;  3B4V C;  2PQ8 A;  3FC3 A;  1NUB A;  3QAH A;  1X4S A;  5EX0 A;  2V1C C;  1LR7 A;  2ODD A;  3GOX A;  1W4R A;  3TOB A;  1Y1B A;  2RIJ A;  2SGQ I;  3R5C A;  4UXH A;  3MEK A;  3VDU A;  4SGB I;  2NU0 I;  2XRC A;  2QQC A;  1Y8F A;  2NU3 I;  3R5A A;  4DNC A;  2QPO A;  1UZQ A;  2J9R A;  1OMT A;  4UXJ A;  3UGI A;  1KBE A;  1TBQ R;  3D00 A;  1N13 A;  1MT1 A;  1UVG A;  3OL0 A;  4JCV E;  1Y1C A;  9WGA A;  2P6A C;  4FKD A;  4OVO A;  5J8C A;  1BUS A;  1CGI I;  1APJ A;  1V1I A;  2QQ0 A;  1WGC A;  1PCE A;  2A20 A;  2CWG A;  3E59 A;  1CGJ I;  1LR9 A;  2F3C I;  1Z2I A;  2OVO A;  3UGD A;  1CT0 I;  1SGQ I;  5J8F A;  3SGQ I;  2V1C A;  3SGB I;  3QTL D;  1Z7K B;  1SGE I;  3OXG A;  1UZK A;  1TUS A;  1SGD I;  2ROW A;  2X3T A;  1M8B A;  1OVO A;  2B8T A;  2OU2 A;  1TBR R;  1BMO A;  1FAR A;  2ARP F;  1DS3 I;  1SGP I;  1TBN A;  1W3S A;  1SGY I;  3FSX A;  2SGF I;  3HH2 C;  3VDP A;  3UFF A;  1H0Z A;  1PJU A;  1UHA A;  2E5R A;  1M8C A;  5JHW C;  1IY6 A;  2WGC A;  2ENN A;  2ORV A;  5FUY A;  3TO7 A;  1OMU A;  1SGR I;  5DAE A;  3SEK C;  1KBF A;  1MJA A;  2J87 A;  1CSO I;  2DIP A;  3RU0 A;  5CCL A;  1ULM A;  3OXF A;  1CT2 I;  4HGU A;  3KY9 A;  2DB6 A;  3CXL A;  2KMP A;  2KMR A;  5FUX A;  1FAQ A;  1WKX A;  3PDN A;  2V53 A;  1IW4 A;  2NU2 I;  1TUR A;  3UEY A;  1OYV I;  2BUS A;  2GKT I;  1U5K A;  1HJA I;  3BJI A;  2K9H A;  2NU1 I;  4UXI A;  1MJB A;  1XA6 A;  1S20 A;  1ULK A;  3OVO A;  3E2I A;  4E1P A;  3TOA A;  4A24 A;  1P9G A;  2B0U C;  2GVI A;  2UZ3 A;  2GKV A;  5EX3 A;  3R5B A;  5FUV A;  1K7T A;  1WGT A;  4MPI A;  2OD1 A;  7WGA A;  5HQ8 A;  2OZU A;  1P9Z A;  1ULN A;  3TJQ A;  2ORW A;  2KMQ A;  2Y0M A;  2LB7 A;  1K7V A;  1UUC A;  2DKV A;  2X52 A;  2CWF A;  5E3P A;  3UOE A;  3FSY A;  1TOT A;  1TIH A;  4L9M A;  1HPT A;  1HEV A;  2N17 A;  2SGE I;  2FNF X;  1PPF I;  2SGP I;  4B6D A;  1UZP A;  1XX6 A;  1HDL A;  1FYB A;  3UGL A;  4E1R A;  2N71 A;  1V1H A;  2W0T A;  3VE5 A;  1UVF A;  2ERW A;  2WCY A;  1KMA A;  1AN1 I;  2ENZ A;  2CWH A;  2JZM A;  1NXU A;  1IY5 A;  4WP4 A;  2L7X A;  5E3Q A;  4GI3 C;  2JYY A;  2LUY A;  2VRW B;  2KCX A;  2UVO A; 
#chains in the Genus database with same CATH homology
 1TGS I;  1PTR A;  2NU4 I;  1CHO I;  2ELI A;  5FUW A;  1YU6 C;  1TBO A;  1YTP A;  3OXL A;  2N1A B;  2LEO A;  1R0R I;  1UZJ A;  1KSQ A;  1VDD A;  2JA1 A;  5HI7 A;  1PTQ A;  2CJS C;  1CT4 I;  1RFH A;  1SGN I;  2WVJ A;  2YQP A;  2JW6 A;  2JXD A;  2M5X A;  3UEJ A;  2SGD I;  2YUU A;  1CE3 A;  2QQD A;  1LR8 A;  1DS2 I;  2N52 A;  3QWP A;  2QQE A;  1R79 A;  2L8E A;  2W86 A;  2KMO A;  2GKR I;  1XBT A;  1X74 A;  2E73 A;  3B4V C;  3FC3 A;  1NUB A;  1X4S A;  5EX0 A;  2V1C C;  1LR7 A;  2ODD A;  3GOX A;  1W4R A;  1Y1B A;  3VDU A;  2SGQ I;  4UXH A;  3MEK A;  4SGB I;  2NU0 I;  2XRC A;  2QQC A;  1Y8F A;  2NU3 I;  1UZQ A;  2QPO A;  2J9R A;  1OMT A;  4UXJ A;  3UGI A;  1KBE A;  1TBQ R;  3D00 A;  1N13 A;  1MT1 A;  1UVG A;  3OL0 A;  4JCV E;  1Y1C A;  1BUS A;  2P6A C;  4FKD A;  4OVO A;  1UZK A;  1APJ A;  1CGI I;  1V1I A;  2QQ0 A;  2A20 A;  1PCE A;  3E59 A;  1CGJ I;  1LR9 A;  2F3C I;  2OVO A;  3UGD A;  1CT0 I;  1SGQ I;  3SGQ I;  2V1C A;  3SGB I;  3QTL D;  1Z7K B;  1SGE I;  3OXG A;  1TUS A;  1SGD I;  2ROW A;  1M8B A;  1OVO A;  2B8T A;  1TBR R;  1BMO A;  1FAR A;  2ARP F;  1DS3 I;  1SGP I;  1TBN A;  1W3S A;  1SGY I;  3HH2 C;  2SGF I;  5CCM A;  3VDP A;  3UFF A;  1H0Z A;  1PJU A;  2E5R A;  1M8C A;  5JHW C;  1IY6 A;  2ENN A;  2ORV A;  5FUY A;  1OMU A;  1SGR I;  5DAE A;  3SEK C;  1KBF A;  2J87 A;  1CSO I;  2DIP A;  3RU0 A;  5CCL A;  3OXF A;  1CT2 I;  4HGU A;  3KY9 A;  2DB6 A;  3CXL A;  2KMP A;  2KMR A;  5FUX A;  1FAQ A;  3PDN A;  2V53 A;  1IW4 A;  2NU2 I;  1TUR A;  3UEY A;  1OYV I;  2BUS A;  2GKT I;  1U5K A;  1HJA I;  3BJI A;  2K9H A;  2NU1 I;  4UXI A;  1XA6 A;  3OVO A;  4E1P A;  3E2I A;  4A24 A;  2B0U C;  2GVI A;  2UZ3 A;  2GKV A;  5EX3 A;  5FUV A;  2OD1 A;  5HQ8 A;  3TJQ A;  2ORW A;  2KMQ A;  1UUC A;  1TOT A;  1TIH A;  4L9M A;  1HPT A;  2N17 A;  2SGE I;  2FNF X;  1PPF I;  2SGP I;  4B6D A;  1UZP A;  1XX6 A;  1HDL A;  1FYB A;  3UGL A;  4E1R A;  2N71 A;  1V1H A;  2W0T A;  3VE5 A;  1UVF A;  2ERW A;  2WCY A;  1KMA A;  1AN1 I;  2ENZ A;  2JZM A;  1IY5 A;  2L7X A;  4GI3 C;  2JYY A;  2LUY A;  2VRW B;  2KCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...