3HH2C

Crystal structure of the myostatin:follistatin 288 complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
288
structure length
278
Chain Sequence
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of myostatin:follistatin 288: insights into receptor utilization and heparin binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/cytokine
molecule keywords Growth/differentiation factor 8
total genus 62
structure length 278
sequence length 288
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3hh2C04
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3hh2C03
3.30.60.250 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3hh2C02
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 3hh2C01
1CT0I 3SGQI 5DAEA 1KMAA 1OMTA 1M8CA 1TURA 2BUSA 1SGPI 1SGYI 2KCXA 1PJUA 2GKTI 3QTLD 1CSOI 2JXDA 2M5XA 4GI3C 1APJA 1KSQA 1PPFI 1UZJA 1UZQA 1IW4A 1BMOA 2ERWA 1DS2I 1TGSI 1TUSA 2SGDI 1HPTA 2JYYA 2SGPI 1CGII 1SGNI 2LEOA 2NU3I 1UVFA 1OYVI 1UZKA 2WCYA 1UUCA 2KMPA 2N71A 1Y1BA 2F3CI 1CHOI 2QQDA 1N13A 2KMOA 1NUBA 3HH2C 1HDLA 3OVOA 2N17A 1LR8A 1R0RI 1YU6C 2SGEI 2GKRI 1TBRR 2SGFI 1MT1A 4HGUA 2NU2I 3SGBI 1Y1CA 1UZPA 1SGQI 1CT2I 1UVGA 1H0ZA 1HJAI 1CGJI 2XRCA 1TIHA 1SGRI 1CT4I 3TJQA 1BUSA 1M8BA 2P6AC 2W86A 2KMRA 2QQCA 1Z7KB 3SEKC 2B0UC 1OVOA 1IY6A 2NU0I 4SGBI 1DS3I 2JZMA 5JHWC 2KMQA 1AN1I 3B4VC 1LR9A 2N52A 2OVOA 1SGDI 2V53A 1FYBA 4OVOA 1OMUA 1PCEA 2ARPF 1SGEI 1IY5A 2SGQI 1LR7A 2NU4I 1CE3A 1TBQR 2GKVA 1YTPA 2NU1I
chains in the Genus database with same CATH superfamily
1CT0I 4L9MA 3FSXA 2JW6A 3SGQI 2LUYA 4UXJA 1XA6A 5DAEA 2Y0MA 2ELIA 1KMAA 1OMTA 1K7VA 1M8CA 1TURA 1Q9BA 2BUSA 1SGPI 1SGYI 2ORWA 3BJIA 2KCXA 1PJUA 2GKTI 5HQ8A 4WP4A 5FUYA 2CWHA 1TOTA 2E73A 2GIVA 3QTLD 2L7XA 1ULNA 3UGDA 1CSOI 2JXDA 2M5XA 4GI3C 1APJA 1KSQA 1PPFI 1UZJA 1UZQA 3GOXA 1IW4A 1BMOA 2VRWB 1MJ9A 2ERWA 1DS2I 2WVJA 3VE5A 1TGSI 5HI7A 2GVIA 1TUSA 2SGDI 5EX0A 1ULMA 5J8FA 2LB7A 1HPTA 3PDNA 1Z2IA 2JYYA 2SGPI 1WTJA 1CGII 1SGNI 2LEOA 2QQEA 2NU3I 1UVFA 3UGLA 1OYVI 1WKXA 1UHAA 2WCYA 1WGCA 3E59A 3UOEA 1UZKA 3QWPA 1UUCA 2QQ0A 2K9HA 1NXUA 3E2IA 2YQPA 4UXHA 2KMPA 2N71A 1Y1BA 4B6DA 7WGAA 2RIJA 2F3CI 1CHOI 1MJAA 2QQDA 3RU0A 1N13A 2KMOA 1NUBA 1K7UA 1KBEA 3R5CA 4FKDA 5E3RA 2V1CC 1HEVA 2L8EA 3HH2C 3TO6A 1HDLA 3OVOA 3TO9A 1XX6A 2DB6A 1LR8A 2N17A 2V1CA 1R0RI 3OXGA 1FY7A 2PQ8A 3TOAA 1VDDA 1YU6C 2SGEI 5J8CA 2DIPA 2GKRI 2RC4A 1TBRR 2UVOA 2WGCA 3KY9A 1MJBA 2ORVA 1Y8FA 3FSYA 2FNFX 2SGFI 1MT1A 2DKVA 2YUUA 4HGUA 2NU2I 3SGBI 1Y1CA 2UZ3A 2ENZA 1UZPA 1PTQA 1SGQI 1CT2I 1UVGA 2QPOA 2JA1A 3UEYA 1S20A 2OZUA 1H0ZA 1HJAI 1CGJI 2XRCA 3FC3A 4DNCA 1TIHA 4UXIA 2X52A 1KBFA 3QAHA 3CXLA 1SGRI 1CT4I 1P9GA 3TJQA 1BUSA 2ODDA 1WGTA 4AMLA 3UEJA 2J9RA 1RFHA 1V1HA 4E1PA 1M8BA 2P6AC 1W4RA 2W86A 2KMRA 1TBOA 1XBTA 1P9ZA 2QQCA 3MEKA 2E5RA 4JCVE 1Z7KB 3VDPA 3TO7A 2CWGA 3SEKC 1V1IA 2A20A 1ULKA 2NU1I 5E3PA 2OU2A 4MPIA 4E1RA 3OL0A 3OXFA 5EX3A 5FUWA 5CCLA 2N1AB 1K7TA 2W0TA 9WGAA 2ROWA 2B0UC 3R5AA 1OVOA 3TOBA 3UGIA 1IY6A 3R5DA 2CWFA 1W3SA 2ENNA 1R79A 2J87A 2X3TA 3D00A 2NU0I 4SGBI 1DS3I 2JZMA 5JHWC 2B8TA 2KMQA 5CCMA 1AN1I 1FAQA 3B4VC 3VDUA 1LR9A 2N52A 2OVOA 3R5BA 3UFFA 3OXLA 1X74A 1SGDI 2V53A 1TBNA 1FYBA 4OVOA 2CJSC 1OMUA 1PCEA 2ARPF 1PTRA 1U5KA 1SGEI 5FUXA 1IY5A 2SGQI 5FUVA 1LR7A 5E3QA 2NU4I 1CE3A 1TBQR 1FARA 2GKVA 1YTPA 2OD1A 1X4SA 4A24A
chains in the Genus database with same CATH topology
1CT0I 4L9MA 2JW6A 3SGQI 2LUYA 4UXJA 1XA6A 5DAEA 2ELIA 1KMAA 1OMTA 1M8CA 1TURA 2BUSA 1SGPI 1SGYI 2ORWA 3BJIA 2KCXA 1PJUA 2GKTI 5HQ8A 5FUYA 2E73A 1TOTA 3QTLD 2L7XA 3UGDA 1CSOI 2JXDA 2M5XA 4GI3C 1APJA 1KSQA 1PPFI 1UZJA 1UZQA 3GOXA 1IW4A 1BMOA 2VRWB 2ERWA 1DS2I 2WVJA 3VE5A 1TGSI 5HI7A 2GVIA 1TUSA 2SGDI 5EX0A 3PDNA 1HPTA 4A24A 2JYYA 2SGPI 1CGII 1SGNI 2LEOA 2QQEA 2NU3I 1UVFA 3UGLA 1OYVI 1UZKA 2WCYA 3E59A 3QWPA 1UUCA 2QQ0A 2K9HA 3E2IA 2YQPA 4UXHA 2KMPA 2N71A 1Y1BA 4B6DA 2F3CI 1CHOI 2QQDA 3RU0A 1N13A 2KMOA 1NUBA 1KBEA 4FKDA 2V1CC 2L8EA 3HH2C 1HDLA 3OVOA 1XX6A 2DB6A 1LR8A 2N17A 2V1CA 1R0RI 3OXGA 1VDDA 1YU6C 2SGEI 2DIPA 2GKRI 1TBRR 3KY9A 2ORVA 1Y8FA 2FNFX 2SGFI 1MT1A 2YUUA 4HGUA 2NU2I 3SGBI 1Y1CA 2UZ3A 2ENZA 1UZPA 1PTQA 1SGQI 1CT2I 1UVGA 2QPOA 2JA1A 3UEYA 1H0ZA 1HJAI 1CGJI 2XRCA 3FC3A 1TIHA 4UXIA 1KBFA 3CXLA 1SGRI 1CT4I 3TJQA 1BUSA 2ODDA 3UEJA 2J9RA 1RFHA 1V1HA 4E1PA 1M8BA 2P6AC 1W4RA 2W86A 2KMRA 1TBOA 1XBTA 2QQCA 3MEKA 4JCVE 2E5RA 1Z7KB 3VDPA 3SEKC 2A20A 1V1IA 2NU1I 4E1RA 3OL0A 3OXFA 5EX3A 5FUWA 5CCLA 2N1AB 2W0TA 2ROWA 2B0UC 3UGIA 1OVOA 1IY6A 1W3SA 2ENNA 1R79A 2J87A 3D00A 2NU0I 4SGBI 1DS3I 2JZMA 5JHWC 2B8TA 2KMQA 5CCMA 1AN1I 1FAQA 3B4VC 3VDUA 1LR9A 2N52A 2OVOA 3UFFA 3OXLA 1X74A 1SGDI 2V53A 1TBNA 1FYBA 4OVOA 2CJSC 1OMUA 1PCEA 2ARPF 1PTRA 1U5KA 1SGEI 5FUXA 1IY5A 2SGQI 5FUVA 1LR7A 2NU4I 1CE3A 1TBQR 1FARA 2GKVA 1YTPA 2OD1A 1X4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CT0 I;  3SGQ I;  5DAE A;  1KMA A;  1OMT A;  1M8C A;  1TUR A;  2BUS A;  1SGP I;  1SGY I;  2KCX A;  1PJU A;  2GKT I;  3QTL D;  1CSO I;  2JXD A;  2M5X A;  4GI3 C;  1APJ A;  1KSQ A;  1PPF I;  1UZJ A;  1UZQ A;  1IW4 A;  1BMO A;  2ERW A;  1DS2 I;  1TGS I;  1TUS A;  2SGD I;  1HPT A;  2JYY A;  2SGP I;  1CGI I;  1SGN I;  2LEO A;  2NU3 I;  1UVF A;  1OYV I;  1UZK A;  2WCY A;  1UUC A;  2KMP A;  2N71 A;  1Y1B A;  2F3C I;  1CHO I;  2QQD A;  1N13 A;  2KMO A;  1NUB A;  3HH2 C;  1HDL A;  3OVO A;  2N17 A;  1LR8 A;  1R0R I;  1YU6 C;  2SGE I;  2GKR I;  1TBR R;  2SGF I;  1MT1 A;  4HGU A;  2NU2 I;  3SGB I;  1Y1C A;  1UZP A;  1SGQ I;  1CT2 I;  1UVG A;  1H0Z A;  1HJA I;  1CGJ I;  2XRC A;  1TIH A;  1SGR I;  1CT4 I;  3TJQ A;  1BUS A;  1M8B A;  2P6A C;  2W86 A;  2KMR A;  2QQC A;  1Z7K B;  3SEK C;  2B0U C;  1OVO A;  1IY6 A;  2NU0 I;  4SGB I;  1DS3 I;  2JZM A;  5JHW C;  2KMQ A;  1AN1 I;  3B4V C;  1LR9 A;  2N52 A;  2OVO A;  1SGD I;  2V53 A;  1FYB A;  4OVO A;  1OMU A;  1PCE A;  2ARP F;  1SGE I;  1IY5 A;  2SGQ I;  1LR7 A;  2NU4 I;  1CE3 A;  1TBQ R;  2GKV A;  1YTP A;  2NU1 I; 
#chains in the Genus database with same CATH topology
 1CT0 I;  4L9M A;  3FSX A;  2JW6 A;  3SGQ I;  2LUY A;  4UXJ A;  1XA6 A;  5DAE A;  2Y0M A;  2ELI A;  1KMA A;  1OMT A;  1K7V A;  1M8C A;  1TUR A;  1Q9B A;  2BUS A;  1SGP I;  1SGY I;  2ORW A;  3BJI A;  2KCX A;  1PJU A;  2GKT I;  5HQ8 A;  4WP4 A;  5FUY A;  2CWH A;  1TOT A;  2E73 A;  2GIV A;  3QTL D;  2L7X A;  1ULN A;  3UGD A;  1CSO I;  2JXD A;  2M5X A;  4GI3 C;  1APJ A;  1KSQ A;  1PPF I;  1UZJ A;  1UZQ A;  3GOX A;  1IW4 A;  1BMO A;  2VRW B;  1MJ9 A;  2ERW A;  1DS2 I;  2WVJ A;  3VE5 A;  1TGS I;  5HI7 A;  2GVI A;  1TUS A;  2SGD I;  5EX0 A;  1ULM A;  5J8F A;  2LB7 A;  1HPT A;  3PDN A;  1Z2I A;  2JYY A;  2SGP I;  1WTJ A;  1CGI I;  1SGN I;  2LEO A;  2QQE A;  2NU3 I;  1UVF A;  3UGL A;  1OYV I;  1WKX A;  1UHA A;  2WCY A;  1WGC A;  3E59 A;  3UOE A;  1UZK A;  3QWP A;  1UUC A;  2QQ0 A;  2K9H A;  1NXU A;  3E2I A;  2YQP A;  4UXH A;  2KMP A;  2N71 A;  1Y1B A;  4B6D A;  7WGA A;  2RIJ A;  2F3C I;  1CHO I;  1MJA A;  2QQD A;  3RU0 A;  1N13 A;  2KMO A;  1NUB A;  1K7U A;  1KBE A;  3R5C A;  4FKD A;  5E3R A;  2V1C C;  1HEV A;  2L8E A;  3HH2 C;  3TO6 A;  1HDL A;  3OVO A;  3TO9 A;  1XX6 A;  2DB6 A;  1LR8 A;  2N17 A;  2V1C A;  1R0R I;  3OXG A;  1FY7 A;  2PQ8 A;  3TOA A;  1VDD A;  1YU6 C;  2SGE I;  5J8C A;  2DIP A;  2GKR I;  2RC4 A;  1TBR R;  2UVO A;  2WGC A;  3KY9 A;  1MJB A;  2ORV A;  1Y8F A;  3FSY A;  2FNF X;  2SGF I;  1MT1 A;  2DKV A;  2YUU A;  4HGU A;  2NU2 I;  3SGB I;  1Y1C A;  2UZ3 A;  2ENZ A;  1UZP A;  1PTQ A;  1SGQ I;  1CT2 I;  1UVG A;  2QPO A;  2JA1 A;  3UEY A;  1S20 A;  2OZU A;  1H0Z A;  1HJA I;  1CGJ I;  2XRC A;  3FC3 A;  4DNC A;  1TIH A;  4UXI A;  2X52 A;  1KBF A;  3QAH A;  3CXL A;  1SGR I;  1CT4 I;  1P9G A;  3TJQ A;  1BUS A;  2ODD A;  1WGT A;  4AML A;  3UEJ A;  2J9R A;  1RFH A;  1V1H A;  4E1P A;  1M8B A;  2P6A C;  1W4R A;  2W86 A;  2KMR A;  1TBO A;  1XBT A;  1P9Z A;  2QQC A;  3MEK A;  2E5R A;  4JCV E;  1Z7K B;  3VDP A;  3TO7 A;  2CWG A;  3SEK C;  1V1I A;  2A20 A;  1ULK A;  2NU1 I;  5E3P A;  2OU2 A;  4MPI A;  4E1R A;  3OL0 A;  3OXF A;  5EX3 A;  5FUW A;  5CCL A;  2N1A B;  1K7T A;  2W0T A;  9WGA A;  2ROW A;  2B0U C;  3R5A A;  1OVO A;  3TOB A;  3UGI A;  1IY6 A;  3R5D A;  2CWF A;  1W3S A;  2ENN A;  1R79 A;  2J87 A;  2X3T A;  3D00 A;  2NU0 I;  4SGB I;  1DS3 I;  2JZM A;  5JHW C;  2B8T A;  2KMQ A;  5CCM A;  1AN1 I;  1FAQ A;  3B4V C;  3VDU A;  1LR9 A;  2N52 A;  2OVO A;  3R5B A;  3UFF A;  3OXL A;  1X74 A;  1SGD I;  2V53 A;  1TBN A;  1FYB A;  4OVO A;  2CJS C;  1OMU A;  1PCE A;  2ARP F;  1PTR A;  1U5K A;  1SGE I;  5FUX A;  1IY5 A;  2SGQ I;  5FUV A;  1LR7 A;  5E3Q A;  2NU4 I;  1CE3 A;  1TBQ R;  1FAR A;  2GKV A;  1YTP A;  2OD1 A;  1X4S A;  4A24 A; 
#chains in the Genus database with same CATH homology
 1CT0 I;  4L9M A;  2JW6 A;  3SGQ I;  2LUY A;  4UXJ A;  1XA6 A;  5DAE A;  2ELI A;  1KMA A;  1OMT A;  1M8C A;  1TUR A;  2BUS A;  1SGP I;  1SGY I;  2ORW A;  3BJI A;  2KCX A;  1PJU A;  2GKT I;  5HQ8 A;  5FUY A;  2E73 A;  1TOT A;  3QTL D;  2L7X A;  3UGD A;  1CSO I;  2JXD A;  2M5X A;  4GI3 C;  1APJ A;  1KSQ A;  1PPF I;  1UZJ A;  1UZQ A;  3GOX A;  1IW4 A;  1BMO A;  2VRW B;  2ERW A;  1DS2 I;  2WVJ A;  3VE5 A;  1TGS I;  5HI7 A;  2GVI A;  1TUS A;  2SGD I;  5EX0 A;  3PDN A;  1HPT A;  4A24 A;  2JYY A;  2SGP I;  1CGI I;  1SGN I;  2LEO A;  2QQE A;  2NU3 I;  1UVF A;  3UGL A;  1OYV I;  1UZK A;  2WCY A;  3E59 A;  3QWP A;  1UUC A;  2QQ0 A;  2K9H A;  3E2I A;  2YQP A;  4UXH A;  2KMP A;  2N71 A;  1Y1B A;  4B6D A;  2F3C I;  1CHO I;  2QQD A;  3RU0 A;  1N13 A;  2KMO A;  1NUB A;  1KBE A;  4FKD A;  2V1C C;  2L8E A;  3HH2 C;  1HDL A;  3OVO A;  1XX6 A;  2DB6 A;  1LR8 A;  2N17 A;  2V1C A;  1R0R I;  3OXG A;  1VDD A;  1YU6 C;  2SGE I;  2DIP A;  2GKR I;  1TBR R;  3KY9 A;  2ORV A;  1Y8F A;  2FNF X;  2SGF I;  1MT1 A;  2YUU A;  4HGU A;  2NU2 I;  3SGB I;  1Y1C A;  2UZ3 A;  2ENZ A;  1UZP A;  1PTQ A;  1SGQ I;  1CT2 I;  1UVG A;  2QPO A;  2JA1 A;  3UEY A;  1H0Z A;  1HJA I;  1CGJ I;  2XRC A;  3FC3 A;  1TIH A;  4UXI A;  1KBF A;  3CXL A;  1SGR I;  1CT4 I;  3TJQ A;  1BUS A;  2ODD A;  3UEJ A;  2J9R A;  1RFH A;  1V1H A;  4E1P A;  1M8B A;  2P6A C;  1W4R A;  2W86 A;  2KMR A;  1TBO A;  1XBT A;  2QQC A;  3MEK A;  4JCV E;  2E5R A;  1Z7K B;  3VDP A;  3SEK C;  2A20 A;  1V1I A;  2NU1 I;  4E1R A;  3OL0 A;  3OXF A;  5EX3 A;  5FUW A;  5CCL A;  2N1A B;  2W0T A;  2ROW A;  2B0U C;  3UGI A;  1OVO A;  1IY6 A;  1W3S A;  2ENN A;  1R79 A;  2J87 A;  3D00 A;  2NU0 I;  4SGB I;  1DS3 I;  2JZM A;  5JHW C;  2B8T A;  2KMQ A;  5CCM A;  1AN1 I;  1FAQ A;  3B4V C;  3VDU A;  1LR9 A;  2N52 A;  2OVO A;  3UFF A;  3OXL A;  1X74 A;  1SGD I;  2V53 A;  1TBN A;  1FYB A;  4OVO A;  2CJS C;  1OMU A;  1PCE A;  2ARP F;  1PTR A;  1U5K A;  1SGE I;  5FUX A;  1IY5 A;  2SGQ I;  5FUV A;  1LR7 A;  2NU4 I;  1CE3 A;  1TBQ R;  1FAR A;  2GKV A;  1YTP A;  2OD1 A;  1X4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...