3HH2C

Crystal structure of the myostatin:follistatin 288 complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
288
structure length
278
Chain Sequence
b'GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth/differentiation factor 8
publication title The structure of myostatin:follistatin 288: insights into receptor utilization and heparin binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/cytokine
total genus 62
structure length 278
sequence length 288
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3hh2C04
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3hh2C03
3.30.60.250 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3hh2C02
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 3hh2C01
1OMUA 4HGUA 2KMOA 1HPTA 2V53A 3OVOA 1UZPA 3HH2C 2NU3I 1M8CA 2P6AC 1PPFI 1UVGA 1KMAA 2M5XA 1NUBA 2BUSA 4SGBI 2OVOA 1OVOA 2KMRA 2SGPI 2JYYA 3TJQA 5DAEA 1SGNI 2W86A 2N52A 2NU4I 1TBQR 2N71A 2GKRI 1KSQA 1DS3I 1DS2I 4GI3C 1N13A 2NU1I 2NU0I 1IY6A 1UZJA 1YU6C 5JHWC 3B4VC 2ERWA 2SGEI 2GKTI 1BMOA 1YTPA 1LR8A 2XRCA 1IW4A 1TGSI 2JXDA 1LR9A 1UZKA 2SGFI 1CSOI 1SGYI 2KMPA 3SGBI 1UUCA 2NU2I 3SEKC 1M8BA 1TBRR 1TIHA 1H0ZA 2LEOA 1CT4I 1OYVI 1PJUA 1SGQI 3SGQI 1CGII 2KCXA 1FYBA 1Z7KB 1R0RI 1TUSA 2ARPF 2QQCA 1MT1A 1OMTA 2SGDI 1HJAI 1UVFA 2KMQA 3QTLD 1UZQA 1SGRI 1LR7A 1Y1BA 1CT0I 1SGDI 1HDLA 1IY5A 1APJA 2GKVA 2QQDA 1TURA 1CGJI 1PCEA 1SGPI 1Y1CA 2JZMA 2SGQI 1BUSA 1CE3A 2N17A 1CT2I 2F3CI 1SGEI 1AN1I 1CHOI 4OVOA 2B0UC 2WCYA
chains in the Genus database with same CATH superfamily
3D00A 1OMUA 3OXFA 2CWFA 4HGUA 2KMOA 1HPTA 2PQ8A 4DNCA 1MJAA 1P9ZA 3E2IA 5HI7A 2V53A 3OVOA 5FUXA 2X52A 1Y8FA 2NU3I 2ORWA 1M8CA 2P6AC 1WTJA 1PPFI 1UVGA 2E5RA 2QQEA 2X3TA 1V1IA 1NXUA 4UXJA 3OXLA 2B8TA 5FUVA 3UEYA 2CWGA 1KMAA 2FNFX 1U5KA 2M5XA 1NUBA 3R5DA 1ULMA 1WKXA 2BUSA 2J9RA 1X74A 9WGAA 4SGBI 2L8EA 2OVOA 2VRWB 1MJ9A 2JW6A 1OVOA 2KMRA 2SGPI 3BJIA 1Q9BA 2JYYA 3CXLA 3RU0A 3TJQA 3UGDA 5DAEA 1SGNI 2JA1A 2W86A 4FKDA 2N52A 1Z2IA 2NU4I 1TBQR 2N71A 2YQPA 1K7VA 5HQ8A 2GKRI 1V1HA 1KSQA 1DS3I 1DS2I 2Y0MA 1KBEA 2CJSC 4AMLA 3PDNA 4GI3C 4A24A 5CCMA 1S20A 1N13A 2NU1I 2NU0I 5FUYA 3HH2C 1YU6C 3E59A 3TOBA 5JHWC 2OD1A 3UEJA 1IY6A 1UZJA 2ROWA 3B4VC 2GIVA 2ERWA 2SGEI 5E3RA 2GKTI 5E3PA 1BMOA 5EX0A 1YTPA 3TO6A 1LR8A 3QWPA 1RFHA 2WGCA 2XRCA 1TGSI 2JXDA 4UXHA 3VDPA 2ENNA 1LR9A 4WP4A 1IW4A 1UZKA 2SGFI 1TBOA 5E3QA 3R5CA 1CSOI 3GOXA 1KBFA 1SGYI 2KMPA 3SGBI 1UUCA 2NU2I 4B6DA 1ULKA 3FC3A 4L9MA 3SEKC 1M8BA 1TBRR 1TIHA 2J87A 1H0ZA 2RIJA 1FARA 2LEOA 3UFFA 2LB7A 3TO9A 1PTQA 1CT4I 3UGIA 3VDUA 2DIPA 4UXIA 3TOAA 7WGAA 1OYVI 1PJUA 1SGQI 1WGTA 2ELIA 1K7TA 2GVIA 1CGII 3SGQI 4E1PA 1TOTA 2KCXA 1FYBA 1Z7KB 2ENZA 1R0RI 2CWHA 3R5AA 2E73A 1TUSA 2ARPF 2QQCA 1MT1A 1OMTA 3OXGA 3MEKA 3UOEA 5J8FA 2SGDI 1XX6A 1HJAI 1UVFA 2KMQA 1X4SA 2ODDA 3QTLD 4MPIA 1VDDA 1UZQA 2W0TA 1SGRI 1LR7A 1W3SA 3TO7A 1WGCA 2OZUA 2QPOA 2UZ3A 3FSXA 1Y1BA 1CT0I 2UVOA 2YUUA 1XA6A 1SGDI 1HDLA 1IY5A 1W4RA 2A20A 2QQ0A 3UGLA 2DB6A 3KY9A 1APJA 1MJBA 2LUYA 2GKVA 2N1AB 1PTRA 2QQDA 1XBTA 1ULNA 2V1CC 3OL0A 1TURA 5EX3A 5CCLA 1K7UA 5FUWA 4E1RA 2V1CA 2L7XA 2RC4A 1FAQA 1UZPA 1CGJI 1PCEA 1SGPI 1Y1CA 3VE5A 2OU2A 2JZMA 1UHAA 2SGQI 1BUSA 3FSYA 1P9GA 1CE3A 1TBNA 3R5BA 2N17A 3QAHA 1CT2I 2F3CI 4JCVE 1SGEI 1AN1I 1CHOI 1R79A 4OVOA 2DKVA 5J8CA 2WVJA 2K9HA 2ORVA 2B0UC 1HEVA 1FY7A 2WCYA
chains in the Genus database with same CATH topology
3D00A 1OMUA 3OXFA 4HGUA 2KMOA 1HPTA 3E2IA 5HI7A 2V53A 3OVOA 5FUXA 1UZPA 1Y8FA 2NU3I 2ORWA 1M8CA 2P6AC 2E5RA 1PPFI 1UVGA 2QQEA 3HH2C 1V1IA 4UXJA 3OXLA 2B8TA 5FUVA 3UEYA 1KMAA 2FNFX 1U5KA 2M5XA 1NUBA 2BUSA 2J9RA 1X74A 4SGBI 2L8EA 2OVOA 2VRWB 3BJIA 2JW6A 1OVOA 2KMRA 2SGPI 3UGIA 2JYYA 3CXLA 3RU0A 3TJQA 3UGDA 5DAEA 1SGNI 2JA1A 2W86A 4FKDA 2N52A 2NU4I 1TBQR 2N71A 2YQPA 5HQ8A 2GKRI 1V1HA 1KSQA 1DS3I 1DS2I 1KBEA 2CJSC 3PDNA 4GI3C 4A24A 5CCMA 1N13A 2NU1I 2NU0I 5FUYA 1IY6A 1YU6C 3E59A 5JHWC 1UZJA 2OD1A 3UEJA 2ROWA 3B4VC 2ERWA 2SGEI 5EX0A 2GKTI 1BMOA 1YTPA 1LR8A 3QWPA 1RFHA 2XRCA 3VDPA 1TGSI 2JXDA 4UXHA 1IW4A 2ENNA 1LR9A 1UZKA 2SGFI 1TBOA 3GOXA 1KBFA 1CSOI 1SGYI 2KMPA 3SGBI 1UUCA 2NU2I 4B6DA 3FC3A 4L9MA 3SEKC 1M8BA 1TBRR 1TIHA 2J87A 1H0ZA 1FARA 2LEOA 3UFFA 1PTQA 1CT4I 3VDUA 2DIPA 4UXIA 1OYVI 1PJUA 1SGQI 2ELIA 2GVIA 3SGQI 4E1PA 1CGII 1TOTA 2KCXA 1FYBA 1Z7KB 2ENZA 1R0RI 2E73A 1TUSA 2ARPF 2QQCA 1MT1A 1OMTA 3OXGA 3MEKA 2SGDI 1XX6A 1HJAI 1UVFA 2KMQA 1X4SA 2ODDA 3QTLD 1VDDA 1UZQA 2W0TA 1SGRI 1LR7A 1W3SA 2QPOA 2UZ3A 1Y1BA 1CT0I 2YUUA 1XA6A 1SGDI 1HDLA 1IY5A 1W4RA 2A20A 2QQ0A 3UGLA 2DB6A 3KY9A 1APJA 2LUYA 2GKVA 2N1AB 1PTRA 2QQDA 1XBTA 2V1CC 3OL0A 5CCLA 1TURA 5EX3A 5FUWA 4E1RA 2V1CA 2L7XA 1FAQA 1CGJI 1PCEA 1SGPI 1Y1CA 3VE5A 2JZMA 2SGQI 1BUSA 1CE3A 1TBNA 2N17A 1CT2I 2F3CI 4JCVE 1SGEI 1AN1I 1CHOI 1R79A 4OVOA 2WVJA 2K9HA 2ORVA 2B0UC 2WCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMU A;  4HGU A;  2KMO A;  1HPT A;  2V53 A;  3OVO A;  1UZP A;  3HH2 C;  2NU3 I;  1M8C A;  2P6A C;  1PPF I;  1UVG A;  1KMA A;  2M5X A;  1NUB A;  2BUS A;  4SGB I;  2OVO A;  1OVO A;  2KMR A;  2SGP I;  2JYY A;  3TJQ A;  5DAE A;  1SGN I;  2W86 A;  2N52 A;  2NU4 I;  1TBQ R;  2N71 A;  2GKR I;  1KSQ A;  1DS3 I;  1DS2 I;  4GI3 C;  1N13 A;  2NU1 I;  2NU0 I;  1IY6 A;  1UZJ A;  1YU6 C;  5JHW C;  3B4V C;  2ERW A;  2SGE I;  2GKT I;  1BMO A;  1YTP A;  1LR8 A;  2XRC A;  1IW4 A;  1TGS I;  2JXD A;  1LR9 A;  1UZK A;  2SGF I;  1CSO I;  1SGY I;  2KMP A;  3SGB I;  1UUC A;  2NU2 I;  3SEK C;  1M8B A;  1TBR R;  1TIH A;  1H0Z A;  2LEO A;  1CT4 I;  1OYV I;  1PJU A;  1SGQ I;  3SGQ I;  1CGI I;  2KCX A;  1FYB A;  1Z7K B;  1R0R I;  1TUS A;  2ARP F;  2QQC A;  1MT1 A;  1OMT A;  2SGD I;  1HJA I;  1UVF A;  2KMQ A;  3QTL D;  1UZQ A;  1SGR I;  1LR7 A;  1Y1B A;  1CT0 I;  1SGD I;  1HDL A;  1IY5 A;  1APJ A;  2GKV A;  2QQD A;  1TUR A;  1CGJ I;  1PCE A;  1SGP I;  1Y1C A;  2JZM A;  2SGQ I;  1BUS A;  1CE3 A;  2N17 A;  1CT2 I;  2F3C I;  1SGE I;  1AN1 I;  1CHO I;  4OVO A;  2B0U C;  2WCY A; 
#chains in the Genus database with same CATH topology
 3D00 A;  1OMU A;  3OXF A;  2CWF A;  4HGU A;  2KMO A;  1HPT A;  2PQ8 A;  4DNC A;  1MJA A;  1P9Z A;  3E2I A;  5HI7 A;  2V53 A;  3OVO A;  5FUX A;  2X52 A;  1Y8F A;  2NU3 I;  2ORW A;  1M8C A;  2P6A C;  1WTJ A;  1PPF I;  1UVG A;  2E5R A;  2QQE A;  2X3T A;  1V1I A;  1NXU A;  4UXJ A;  3OXL A;  2B8T A;  5FUV A;  3UEY A;  2CWG A;  1KMA A;  2FNF X;  1U5K A;  2M5X A;  1NUB A;  3R5D A;  1ULM A;  1WKX A;  2BUS A;  2J9R A;  1X74 A;  9WGA A;  4SGB I;  2L8E A;  2OVO A;  2VRW B;  1MJ9 A;  2JW6 A;  1OVO A;  2KMR A;  2SGP I;  3BJI A;  1Q9B A;  2JYY A;  3CXL A;  3RU0 A;  3TJQ A;  3UGD A;  5DAE A;  1SGN I;  2JA1 A;  2W86 A;  4FKD A;  2N52 A;  1Z2I A;  2NU4 I;  1TBQ R;  2N71 A;  2YQP A;  1K7V A;  5HQ8 A;  2GKR I;  1V1H A;  1KSQ A;  1DS3 I;  1DS2 I;  2Y0M A;  1KBE A;  2CJS C;  4AML A;  3PDN A;  4GI3 C;  4A24 A;  5CCM A;  1S20 A;  1N13 A;  2NU1 I;  2NU0 I;  5FUY A;  3HH2 C;  1YU6 C;  3E59 A;  3TOB A;  5JHW C;  2OD1 A;  3UEJ A;  1IY6 A;  1UZJ A;  2ROW A;  3B4V C;  2GIV A;  2ERW A;  2SGE I;  5E3R A;  2GKT I;  5E3P A;  1BMO A;  5EX0 A;  1YTP A;  3TO6 A;  1LR8 A;  3QWP A;  1RFH A;  2WGC A;  2XRC A;  1TGS I;  2JXD A;  4UXH A;  3VDP A;  2ENN A;  1LR9 A;  4WP4 A;  1IW4 A;  1UZK A;  2SGF I;  1TBO A;  5E3Q A;  3R5C A;  1CSO I;  3GOX A;  1KBF A;  1SGY I;  2KMP A;  3SGB I;  1UUC A;  2NU2 I;  4B6D A;  1ULK A;  3FC3 A;  4L9M A;  3SEK C;  1M8B A;  1TBR R;  1TIH A;  2J87 A;  1H0Z A;  2RIJ A;  1FAR A;  2LEO A;  3UFF A;  2LB7 A;  3TO9 A;  1PTQ A;  1CT4 I;  3UGI A;  3VDU A;  2DIP A;  4UXI A;  3TOA A;  7WGA A;  1OYV I;  1PJU A;  1SGQ I;  1WGT A;  2ELI A;  1K7T A;  2GVI A;  1CGI I;  3SGQ I;  4E1P A;  1TOT A;  2KCX A;  1FYB A;  1Z7K B;  2ENZ A;  1R0R I;  2CWH A;  3R5A A;  2E73 A;  1TUS A;  2ARP F;  2QQC A;  1MT1 A;  1OMT A;  3OXG A;  3MEK A;  3UOE A;  5J8F A;  2SGD I;  1XX6 A;  1HJA I;  1UVF A;  2KMQ A;  1X4S A;  2ODD A;  3QTL D;  4MPI A;  1VDD A;  1UZQ A;  2W0T A;  1SGR I;  1LR7 A;  1W3S A;  3TO7 A;  1WGC A;  2OZU A;  2QPO A;  2UZ3 A;  3FSX A;  1Y1B A;  1CT0 I;  2UVO A;  2YUU A;  1XA6 A;  1SGD I;  1HDL A;  1IY5 A;  1W4R A;  2A20 A;  2QQ0 A;  3UGL A;  2DB6 A;  3KY9 A;  1APJ A;  1MJB A;  2LUY A;  2GKV A;  2N1A B;  1PTR A;  2QQD A;  1XBT A;  1ULN A;  2V1C C;  3OL0 A;  1TUR A;  5EX3 A;  5CCL A;  1K7U A;  5FUW A;  4E1R A;  2V1C A;  2L7X A;  2RC4 A;  1FAQ A;  1UZP A;  1CGJ I;  1PCE A;  1SGP I;  1Y1C A;  3VE5 A;  2OU2 A;  2JZM A;  1UHA A;  2SGQ I;  1BUS A;  3FSY A;  1P9G A;  1CE3 A;  1TBN A;  3R5B A;  2N17 A;  3QAH A;  1CT2 I;  2F3C I;  4JCV E;  1SGE I;  1AN1 I;  1CHO I;  1R79 A;  4OVO A;  2DKV A;  5J8C A;  2WVJ A;  2K9H A;  2ORV A;  2B0U C;  1HEV A;  1FY7 A;  2WCY A; 
#chains in the Genus database with same CATH homology
 3D00 A;  1OMU A;  3OXF A;  4HGU A;  2KMO A;  1HPT A;  3E2I A;  5HI7 A;  2V53 A;  3OVO A;  5FUX A;  1UZP A;  1Y8F A;  2NU3 I;  2ORW A;  1M8C A;  2P6A C;  2E5R A;  1PPF I;  1UVG A;  2QQE A;  3HH2 C;  1V1I A;  4UXJ A;  3OXL A;  2B8T A;  5FUV A;  3UEY A;  1KMA A;  2FNF X;  1U5K A;  2M5X A;  1NUB A;  2BUS A;  2J9R A;  1X74 A;  4SGB I;  2L8E A;  2OVO A;  2VRW B;  3BJI A;  2JW6 A;  1OVO A;  2KMR A;  2SGP I;  3UGI A;  2JYY A;  3CXL A;  3RU0 A;  3TJQ A;  3UGD A;  5DAE A;  1SGN I;  2JA1 A;  2W86 A;  4FKD A;  2N52 A;  2NU4 I;  1TBQ R;  2N71 A;  2YQP A;  5HQ8 A;  2GKR I;  1V1H A;  1KSQ A;  1DS3 I;  1DS2 I;  1KBE A;  2CJS C;  3PDN A;  4GI3 C;  4A24 A;  5CCM A;  1N13 A;  2NU1 I;  2NU0 I;  5FUY A;  1IY6 A;  1YU6 C;  3E59 A;  5JHW C;  1UZJ A;  2OD1 A;  3UEJ A;  2ROW A;  3B4V C;  2ERW A;  2SGE I;  5EX0 A;  2GKT I;  1BMO A;  1YTP A;  1LR8 A;  3QWP A;  1RFH A;  2XRC A;  3VDP A;  1TGS I;  2JXD A;  4UXH A;  1IW4 A;  2ENN A;  1LR9 A;  1UZK A;  2SGF I;  1TBO A;  3GOX A;  1KBF A;  1CSO I;  1SGY I;  2KMP A;  3SGB I;  1UUC A;  2NU2 I;  4B6D A;  3FC3 A;  4L9M A;  3SEK C;  1M8B A;  1TBR R;  1TIH A;  2J87 A;  1H0Z A;  1FAR A;  2LEO A;  3UFF A;  1PTQ A;  1CT4 I;  3VDU A;  2DIP A;  4UXI A;  1OYV I;  1PJU A;  1SGQ I;  2ELI A;  2GVI A;  3SGQ I;  4E1P A;  1CGI I;  1TOT A;  2KCX A;  1FYB A;  1Z7K B;  2ENZ A;  1R0R I;  2E73 A;  1TUS A;  2ARP F;  2QQC A;  1MT1 A;  1OMT A;  3OXG A;  3MEK A;  2SGD I;  1XX6 A;  1HJA I;  1UVF A;  2KMQ A;  1X4S A;  2ODD A;  3QTL D;  1VDD A;  1UZQ A;  2W0T A;  1SGR I;  1LR7 A;  1W3S A;  2QPO A;  2UZ3 A;  1Y1B A;  1CT0 I;  2YUU A;  1XA6 A;  1SGD I;  1HDL A;  1IY5 A;  1W4R A;  2A20 A;  2QQ0 A;  3UGL A;  2DB6 A;  3KY9 A;  1APJ A;  2LUY A;  2GKV A;  2N1A B;  1PTR A;  2QQD A;  1XBT A;  2V1C C;  3OL0 A;  5CCL A;  1TUR A;  5EX3 A;  5FUW A;  4E1R A;  2V1C A;  2L7X A;  1FAQ A;  1CGJ I;  1PCE A;  1SGP I;  1Y1C A;  3VE5 A;  2JZM A;  2SGQ I;  1BUS A;  1CE3 A;  1TBN A;  2N17 A;  1CT2 I;  2F3C I;  4JCV E;  1SGE I;  1AN1 I;  1CHO I;  1R79 A;  4OVO A;  2WVJ A;  2K9H A;  2ORV A;  2B0U C;  2WCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...