3HH2C

Crystal structure of the myostatin:follistatin 288 complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
288
structure length
278
Chain Sequence
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth/differentiation factor 8
publication title The structure of myostatin:follistatin 288: insights into receptor utilization and heparin binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/cytokine
total genus 62
structure length 278
sequence length 288
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3hh2C04
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3hh2C03
3.30.60.250 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3hh2C02
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 3hh2C01
2GKVA 1PJUA 2LEOA 1YTPA 2N52A 1TIHA 1M8CA 2SGFI 1FYBA 2SGPI 3OVOA 2GKRI 2NU2I 1TURA 2JXDA 2KMPA 1NUBA 1CT0I 1H0ZA 1CGJI 1OMUA 3TJQA 1HJAI 1CT2I 1LR7A 2WCYA 2NU3I 4SGBI 1UVGA 1LR9A 1LR8A 5DAEA 1APJA 1PPFI 1SGNI 2ARPF 2KMQA 3B4VC 1UZKA 1CSOI 5JHWC 2M5XA 2N71A 1R0RI 1KMAA 1Y1CA 2JZMA 1SGRI 4HGUA 1M8BA 2QQCA 1DS2I 1UVFA 2V53A 1UZJA 1AN1I 1SGDI 1SGYI 2XRCA 1Z7KB 1PCEA 2NU4I 1CHOI 4GI3C 1IY6A 1TGSI 1OMTA 1IW4A 1UUCA 2SGEI 1Y1BA 3SGQI 2N17A 4OVOA 2OVOA 2QQDA 1MT1A 1UZPA 2KMOA 1SGQI 2ERWA 1SGPI 1BMOA 1OYVI 1BUSA 1SGEI 1HPTA 2NU0I 3SEKC 2NU1I 1N13A 1TBRR 2B0UC 2BUSA 3QTLD 1IY5A 1UZQA 2F3CI 1DS3I 2JYYA 2KCXA 1TUSA 1CT4I 2GKTI 2SGDI 2SGQI 1TBQR 1CE3A 1OVOA 2P6AC 1YU6C 1HDLA 1CGII 3SGBI 1KSQA 2W86A 3HH2C 2KMRA
chains in the Genus database with same CATH superfamily
2YUUA 2A20A 2GKVA 7WGAA 1PJUA 2LEOA 1YTPA 5E3QA 2OZUA 4B6DA 2L8EA 2N52A 3UEYA 3MEKA 1TIHA 2CJSC 2OU2A 1M8CA 1K7TA 2CWGA 1MJ9A 1TBNA 2SGFI 5FUWA 5FUXA 2SGPI 5J8FA 1FYBA 3OVOA 3TO6A 2RC4A 1K7UA 1WKXA 1X74A 2GKRI 2NU2I 1XBTA 2GVIA 2PQ8A 5HI7A 1TURA 2JXDA 1UZKA 1W4RA 2CWHA 2DKVA 2KMPA 1MJAA 4MPIA 2ROWA 1FY7A 4DNCA 1NUBA 1WTJA 1U5KA 3FSYA 1UHAA 2X52A 2CWFA 1FARA 1CT0I 4FKDA 1H0ZA 4JCVE 1CGJI 1TBOA 1OMUA 3OXGA 4UXJA 1KBEA 3TJQA 4E1PA 1HJAI 1ULKA 1CT2I 1KBFA 1LR7A 1XX6A 3E59A 4UXIA 2WCYA 2LUYA 2NU3I 5HQ8A 2WVJA 3BJIA 1UVGA 3OXLA 1LR9A 1LR8A 4SGBI 5DAEA 2OD1A 3VDPA 5E3PA 1APJA 1PPFI 1SGNI 2ARPF 2KMQA 1TOTA 2ELIA 3B4VC 1CSOI 2JW6A 3R5DA 5FUYA 3TOBA 5JHWC 2JA1A 2K9HA 2M5XA 3R5CA 3UFFA 2N71A 1R0RI 1Z2IA 2X3TA 1KMAA 1Y1CA 2JZMA 1SGRI 2E73A 2V1CC 3E2IA 3OL0A 1M8BA 4HGUA 5CCLA 5J8CA 5EX3A 5EX0A 1W3SA 1PTQA 2QQCA 1DS2I 1RFHA 2ORVA 1UVFA 2ODDA 1V1IA 2B8TA 2V53A 1UZJA 2QQ0A 2GIVA 5CCMA 1AN1I 1ULNA 1SGDI 1SGYI 1X4SA 2L7XA 2XRCA 4A24A 1Z7KB 1PCEA 2NU4I 1CHOI 3R5BA 4GI3C 3VE5A 2QQEA 1TGSI 1IY6A 2QPOA 1OMTA 1IW4A 1XA6A 1NXUA 1UUCA 2SGEI 1VDDA 1Y1BA 2Y0MA 3RU0A 3UEJA 3SGQI 1R79A 2N17A 2RIJA 1P9GA 4AMLA 4OVOA 3UGLA 9WGAA 2OVOA 1S20A 2QQDA 2ENNA 1MT1A 1Q9BA 1UZPA 2KMOA 1SGQI 3FSXA 3FC3A 2ERWA 1WGCA 2LB7A 1SGPI 3UGDA 1BMOA 1OYVI 2V1CA 2FNFX 2J87A 2UVOA 2WGCA 3CXLA 3VDUA 3QAHA 1BUSA 1WGTA 1SGEI 1HPTA 2NU0I 2UZ3A 3SEKC 2KMRA 2NU1I 1ULMA 5E3RA 1HEVA 3QWPA 1N13A 1TBRR 1MJBA 2B0UC 2BUSA 3QTLD 3TOAA 5FUVA 1IY5A 2VRWB 2W0TA 1UZQA 3UGIA 2F3CI 3KY9A 1DS3I 2JYYA 2J9RA 2KCXA 1TUSA 1CT4I 2GKTI 3TO9A 1V1HA 3OXFA 3GOXA 4E1RA 1FAQA 2SGDI 2DB6A 2SGQI 2YQPA 3R5AA 1PTRA 2ORWA 1TBQR 1CE3A 3D00A 1OVOA 1P9ZA 1Y8FA 2P6AC 1YU6C 3TO7A 1HDLA 3PDNA 1CGII 1K7VA 2N1AB 4L9MA 4UXHA 3SGBI 3UOEA 1KSQA 2E5RA 2W86A 3HH2C 2DIPA 4WP4A 2ENZA
chains in the Genus database with same CATH topology
2YUUA 2A20A 2GKVA 1PJUA 2LEOA 1YTPA 4B6DA 2L8EA 2N52A 3UEYA 3MEKA 1TIHA 2CJSC 1M8CA 2SGFI 5FUXA 1TBNA 1FYBA 5FUWA 2SGPI 3OVOA 1X74A 2GKRI 2NU2I 1XBTA 2GVIA 5HI7A 1TURA 2JXDA 1W4RA 2KMPA 2ROWA 1NUBA 1U5KA 1FARA 1CT0I 4FKDA 1H0ZA 4JCVE 1CGJI 1TBOA 1OMUA 3OXGA 4UXJA 1KBEA 3TJQA 4E1PA 1HJAI 1KBFA 1CT2I 1LR7A 1XX6A 3E59A 4UXIA 2WCYA 2LUYA 2NU3I 5HQ8A 2WVJA 3BJIA 1UVGA 3OXLA 1LR9A 1LR8A 4SGBI 5DAEA 2OD1A 3VDPA 1APJA 1PPFI 1SGNI 2ARPF 2KMQA 1TOTA 2ELIA 3B4VC 1CSOI 2JW6A 5FUYA 1UZKA 5JHWC 2JA1A 2K9HA 2M5XA 3UFFA 2N71A 1R0RI 1KMAA 1Y1CA 2JZMA 1SGRI 2E73A 2V1CC 3E2IA 3OL0A 1M8BA 4HGUA 5CCLA 5EX3A 5EX0A 1W3SA 1PTQA 2QQCA 1DS2I 1RFHA 2ORVA 1UVFA 2ODDA 1V1IA 2B8TA 2V53A 1UZJA 2QQ0A 5CCMA 1AN1I 1SGDI 1SGYI 1X4SA 2L7XA 2XRCA 4A24A 1Z7KB 1PCEA 2NU4I 1CHOI 4GI3C 3VE5A 2QQEA 1TGSI 1IY6A 2QPOA 1OMTA 1IW4A 1XA6A 3UEJA 1UUCA 2SGEI 1VDDA 1Y1BA 3RU0A 3SGQI 1R79A 2N17A 4OVOA 3UGLA 2OVOA 2QQDA 2ENNA 1MT1A 1UZPA 2KMOA 1SGQI 3FC3A 2ERWA 1SGPI 3UGDA 1BMOA 1OYVI 2V1CA 2FNFX 2J87A 3VDUA 3CXLA 1BUSA 1SGEI 1HPTA 2NU0I 2UZ3A 3SEKC 2KMRA 2NU1I 3QWPA 1N13A 1TBRR 2B0UC 2BUSA 3QTLD 5FUVA 1IY5A 2VRWB 2W0TA 1UZQA 3UGIA 2F3CI 3KY9A 1DS3I 2JYYA 2J9RA 2KCXA 1TUSA 1CT4I 2GKTI 1V1HA 3OXFA 3GOXA 4E1RA 1FAQA 2SGDI 2DB6A 2SGQI 2YQPA 1PTRA 2ORWA 1TBQR 1CE3A 3D00A 1OVOA 1Y8FA 2P6AC 1YU6C 1HDLA 3PDNA 1CGII 4UXHA 2N1AB 4L9MA 3SGBI 1KSQA 2E5RA 2W86A 3HH2C 2DIPA 2ENZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GKV A;  1PJU A;  2LEO A;  1YTP A;  2N52 A;  1TIH A;  1M8C A;  2SGF I;  1FYB A;  2SGP I;  3OVO A;  2GKR I;  2NU2 I;  1TUR A;  2JXD A;  2KMP A;  1NUB A;  1CT0 I;  1H0Z A;  1CGJ I;  1OMU A;  3TJQ A;  1HJA I;  1CT2 I;  1LR7 A;  2WCY A;  2NU3 I;  4SGB I;  1UVG A;  1LR9 A;  1LR8 A;  5DAE A;  1APJ A;  1PPF I;  1SGN I;  2ARP F;  2KMQ A;  3B4V C;  1UZK A;  1CSO I;  5JHW C;  2M5X A;  2N71 A;  1R0R I;  1KMA A;  1Y1C A;  2JZM A;  1SGR I;  4HGU A;  1M8B A;  2QQC A;  1DS2 I;  1UVF A;  2V53 A;  1UZJ A;  1AN1 I;  1SGD I;  1SGY I;  2XRC A;  1Z7K B;  1PCE A;  2NU4 I;  1CHO I;  4GI3 C;  1IY6 A;  1TGS I;  1OMT A;  1IW4 A;  1UUC A;  2SGE I;  1Y1B A;  3SGQ I;  2N17 A;  4OVO A;  2OVO A;  2QQD A;  1MT1 A;  1UZP A;  2KMO A;  1SGQ I;  2ERW A;  1SGP I;  1BMO A;  1OYV I;  1BUS A;  1SGE I;  1HPT A;  2NU0 I;  3SEK C;  2NU1 I;  1N13 A;  1TBR R;  2B0U C;  2BUS A;  3QTL D;  1IY5 A;  1UZQ A;  2F3C I;  1DS3 I;  2JYY A;  2KCX A;  1TUS A;  1CT4 I;  2GKT I;  2SGD I;  2SGQ I;  1TBQ R;  1CE3 A;  1OVO A;  2P6A C;  1YU6 C;  1HDL A;  1CGI I;  3SGB I;  1KSQ A;  2W86 A;  3HH2 C;  2KMR A; 
#chains in the Genus database with same CATH topology
 2YUU A;  2A20 A;  2GKV A;  7WGA A;  1PJU A;  2LEO A;  1YTP A;  5E3Q A;  2OZU A;  4B6D A;  2L8E A;  2N52 A;  3UEY A;  3MEK A;  1TIH A;  2CJS C;  2OU2 A;  1M8C A;  1K7T A;  2CWG A;  1MJ9 A;  1TBN A;  2SGF I;  5FUW A;  5FUX A;  2SGP I;  5J8F A;  1FYB A;  3OVO A;  3TO6 A;  2RC4 A;  1K7U A;  1WKX A;  1X74 A;  2GKR I;  2NU2 I;  1XBT A;  2GVI A;  2PQ8 A;  5HI7 A;  1TUR A;  2JXD A;  1UZK A;  1W4R A;  2CWH A;  2DKV A;  2KMP A;  1MJA A;  4MPI A;  2ROW A;  1FY7 A;  4DNC A;  1NUB A;  1WTJ A;  1U5K A;  3FSY A;  1UHA A;  2X52 A;  2CWF A;  1FAR A;  1CT0 I;  4FKD A;  1H0Z A;  4JCV E;  1CGJ I;  1TBO A;  1OMU A;  3OXG A;  4UXJ A;  1KBE A;  3TJQ A;  4E1P A;  1HJA I;  1ULK A;  1CT2 I;  1KBF A;  1LR7 A;  1XX6 A;  3E59 A;  4UXI A;  2WCY A;  2LUY A;  2NU3 I;  5HQ8 A;  2WVJ A;  3BJI A;  1UVG A;  3OXL A;  1LR9 A;  1LR8 A;  4SGB I;  5DAE A;  2OD1 A;  3VDP A;  5E3P A;  1APJ A;  1PPF I;  1SGN I;  2ARP F;  2KMQ A;  1TOT A;  2ELI A;  3B4V C;  1CSO I;  2JW6 A;  3R5D A;  5FUY A;  3TOB A;  5JHW C;  2JA1 A;  2K9H A;  2M5X A;  3R5C A;  3UFF A;  2N71 A;  1R0R I;  1Z2I A;  2X3T A;  1KMA A;  1Y1C A;  2JZM A;  1SGR I;  2E73 A;  2V1C C;  3E2I A;  3OL0 A;  1M8B A;  4HGU A;  5CCL A;  5J8C A;  5EX3 A;  5EX0 A;  1W3S A;  1PTQ A;  2QQC A;  1DS2 I;  1RFH A;  2ORV A;  1UVF A;  2ODD A;  1V1I A;  2B8T A;  2V53 A;  1UZJ A;  2QQ0 A;  2GIV A;  5CCM A;  1AN1 I;  1ULN A;  1SGD I;  1SGY I;  1X4S A;  2L7X A;  2XRC A;  4A24 A;  1Z7K B;  1PCE A;  2NU4 I;  1CHO I;  3R5B A;  4GI3 C;  3VE5 A;  2QQE A;  1TGS I;  1IY6 A;  2QPO A;  1OMT A;  1IW4 A;  1XA6 A;  1NXU A;  1UUC A;  2SGE I;  1VDD A;  1Y1B A;  2Y0M A;  3RU0 A;  3UEJ A;  3SGQ I;  1R79 A;  2N17 A;  2RIJ A;  1P9G A;  4AML A;  4OVO A;  3UGL A;  9WGA A;  2OVO A;  1S20 A;  2QQD A;  2ENN A;  1MT1 A;  1Q9B A;  1UZP A;  2KMO A;  1SGQ I;  3FSX A;  3FC3 A;  2ERW A;  1WGC A;  2LB7 A;  1SGP I;  3UGD A;  1BMO A;  1OYV I;  2V1C A;  2FNF X;  2J87 A;  2UVO A;  2WGC A;  3CXL A;  3VDU A;  3QAH A;  1BUS A;  1WGT A;  1SGE I;  1HPT A;  2NU0 I;  2UZ3 A;  3SEK C;  2KMR A;  2NU1 I;  1ULM A;  5E3R A;  1HEV A;  3QWP A;  1N13 A;  1TBR R;  1MJB A;  2B0U C;  2BUS A;  3QTL D;  3TOA A;  5FUV A;  1IY5 A;  2VRW B;  2W0T A;  1UZQ A;  3UGI A;  2F3C I;  3KY9 A;  1DS3 I;  2JYY A;  2J9R A;  2KCX A;  1TUS A;  1CT4 I;  2GKT I;  3TO9 A;  1V1H A;  3OXF A;  3GOX A;  4E1R A;  1FAQ A;  2SGD I;  2DB6 A;  2SGQ I;  2YQP A;  3R5A A;  1PTR A;  2ORW A;  1TBQ R;  1CE3 A;  3D00 A;  1OVO A;  1P9Z A;  1Y8F A;  2P6A C;  1YU6 C;  3TO7 A;  1HDL A;  3PDN A;  1CGI I;  1K7V A;  2N1A B;  4L9M A;  4UXH A;  3SGB I;  3UOE A;  1KSQ A;  2E5R A;  2W86 A;  3HH2 C;  2DIP A;  4WP4 A;  2ENZ A; 
#chains in the Genus database with same CATH homology
 2YUU A;  2A20 A;  2GKV A;  1PJU A;  2LEO A;  1YTP A;  4B6D A;  2L8E A;  2N52 A;  3UEY A;  3MEK A;  1TIH A;  2CJS C;  1M8C A;  2SGF I;  5FUX A;  1TBN A;  1FYB A;  5FUW A;  2SGP I;  3OVO A;  1X74 A;  2GKR I;  2NU2 I;  1XBT A;  2GVI A;  5HI7 A;  1TUR A;  2JXD A;  1W4R A;  2KMP A;  2ROW A;  1NUB A;  1U5K A;  1FAR A;  1CT0 I;  4FKD A;  1H0Z A;  4JCV E;  1CGJ I;  1TBO A;  1OMU A;  3OXG A;  4UXJ A;  1KBE A;  3TJQ A;  4E1P A;  1HJA I;  1KBF A;  1CT2 I;  1LR7 A;  1XX6 A;  3E59 A;  4UXI A;  2WCY A;  2LUY A;  2NU3 I;  5HQ8 A;  2WVJ A;  3BJI A;  1UVG A;  3OXL A;  1LR9 A;  1LR8 A;  4SGB I;  5DAE A;  2OD1 A;  3VDP A;  1APJ A;  1PPF I;  1SGN I;  2ARP F;  2KMQ A;  1TOT A;  2ELI A;  3B4V C;  1CSO I;  2JW6 A;  5FUY A;  1UZK A;  5JHW C;  2JA1 A;  2K9H A;  2M5X A;  3UFF A;  2N71 A;  1R0R I;  1KMA A;  1Y1C A;  2JZM A;  1SGR I;  2E73 A;  2V1C C;  3E2I A;  3OL0 A;  1M8B A;  4HGU A;  5CCL A;  5EX3 A;  5EX0 A;  1W3S A;  1PTQ A;  2QQC A;  1DS2 I;  1RFH A;  2ORV A;  1UVF A;  2ODD A;  1V1I A;  2B8T A;  2V53 A;  1UZJ A;  2QQ0 A;  5CCM A;  1AN1 I;  1SGD I;  1SGY I;  1X4S A;  2L7X A;  2XRC A;  4A24 A;  1Z7K B;  1PCE A;  2NU4 I;  1CHO I;  4GI3 C;  3VE5 A;  2QQE A;  1TGS I;  1IY6 A;  2QPO A;  1OMT A;  1IW4 A;  1XA6 A;  3UEJ A;  1UUC A;  2SGE I;  1VDD A;  1Y1B A;  3RU0 A;  3SGQ I;  1R79 A;  2N17 A;  4OVO A;  3UGL A;  2OVO A;  2QQD A;  2ENN A;  1MT1 A;  1UZP A;  2KMO A;  1SGQ I;  3FC3 A;  2ERW A;  1SGP I;  3UGD A;  1BMO A;  1OYV I;  2V1C A;  2FNF X;  2J87 A;  3VDU A;  3CXL A;  1BUS A;  1SGE I;  1HPT A;  2NU0 I;  2UZ3 A;  3SEK C;  2KMR A;  2NU1 I;  3QWP A;  1N13 A;  1TBR R;  2B0U C;  2BUS A;  3QTL D;  5FUV A;  1IY5 A;  2VRW B;  2W0T A;  1UZQ A;  3UGI A;  2F3C I;  3KY9 A;  1DS3 I;  2JYY A;  2J9R A;  2KCX A;  1TUS A;  1CT4 I;  2GKT I;  1V1H A;  3OXF A;  3GOX A;  4E1R A;  1FAQ A;  2SGD I;  2DB6 A;  2SGQ I;  2YQP A;  1PTR A;  2ORW A;  1TBQ R;  1CE3 A;  3D00 A;  1OVO A;  1Y8F A;  2P6A C;  1YU6 C;  1HDL A;  3PDN A;  1CGI I;  4UXH A;  2N1A B;  4L9M A;  3SGB I;  1KSQ A;  2E5R A;  2W86 A;  3HH2 C;  2DIP A;  2ENZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...