2N1AB

Docked structure between sumo1 and zz-domain from cbp
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
53
structure length
53
Chain Sequence
b'GQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small ubiquitin-related modifier 1
publication title Structural Analysis of a Complex between Small Ubiquitin-like Modifier 1 (SUMO1) and the ZZ Domain of CREB-binding Protein (CBP/p300) Reveals a New Interaction Surface on SUMO.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 53
sequence length 53
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.90 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2n1aB00
2N1AB 1TOTA 2DIPA 2E5RA
chains in the Genus database with same CATH superfamily
2NU1I 1SGQI 1OMTA 1OYVI 3MEKA 1MJAA 2N17A 3QAHA 2QQEA 1HJAI 2GKVA 3HH2C 3E2IA 2ERWA 1FARA 3OXFA 4UXHA 3VE5A 2KMQA 3TOAA 3UGDA 1V1HA 1NUBA 2V1CC 2N71A 1Y1CA 3QWPA 5EX3A 1TBRR 1W4RA 1YU6C 2QQ0A 1P9ZA 2V53A 3PDNA 1SGNI 1TBNA 1XBTA 2RIJA 3FC3A 1Z2IA 5FUWA 3GOXA 1Y1BA 2ENNA 5EX0A 3UGIA 5E3QA 1TBOA 1KBFA 2X3TA 3B4VC 1UVFA 1XX6A 1NXUA 2E5RA 3BJIA 3TJQA 1TBQR 3TO7A 1H0ZA 5E3RA 1TOTA 2GVIA 2B0UC 2K9HA 4SGBI 2JYYA 1CHOI 3R5CA 5J8FA 1ULKA 2DB6A 1IY5A 1CGJI 2JW6A 2N1AB 1SGRI 1Y8FA 2OZUA 3VDPA 1P9GA 1CGII 1Q9BA 2LEOA 1N13A 4A24A 1IW4A 2LUYA 1PTRA 2J9RA 2KMPA 2ODDA 2V1CA 3R5BA 2KMRA 1V1IA 2GIVA 2NU3I 3OXLA 4UXIA 2NU2I 3TO9A 1MJBA 1OVOA 2RC4A 1AN1I 2GKTI 1K7VA 3R5AA 1CE3A 3TOBA 1U5KA 1PJUA 2ORWA 1HPTA 1FY7A 2LB7A 2JXDA 1YTPA 2GKRI 5FUXA 1PTQA 2J87A 4GI3C 3SGBI 4DNCA 1RFHA 1VDDA 3E59A 2ROWA 3RU0A 1R0RI 3KY9A 4OVOA 1WKXA 2CWHA 5JHWC 2YUUA 2DKVA 2UVOA 3UFFA 1W3SA 1X74A 3FSYA 5CCMA 3D00A 1R79A 2NU0I 2YQPA 2OU2A 2E73A 2QPOA 3VDUA 5HQ8A 1M8CA 1KMAA 3FSXA 2NU4I 3SEKC 2F3CI 2P6AC 2A20A 2KCXA 2OD1A 4HGUA 2CWFA 2FNFX 1WGCA 4UXJA 5HI7A 1UVGA 1TGSI 2SGPI 1DS2I 2B8TA 4E1RA 1HDLA 1HEVA 1UUCA 5E3PA 1FYBA 3UEJA 2WCYA 2X52A 2CJSC 3SGQI 2SGEI 3OL0A 1LR7A 1X4SA 2PQ8A 1OMUA 2BUSA 4WP4A 1BUSA 2XRCA 1WGTA 2SGQI 2L8EA 2QQDA 1KBEA 1K7TA 5CCLA 1ULNA 2N52A 2VRWB 2JZMA 4MPIA 2SGFI 1TUSA 1MT1A 1TIHA 2ENZA 1S20A 1TURA 2Y0MA 1SGPI 1WTJA 1ULMA 2ARPF 2KMOA 3OVOA 3QTLD 4FKDA 3TO6A 1FAQA 1CT2I 2W0TA 2WVJA 2SGDI 5FUYA 5DAEA 1Z7KB 1LR9A 2ELIA 2ORVA 3UEYA 4E1PA 1LR8A 1SGDI 3CXLA 2UZ3A 1SGYI 3UGLA 1UHAA 2M5XA 1BMOA 1SGEI 1M8BA 5J8CA 4JCVE 1MJ9A 2QQCA 2WGCA 3R5DA 1DS3I 2JA1A 4AMLA 2DIPA 1PPFI 1PCEA 1CSOI 2OVOA 1K7UA 5FUVA 2L7XA 9WGAA 1XA6A 3UOEA 4B6DA 4L9MA 1IY6A 1CT0I 2CWGA 3OXGA 1CT4I 7WGAA
chains in the Genus database with same CATH topology
2NU1I 1SGQI 1OMTA 1OYVI 3MEKA 2N17A 2QQEA 1HJAI 2GKVA 3HH2C 3E2IA 2ERWA 1FARA 3OXFA 4UXHA 3VE5A 2KMQA 3UGDA 1V1HA 1NUBA 2V1CC 2N71A 1Y1CA 3QWPA 5EX3A 1TBRR 1W4RA 1YU6C 2QQ0A 2V53A 3PDNA 1SGNI 1TBNA 1XBTA 3FC3A 5FUWA 3GOXA 1Y1BA 2ENNA 5EX0A 3UGIA 1TBOA 1KBFA 3B4VC 1UVFA 1XX6A 2E5RA 3BJIA 3TJQA 1TBQR 1H0ZA 1TOTA 2GVIA 2B0UC 2K9HA 4SGBI 2JYYA 1CHOI 2DB6A 1IY5A 1CGJI 2JW6A 2N1AB 1SGRI 1Y8FA 3VDPA 1CGII 2LEOA 1N13A 4A24A 1IW4A 2LUYA 1PTRA 2J9RA 2KMPA 2ODDA 2V1CA 2KMRA 1V1IA 2NU3I 3OXLA 4UXIA 2NU2I 1OVOA 1AN1I 2GKTI 1CE3A 1U5KA 1PJUA 2ORWA 1HPTA 2JXDA 1YTPA 2GKRI 5FUXA 1PTQA 2J87A 4GI3C 3SGBI 1RFHA 1VDDA 3E59A 2ROWA 3RU0A 1R0RI 3KY9A 4OVOA 5JHWC 2YUUA 1W3SA 1X74A 5CCMA 3D00A 1R79A 2NU0I 2YQPA 2E73A 2QPOA 3VDUA 5HQ8A 1M8CA 1KMAA 3SEKC 2NU4I 2F3CI 2P6AC 2A20A 2KCXA 2OD1A 4HGUA 2FNFX 4UXJA 5HI7A 1TGSI 1UVGA 2SGPI 1DS2I 2B8TA 4E1RA 1HDLA 1UUCA 1FYBA 3UEJA 2WCYA 2CJSC 3SGQI 2SGEI 3OL0A 1LR7A 1X4SA 1OMUA 2BUSA 1BUSA 2XRCA 2SGQI 2L8EA 2QQDA 1KBEA 5CCLA 2VRWB 2N52A 2JZMA 2SGFI 1TUSA 1MT1A 1TIHA 2ENZA 1TURA 1SGPI 2ARPF 2KMOA 3OVOA 3QTLD 4FKDA 1FAQA 1CT2I 2W0TA 2WVJA 2SGDI 5FUYA 5DAEA 1Z7KB 1LR9A 2ELIA 2ORVA 3UEYA 4E1PA 1LR8A 1SGDI 3CXLA 2UZ3A 1SGYI 3UGLA 2M5XA 1BMOA 1SGEI 1M8BA 4JCVE 2QQCA 1DS3I 2JA1A 2DIPA 1PPFI 1PCEA 1CSOI 2OVOA 5FUVA 2L7XA 1XA6A 4B6DA 4L9MA 1IY6A 1CT0I 3UFFA 3OXGA 1CT4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1A B;  1TOT A;  2DIP A;  2E5R A; 
#chains in the Genus database with same CATH topology
 2NU1 I;  1SGQ I;  1OMT A;  1OYV I;  3MEK A;  1MJA A;  2N17 A;  3QAH A;  2QQE A;  1HJA I;  2GKV A;  3HH2 C;  3E2I A;  2ERW A;  1FAR A;  3OXF A;  4UXH A;  3VE5 A;  2KMQ A;  3TOA A;  3UGD A;  1V1H A;  1NUB A;  2V1C C;  2N71 A;  1Y1C A;  3QWP A;  5EX3 A;  1TBR R;  1W4R A;  1YU6 C;  2QQ0 A;  1P9Z A;  2V53 A;  3PDN A;  1SGN I;  1TBN A;  1XBT A;  2RIJ A;  3FC3 A;  1Z2I A;  5FUW A;  3GOX A;  1Y1B A;  2ENN A;  5EX0 A;  3UGI A;  5E3Q A;  1TBO A;  1KBF A;  2X3T A;  3B4V C;  1UVF A;  1XX6 A;  1NXU A;  2E5R A;  3BJI A;  3TJQ A;  1TBQ R;  3TO7 A;  1H0Z A;  5E3R A;  1TOT A;  2GVI A;  2B0U C;  2K9H A;  4SGB I;  2JYY A;  1CHO I;  3R5C A;  5J8F A;  1ULK A;  2DB6 A;  1IY5 A;  1CGJ I;  2JW6 A;  2N1A B;  1SGR I;  1Y8F A;  2OZU A;  3VDP A;  1P9G A;  1CGI I;  1Q9B A;  2LEO A;  1N13 A;  4A24 A;  1IW4 A;  2LUY A;  1PTR A;  2J9R A;  2KMP A;  2ODD A;  2V1C A;  3R5B A;  2KMR A;  1V1I A;  2GIV A;  2NU3 I;  3OXL A;  4UXI A;  2NU2 I;  3TO9 A;  1MJB A;  1OVO A;  2RC4 A;  1AN1 I;  2GKT I;  1K7V A;  3R5A A;  1CE3 A;  3TOB A;  1U5K A;  1PJU A;  2ORW A;  1HPT A;  1FY7 A;  2LB7 A;  2JXD A;  1YTP A;  2GKR I;  5FUX A;  1PTQ A;  2J87 A;  4GI3 C;  3SGB I;  4DNC A;  1RFH A;  1VDD A;  3E59 A;  2ROW A;  3RU0 A;  1R0R I;  3KY9 A;  4OVO A;  1WKX A;  2CWH A;  5JHW C;  2YUU A;  2DKV A;  2UVO A;  3UFF A;  1W3S A;  1X74 A;  3FSY A;  5CCM A;  3D00 A;  1R79 A;  2NU0 I;  2YQP A;  2OU2 A;  2E73 A;  2QPO A;  3VDU A;  5HQ8 A;  1M8C A;  1KMA A;  3FSX A;  2NU4 I;  3SEK C;  2F3C I;  2P6A C;  2A20 A;  2KCX A;  2OD1 A;  4HGU A;  2CWF A;  2FNF X;  1WGC A;  4UXJ A;  5HI7 A;  1UVG A;  1TGS I;  2SGP I;  1DS2 I;  2B8T A;  4E1R A;  1HDL A;  1HEV A;  1UUC A;  5E3P A;  1FYB A;  3UEJ A;  2WCY A;  2X52 A;  2CJS C;  3SGQ I;  2SGE I;  3OL0 A;  1LR7 A;  1X4S A;  2PQ8 A;  1OMU A;  2BUS A;  4WP4 A;  1BUS A;  2XRC A;  1WGT A;  2SGQ I;  2L8E A;  2QQD A;  1KBE A;  1K7T A;  5CCL A;  1ULN A;  2N52 A;  2VRW B;  2JZM A;  4MPI A;  2SGF I;  1TUS A;  1MT1 A;  1TIH A;  2ENZ A;  1S20 A;  1TUR A;  2Y0M A;  1SGP I;  1WTJ A;  1ULM A;  2ARP F;  2KMO A;  3OVO A;  3QTL D;  4FKD A;  3TO6 A;  1FAQ A;  1CT2 I;  2W0T A;  2WVJ A;  2SGD I;  5FUY A;  5DAE A;  1Z7K B;  1LR9 A;  2ELI A;  2ORV A;  3UEY A;  4E1P A;  1LR8 A;  1SGD I;  3CXL A;  2UZ3 A;  1SGY I;  3UGL A;  1UHA A;  2M5X A;  1BMO A;  1SGE I;  1M8B A;  5J8C A;  4JCV E;  1MJ9 A;  2QQC A;  2WGC A;  3R5D A;  1DS3 I;  2JA1 A;  4AML A;  2DIP A;  1PPF I;  1PCE A;  1CSO I;  2OVO A;  1K7U A;  5FUV A;  2L7X A;  9WGA A;  1XA6 A;  3UOE A;  4B6D A;  4L9M A;  1IY6 A;  1CT0 I;  2CWG A;  3OXG A;  1CT4 I;  7WGA A; 
#chains in the Genus database with same CATH homology
 2NU1 I;  1SGQ I;  1OMT A;  1OYV I;  3MEK A;  2N17 A;  2QQE A;  1HJA I;  2GKV A;  3HH2 C;  3E2I A;  2ERW A;  1FAR A;  3OXF A;  4UXH A;  3VE5 A;  2KMQ A;  3UGD A;  1V1H A;  1NUB A;  2V1C C;  2N71 A;  1Y1C A;  3QWP A;  5EX3 A;  1TBR R;  1W4R A;  1YU6 C;  2QQ0 A;  2V53 A;  3PDN A;  1SGN I;  1TBN A;  1XBT A;  3FC3 A;  5FUW A;  3GOX A;  1Y1B A;  2ENN A;  5EX0 A;  3UGI A;  1TBO A;  1KBF A;  3B4V C;  1UVF A;  1XX6 A;  2E5R A;  3BJI A;  3TJQ A;  1TBQ R;  1H0Z A;  1TOT A;  2GVI A;  2B0U C;  2K9H A;  4SGB I;  2JYY A;  1CHO I;  2DB6 A;  1IY5 A;  1CGJ I;  2JW6 A;  2N1A B;  1SGR I;  1Y8F A;  3VDP A;  1CGI I;  2LEO A;  1N13 A;  4A24 A;  1IW4 A;  2LUY A;  1PTR A;  2J9R A;  2KMP A;  2ODD A;  2V1C A;  2KMR A;  1V1I A;  2NU3 I;  3OXL A;  4UXI A;  2NU2 I;  1OVO A;  1AN1 I;  2GKT I;  1CE3 A;  1U5K A;  1PJU A;  2ORW A;  1HPT A;  2JXD A;  1YTP A;  2GKR I;  5FUX A;  1PTQ A;  2J87 A;  4GI3 C;  3SGB I;  1RFH A;  1VDD A;  3E59 A;  2ROW A;  3RU0 A;  1R0R I;  3KY9 A;  4OVO A;  5JHW C;  2YUU A;  1W3S A;  1X74 A;  5CCM A;  3D00 A;  1R79 A;  2NU0 I;  2YQP A;  2E73 A;  2QPO A;  3VDU A;  5HQ8 A;  1M8C A;  1KMA A;  3SEK C;  2NU4 I;  2F3C I;  2P6A C;  2A20 A;  2KCX A;  2OD1 A;  4HGU A;  2FNF X;  4UXJ A;  5HI7 A;  1TGS I;  1UVG A;  2SGP I;  1DS2 I;  2B8T A;  4E1R A;  1HDL A;  1UUC A;  1FYB A;  3UEJ A;  2WCY A;  2CJS C;  3SGQ I;  2SGE I;  3OL0 A;  1LR7 A;  1X4S A;  1OMU A;  2BUS A;  1BUS A;  2XRC A;  2SGQ I;  2L8E A;  2QQD A;  1KBE A;  5CCL A;  2VRW B;  2N52 A;  2JZM A;  2SGF I;  1TUS A;  1MT1 A;  1TIH A;  2ENZ A;  1TUR A;  1SGP I;  2ARP F;  2KMO A;  3OVO A;  3QTL D;  4FKD A;  1FAQ A;  1CT2 I;  2W0T A;  2WVJ A;  2SGD I;  5FUY A;  5DAE A;  1Z7K B;  1LR9 A;  2ELI A;  2ORV A;  3UEY A;  4E1P A;  1LR8 A;  1SGD I;  3CXL A;  2UZ3 A;  1SGY I;  3UGL A;  2M5X A;  1BMO A;  1SGE I;  1M8B A;  4JCV E;  2QQC A;  1DS3 I;  2JA1 A;  2DIP A;  1PPF I;  1PCE A;  1CSO I;  2OVO A;  5FUV A;  2L7X A;  1XA6 A;  4B6D A;  4L9M A;  1IY6 A;  1CT0 I;  3UFF A;  3OXG A;  1CT4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...