2N1AB

Docked structure between sumo1 and zz-domain from cbp
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
53
structure length
53
Chain Sequence
GQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small ubiquitin-related modifier 1
publication title Structural Analysis of a Complex between Small Ubiquitin-like Modifier 1 (SUMO1) and the ZZ Domain of CREB-binding Protein (CBP/p300) Reveals a New Interaction Surface on SUMO.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 53
sequence length 53
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.90 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2n1aB00
2DIPA 2N1AB 2E5RA 1TOTA
chains in the Genus database with same CATH superfamily
1WKXA 2DIPA 1YTPA 3PDNA 1TURA 3OVOA 1CE3A 1M8CA 1CT2I 2GVIA 1MT1A 1TBRR 5FUXA 2K9HA 2QPOA 4SGBI 1SGPI 1X4SA 2XRCA 1Y8FA 2ORVA 1PTRA 1SGRI 1Z7KB 2E5RA 1PJUA 3FSYA 2ARPF 3TO6A 2A20A 1K7UA 2LB7A 4WP4A 2OD1A 1K7TA 1R79A 1UHAA 2QQDA 1TOTA 1FARA 1Y1CA 7WGAA 2SGQI 2FNFX 1W4RA 2E73A 2GKTI 2JYYA 2ORWA 3MEKA 3OL0A 3QTLD 1SGQI 3UEYA 1VDDA 2P6AC 1IY5A 2V1CC 1XBTA 1MJAA 1ULMA 2KMOA 2OU2A 5E3RA 4FKDA 1TBNA 1XX6A 1BUSA 1KBEA 2LEOA 1M8BA 1WGCA 1P9ZA 4JCVE 4MPIA 5J8CA 1IY6A 1Z2IA 1CGII 1OMUA 5EX3A 2L7XA 1RFHA 1SGDI 5DAEA 3TOAA 4UXHA 4E1RA 1KBFA 1KMAA 2SGFI 2SGDI 2NU1I 2VRWB 2WCYA 2CWFA 3HH2C 3UEJA 3OXFA 1CHOI 1TBOA 2CJSC 3R5CA 2KMPA 2NU4I 3R5BA 1UUCA 1LR9A 2B8TA 2DKVA 3QAHA 2ENZA 2ENNA 2ROWA 2SGPI 1SGEI 2RIJA 2UZ3A 3CXLA 2B0UC 2WVJA 9WGAA 3OXGA 3UGDA 5E3QA 1PTQA 2UVOA 1LR8A 1K7VA 2L8EA 1OVOA 1W3SA 1Y1BA 2X52A 3R5AA 1ULNA 2ELIA 2JW6A 2JXDA 3KY9A 5HQ8A 5EX0A 3E2IA 1OMTA 1U5KA 2J87A 3SGBI 2LUYA 2NU0I 3TO9A 1HDLA 2OZUA 4GI3C 1FY7A 5CCMA 2F3CI 5HI7A 2RC4A 4OVOA 1TUSA 2M5XA 3GOXA 2NU2I 4DNCA 1TBQR 5FUVA 1FYBA 1XA6A 1Q9BA 2DB6A 1ULKA 1WGTA 2V1CA 3R5DA 1UVFA 3TO7A 1HJAI 3RU0A 3VE5A 2WGCA 3TJQA 1PCEA 2PQ8A 4B6DA 2JA1A 2KMRA 2GKVA 5CCLA 5FUYA 2W0TA 3D00A 1CT4I 1V1IA 1HEVA 2KCXA 1P9GA 1N13A 2JZMA 2N71A 2X3TA 1SGNI 2YUUA 5FUWA 1CSOI 2YQPA 3VDUA 3TOBA 3FC3A 3BJIA 3OXLA 3QWPA 4L9MA 4E1PA 1NUBA 2CWGA 1H0ZA 1NXUA 1TGSI 4UXJA 1DS3I 4AMLA 2N17A 1DS2I 1X74A 4A24A 1AN1I 5JHWC 3VDPA 4HGUA 3E59A 3B4VC 5E3PA 2QQ0A 3UGLA 1OYVI 2CWHA 3SEKC 2OVOA 3UFFA 3SGQI 1UVGA 1BMOA 1CT0I 1S20A 1HPTA 2QQCA 2KMQA 1MJBA 2QQEA 2V53A 2Y0MA 5J8FA 1FAQA 2SGEI 2GIVA 2BUSA 2J9RA 1IW4A 1WTJA 1R0RI 2NU3I 1V1HA 3FSXA 1CGJI 1MJ9A 2ODDA 2ERWA 1LR7A 1SGYI 3UOEA 3UGIA 4UXIA 2N52A 1PPFI 1TIHA 2N1AB 2GKRI 1YU6C
chains in the Genus database with same CATH topology
2DIPA 1YTPA 3PDNA 1TURA 3OVOA 1CE3A 1M8CA 1CT2I 2GVIA 1MT1A 1TBRR 5FUXA 2K9HA 2QPOA 4SGBI 1SGPI 1X4SA 2XRCA 1Y8FA 2ORVA 1PTRA 1SGRI 1Z7KB 2E5RA 1PJUA 2ARPF 2A20A 2OD1A 1R79A 2QQDA 1TOTA 1FARA 1Y1CA 2SGQI 2FNFX 1W4RA 2E73A 2GKTI 2JYYA 2ORWA 3MEKA 3OL0A 3QTLD 1SGQI 3UEYA 1VDDA 2P6AC 1IY5A 2V1CC 1XBTA 2KMOA 4FKDA 1TBNA 1XX6A 1BUSA 1KBEA 2LEOA 1M8BA 4JCVE 1IY6A 1CGII 1OMUA 5EX3A 2L7XA 1RFHA 1SGDI 5DAEA 4E1RA 4UXHA 1KBFA 1KMAA 2SGFI 2SGDI 2NU1I 2VRWB 2WCYA 3HH2C 3UEJA 3OXFA 1CHOI 1TBOA 2CJSC 2KMPA 2NU4I 1UUCA 1LR9A 2B8TA 2ENZA 2ENNA 2ROWA 2SGPI 1SGEI 2UZ3A 3CXLA 2B0UC 2WVJA 3OXGA 3UGDA 1PTQA 1LR8A 2L8EA 1OVOA 1W3SA 1Y1BA 2ELIA 2JW6A 2JXDA 3KY9A 5HQ8A 5EX0A 3E2IA 1OMTA 1U5KA 2J87A 3SGBI 2LUYA 2NU0I 1HDLA 4GI3C 5CCMA 2F3CI 5HI7A 4OVOA 3GOXA 1TUSA 2M5XA 2NU2I 1TBQR 5FUVA 1FYBA 1XA6A 2DB6A 2V1CA 1UVFA 3VE5A 1HJAI 3RU0A 3TJQA 1PCEA 4B6DA 2JA1A 2KMRA 2GKVA 5CCLA 5FUYA 2W0TA 3D00A 1CT4I 1V1IA 2KCXA 1N13A 2JZMA 2N71A 2YUUA 1SGNI 5FUWA 1CSOI 2YQPA 3VDUA 3FC3A 3BJIA 3OXLA 3QWPA 4L9MA 4E1PA 1NUBA 1H0ZA 1TGSI 4UXJA 1DS3I 2N17A 1DS2I 1X74A 4A24A 1AN1I 5JHWC 3VDPA 4HGUA 3E59A 3B4VC 2QQ0A 3UGLA 1OYVI 3UFFA 3SEKC 2OVOA 3SGQI 1UVGA 1BMOA 1CT0I 1HPTA 2QQCA 2KMQA 2QQEA 2V53A 1FAQA 2SGEI 2BUSA 2J9RA 1IW4A 1R0RI 2NU3I 1V1HA 1CGJI 2ODDA 2ERWA 1LR7A 1SGYI 3UGIA 4UXIA 2N52A 1PPFI 1TIHA 2N1AB 2GKRI 1YU6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIP A;  2N1A B;  2E5R A;  1TOT A; 
#chains in the Genus database with same CATH topology
 1WKX A;  2DIP A;  1YTP A;  3PDN A;  1TUR A;  3OVO A;  1CE3 A;  1M8C A;  1CT2 I;  2GVI A;  1MT1 A;  1TBR R;  5FUX A;  2K9H A;  2QPO A;  4SGB I;  1SGP I;  1X4S A;  2XRC A;  1Y8F A;  2ORV A;  1PTR A;  1SGR I;  1Z7K B;  2E5R A;  1PJU A;  3FSY A;  2ARP F;  3TO6 A;  2A20 A;  1K7U A;  2LB7 A;  4WP4 A;  2OD1 A;  1K7T A;  1R79 A;  1UHA A;  2QQD A;  1TOT A;  1FAR A;  1Y1C A;  7WGA A;  2SGQ I;  2FNF X;  1W4R A;  2E73 A;  2GKT I;  2JYY A;  2ORW A;  3MEK A;  3OL0 A;  3QTL D;  1SGQ I;  3UEY A;  1VDD A;  2P6A C;  1IY5 A;  2V1C C;  1XBT A;  1MJA A;  1ULM A;  2KMO A;  2OU2 A;  5E3R A;  4FKD A;  1TBN A;  1XX6 A;  1BUS A;  1KBE A;  2LEO A;  1M8B A;  1WGC A;  1P9Z A;  4JCV E;  4MPI A;  5J8C A;  1IY6 A;  1Z2I A;  1CGI I;  1OMU A;  5EX3 A;  2L7X A;  1RFH A;  1SGD I;  5DAE A;  3TOA A;  4UXH A;  4E1R A;  1KBF A;  1KMA A;  2SGF I;  2SGD I;  2NU1 I;  2VRW B;  2WCY A;  2CWF A;  3HH2 C;  3UEJ A;  3OXF A;  1CHO I;  1TBO A;  2CJS C;  3R5C A;  2KMP A;  2NU4 I;  3R5B A;  1UUC A;  1LR9 A;  2B8T A;  2DKV A;  3QAH A;  2ENZ A;  2ENN A;  2ROW A;  2SGP I;  1SGE I;  2RIJ A;  2UZ3 A;  3CXL A;  2B0U C;  2WVJ A;  9WGA A;  3OXG A;  3UGD A;  5E3Q A;  1PTQ A;  2UVO A;  1LR8 A;  1K7V A;  2L8E A;  1OVO A;  1W3S A;  1Y1B A;  2X52 A;  3R5A A;  1ULN A;  2ELI A;  2JW6 A;  2JXD A;  3KY9 A;  5HQ8 A;  5EX0 A;  3E2I A;  1OMT A;  1U5K A;  2J87 A;  3SGB I;  2LUY A;  2NU0 I;  3TO9 A;  1HDL A;  2OZU A;  4GI3 C;  1FY7 A;  5CCM A;  2F3C I;  5HI7 A;  2RC4 A;  4OVO A;  1TUS A;  2M5X A;  3GOX A;  2NU2 I;  4DNC A;  1TBQ R;  5FUV A;  1FYB A;  1XA6 A;  1Q9B A;  2DB6 A;  1ULK A;  1WGT A;  2V1C A;  3R5D A;  1UVF A;  3TO7 A;  1HJA I;  3RU0 A;  3VE5 A;  2WGC A;  3TJQ A;  1PCE A;  2PQ8 A;  4B6D A;  2JA1 A;  2KMR A;  2GKV A;  5CCL A;  5FUY A;  2W0T A;  3D00 A;  1CT4 I;  1V1I A;  1HEV A;  2KCX A;  1P9G A;  1N13 A;  2JZM A;  2N71 A;  2X3T A;  1SGN I;  2YUU A;  5FUW A;  1CSO I;  2YQP A;  3VDU A;  3TOB A;  3FC3 A;  3BJI A;  3OXL A;  3QWP A;  4L9M A;  4E1P A;  1NUB A;  2CWG A;  1H0Z A;  1NXU A;  1TGS I;  4UXJ A;  1DS3 I;  4AML A;  2N17 A;  1DS2 I;  1X74 A;  4A24 A;  1AN1 I;  5JHW C;  3VDP A;  4HGU A;  3E59 A;  3B4V C;  5E3P A;  2QQ0 A;  3UGL A;  1OYV I;  2CWH A;  3SEK C;  2OVO A;  3UFF A;  3SGQ I;  1UVG A;  1BMO A;  1CT0 I;  1S20 A;  1HPT A;  2QQC A;  2KMQ A;  1MJB A;  2QQE A;  2V53 A;  2Y0M A;  5J8F A;  1FAQ A;  2SGE I;  2GIV A;  2BUS A;  2J9R A;  1IW4 A;  1WTJ A;  1R0R I;  2NU3 I;  1V1H A;  3FSX A;  1CGJ I;  1MJ9 A;  2ODD A;  2ERW A;  1LR7 A;  1SGY I;  3UOE A;  3UGI A;  4UXI A;  2N52 A;  1PPF I;  1TIH A;  2N1A B;  2GKR I;  1YU6 C; 
#chains in the Genus database with same CATH homology
 2DIP A;  1YTP A;  3PDN A;  1TUR A;  3OVO A;  1CE3 A;  1M8C A;  1CT2 I;  2GVI A;  1MT1 A;  1TBR R;  5FUX A;  2K9H A;  2QPO A;  4SGB I;  1SGP I;  1X4S A;  2XRC A;  1Y8F A;  2ORV A;  1PTR A;  1SGR I;  1Z7K B;  2E5R A;  1PJU A;  2ARP F;  2A20 A;  2OD1 A;  1R79 A;  2QQD A;  1TOT A;  1FAR A;  1Y1C A;  2SGQ I;  2FNF X;  1W4R A;  2E73 A;  2GKT I;  2JYY A;  2ORW A;  3MEK A;  3OL0 A;  3QTL D;  1SGQ I;  3UEY A;  1VDD A;  2P6A C;  1IY5 A;  2V1C C;  1XBT A;  2KMO A;  4FKD A;  1TBN A;  1XX6 A;  1BUS A;  1KBE A;  2LEO A;  1M8B A;  4JCV E;  1IY6 A;  1CGI I;  1OMU A;  5EX3 A;  2L7X A;  1RFH A;  1SGD I;  5DAE A;  4E1R A;  4UXH A;  1KBF A;  1KMA A;  2SGF I;  2SGD I;  2NU1 I;  2VRW B;  2WCY A;  3HH2 C;  3UEJ A;  3OXF A;  1CHO I;  1TBO A;  2CJS C;  2KMP A;  2NU4 I;  1UUC A;  1LR9 A;  2B8T A;  2ENZ A;  2ENN A;  2ROW A;  2SGP I;  1SGE I;  2UZ3 A;  3CXL A;  2B0U C;  2WVJ A;  3OXG A;  3UGD A;  1PTQ A;  1LR8 A;  2L8E A;  1OVO A;  1W3S A;  1Y1B A;  2ELI A;  2JW6 A;  2JXD A;  3KY9 A;  5HQ8 A;  5EX0 A;  3E2I A;  1OMT A;  1U5K A;  2J87 A;  3SGB I;  2LUY A;  2NU0 I;  1HDL A;  4GI3 C;  5CCM A;  2F3C I;  5HI7 A;  4OVO A;  3GOX A;  1TUS A;  2M5X A;  2NU2 I;  1TBQ R;  5FUV A;  1FYB A;  1XA6 A;  2DB6 A;  2V1C A;  1UVF A;  3VE5 A;  1HJA I;  3RU0 A;  3TJQ A;  1PCE A;  4B6D A;  2JA1 A;  2KMR A;  2GKV A;  5CCL A;  5FUY A;  2W0T A;  3D00 A;  1CT4 I;  1V1I A;  2KCX A;  1N13 A;  2JZM A;  2N71 A;  2YUU A;  1SGN I;  5FUW A;  1CSO I;  2YQP A;  3VDU A;  3FC3 A;  3BJI A;  3OXL A;  3QWP A;  4L9M A;  4E1P A;  1NUB A;  1H0Z A;  1TGS I;  4UXJ A;  1DS3 I;  2N17 A;  1DS2 I;  1X74 A;  4A24 A;  1AN1 I;  5JHW C;  3VDP A;  4HGU A;  3E59 A;  3B4V C;  2QQ0 A;  3UGL A;  1OYV I;  3UFF A;  3SEK C;  2OVO A;  3SGQ I;  1UVG A;  1BMO A;  1CT0 I;  1HPT A;  2QQC A;  2KMQ A;  2QQE A;  2V53 A;  1FAQ A;  2SGE I;  2BUS A;  2J9R A;  1IW4 A;  1R0R I;  2NU3 I;  1V1H A;  1CGJ I;  2ODD A;  2ERW A;  1LR7 A;  1SGY I;  3UGI A;  4UXI A;  2N52 A;  1PPF I;  1TIH A;  2N1A B;  2GKR I;  1YU6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...