2N1AB

Docked structure between sumo1 and zz-domain from cbp
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
53
structure length
53
Chain Sequence
GQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis of a Complex between Small Ubiquitin-like Modifier 1 (SUMO1) and the ZZ Domain of CREB-binding Protein (CBP/p300) Reveals a New Interaction Surface on SUMO.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Small ubiquitin-related modifier 1
total genus 5
structure length 53
sequence length 53
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.90 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2n1aB00
2E5RA 2N1AB 2DIPA 1TOTA
chains in the Genus database with same CATH superfamily
2SGQI 1HEVA 1CHOI 1Y1BA 2GVIA 2ERWA 3OXLA 1H0ZA 2SGDI 3TO9A 2KMPA 3OL0A 1CT0I 1OMTA 1FARA 2WCYA 1XBTA 2VRWB 2YQPA 1TUSA 3SEKC 1NUBA 1P9GA 1WGTA 1YU6C 3D00A 1PJUA 1X4SA 1Z7KB 1OMUA 1TBOA 1XX6A 1PPFI 2ARPF 2OZUA 1SGQI 1TGSI 4OVOA 4SGBI 1Y8FA 4WP4A 1TBRR 2BUSA 3FSYA 1NXUA 1CGII 5FUWA 4AMLA 1KBEA 2QPOA 1XA6A 2N1AB 1WGCA 5E3PA 3UEJA 4UXHA 1IY6A 3RU0A 3SGQI 2L7XA 1V1HA 2N17A 1Q9BA 1FY7A 2ODDA 2OU2A 3PDNA 1MT1A 2A20A 3OVOA 2NU3I 2RC4A 3UGDA 1LR8A 5CCMA 4HGUA 3B4VC 2ORVA 1K7UA 3MEKA 3TO6A 1PTQA 2N71A 3SGBI 2GKTI 2JZMA 2UZ3A 2KCXA 1V1IA 2YUUA 3TOAA 4E1PA 1BMOA 1HPTA 1TURA 3FSXA 5EX3A 2NU1I 1SGNI 2OD1A 5J8CA 1FAQA 3R5CA 2V1CC 5FUVA 1FYBA 2E73A 4FKDA 3UOEA 1ULKA 3GOXA 1HJAI 3FC3A 1CGJI 1M8BA 2CWHA 3CXLA 3R5AA 3TOBA 2CJSC 2QQCA 2GIVA 5DAEA 4MPIA 1K7VA 2QQEA 1TIHA 1DS2I 1SGPI 1CT2I 1M8CA 2JA1A 2M5XA 2W0TA 2WGCA 5CCLA 3TO7A 1MJ9A 1OVOA 1MJBA 2CWGA 1ULMA 1Y1CA 2F3CI 2J87A 2LEOA 2KMRA 3BJIA 3UFFA 2SGEI 2ORWA 2NU0I 4UXJA 2L8EA 3OXGA 3QTLD 3R5BA 3VE5A 2QQ0A 2CWFA 3E59A 5EX0A 2ROWA 3UGLA 1U5KA 1UHAA 2QQDA 1DS3I 1CE3A 2KMOA 2ENZA 3R5DA 3VDPA 2FNFX 1WKXA 1SGRI 1LR7A 1HDLA 2P6AC 1TOTA 2N52A 2GKRI 1UVGA 2LB7A 5E3QA 1PCEA 4A24A 1CSOI 2V53A 1LR9A 2XRCA 1R79A 3UEYA 1VDDA 2LUYA 2JXDA 2WVJA 4E1RA 4DNCA 2V1CA 3VDUA 1PTRA 3QWPA 4GI3C 1CT4I 1Z2IA 3UGIA 2UVOA 4L9MA 1R0RI 1X74A 2ENNA 1YTPA 2X3TA 2JW6A 1N13A 3KY9A 1TBNA 3TJQA 5HI7A 1W3SA 1UUCA 2E5RA 5J8FA 2PQ8A 1UVFA 1K7TA 4JCVE 1KBFA 2NU4I 5HQ8A 5E3RA 2KMQA 7WGAA 1S20A 1SGEI 1TBQR 1SGYI 1WTJA 1P9ZA 1AN1I 9WGAA 1IW4A 1OYVI 4UXIA 3QAHA 5FUXA 1SGDI 1MJAA 2J9RA 2NU2I 2Y0MA 4B6DA 1RFHA 1KMAA 2JYYA 3HH2C 2RIJA 3E2IA 1IY5A 3OXFA 2SGFI 2SGPI 2OVOA 5JHWC 2DKVA 2B8TA 2GKVA 5FUYA 1W4RA 2DIPA 2B0UC 1ULNA 2DB6A 1BUSA 2K9HA 2ELIA 2X52A
chains in the Genus database with same CATH topology
2SGQI 1CHOI 1Y1BA 2GVIA 2ERWA 3OXLA 1H0ZA 2SGDI 2KMPA 3OL0A 1CT0I 1OMTA 1FARA 2WCYA 1XBTA 2VRWB 2YQPA 1TUSA 3SEKC 1NUBA 3D00A 1YU6C 1PJUA 1X4SA 2ARPF 1OMUA 1TBOA 1Z7KB 1PPFI 1XX6A 1SGQI 1TGSI 4OVOA 4SGBI 1Y8FA 1TBRR 2BUSA 1CGII 5FUWA 1KBEA 2QPOA 1XA6A 2N1AB 3UEJA 4UXHA 1IY6A 3RU0A 3SGQI 2L7XA 1V1HA 2N17A 2ODDA 3PDNA 2A20A 1MT1A 3OVOA 2NU3I 3UGDA 5CCMA 1LR8A 4HGUA 3B4VC 2ORVA 3MEKA 1PTQA 2N71A 3SGBI 2GKTI 2JZMA 2UZ3A 2KCXA 1V1IA 2YUUA 4E1PA 1BMOA 1HPTA 1TURA 5EX3A 2NU1I 1SGNI 2OD1A 1FAQA 2V1CC 5FUVA 1FYBA 2E73A 4FKDA 3GOXA 1HJAI 3FC3A 1CGJI 1M8BA 3CXLA 2CJSC 2QQCA 5DAEA 5JHWC 2QQEA 1TIHA 1DS2I 1SGPI 1CT2I 1M8CA 2JA1A 2M5XA 2W0TA 5CCLA 1OVOA 2F3CI 1Y1CA 2LEOA 2J87A 3BJIA 2KMRA 3UFFA 2SGEI 2ORWA 2NU0I 4UXJA 2L8EA 3OXGA 3QTLD 3VE5A 2QQ0A 3E59A 5EX0A 3UGLA 2ROWA 1U5KA 2QQDA 1DS3I 1CE3A 2KMOA 2ENZA 3VDPA 2FNFX 1SGRI 1LR7A 1HDLA 2P6AC 1TOTA 2N52A 2GKRI 1UVGA 4A24A 1PCEA 1CSOI 2V53A 1LR9A 2XRCA 1R79A 3UEYA 1VDDA 2LUYA 2JXDA 2WVJA 4E1RA 2V1CA 3VDUA 1PTRA 3QWPA 4GI3C 1CT4I 3UGIA 4L9MA 1R0RI 1X74A 2ENNA 1YTPA 2JW6A 1N13A 3KY9A 1TBNA 3TJQA 5HI7A 1W3SA 1UUCA 2E5RA 1UVFA 4JCVE 1KBFA 2NU4I 5HQ8A 2KMQA 1SGEI 1TBQR 1SGYI 1IW4A 1AN1I 1OYVI 4UXIA 5FUXA 1SGDI 2J9RA 2NU2I 4B6DA 1RFHA 1KMAA 2JYYA 3HH2C 3E2IA 1IY5A 3OXFA 2SGFI 2SGPI 2OVOA 2B8TA 2GKVA 5FUYA 1W4RA 2DIPA 2B0UC 2DB6A 1BUSA 2K9HA 2ELIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5R A;  2N1A B;  2DIP A;  1TOT A; 
#chains in the Genus database with same CATH topology
 2SGQ I;  1HEV A;  1CHO I;  1Y1B A;  2GVI A;  2ERW A;  3OXL A;  1H0Z A;  2SGD I;  3TO9 A;  2KMP A;  3OL0 A;  1CT0 I;  1OMT A;  1FAR A;  2WCY A;  1XBT A;  2VRW B;  2YQP A;  1TUS A;  3SEK C;  1NUB A;  1P9G A;  1WGT A;  1YU6 C;  3D00 A;  1PJU A;  1X4S A;  1Z7K B;  1OMU A;  1TBO A;  1XX6 A;  1PPF I;  2ARP F;  2OZU A;  1SGQ I;  1TGS I;  4OVO A;  4SGB I;  1Y8F A;  4WP4 A;  1TBR R;  2BUS A;  3FSY A;  1NXU A;  1CGI I;  5FUW A;  4AML A;  1KBE A;  2QPO A;  1XA6 A;  2N1A B;  1WGC A;  5E3P A;  3UEJ A;  4UXH A;  1IY6 A;  3RU0 A;  3SGQ I;  2L7X A;  1V1H A;  2N17 A;  1Q9B A;  1FY7 A;  2ODD A;  2OU2 A;  3PDN A;  1MT1 A;  2A20 A;  3OVO A;  2NU3 I;  2RC4 A;  3UGD A;  1LR8 A;  5CCM A;  4HGU A;  3B4V C;  2ORV A;  1K7U A;  3MEK A;  3TO6 A;  1PTQ A;  2N71 A;  3SGB I;  2GKT I;  2JZM A;  2UZ3 A;  2KCX A;  1V1I A;  2YUU A;  3TOA A;  4E1P A;  1BMO A;  1HPT A;  1TUR A;  3FSX A;  5EX3 A;  2NU1 I;  1SGN I;  2OD1 A;  5J8C A;  1FAQ A;  3R5C A;  2V1C C;  5FUV A;  1FYB A;  2E73 A;  4FKD A;  3UOE A;  1ULK A;  3GOX A;  1HJA I;  3FC3 A;  1CGJ I;  1M8B A;  2CWH A;  3CXL A;  3R5A A;  3TOB A;  2CJS C;  2QQC A;  2GIV A;  5DAE A;  4MPI A;  1K7V A;  2QQE A;  1TIH A;  1DS2 I;  1SGP I;  1CT2 I;  1M8C A;  2JA1 A;  2M5X A;  2W0T A;  2WGC A;  5CCL A;  3TO7 A;  1MJ9 A;  1OVO A;  1MJB A;  2CWG A;  1ULM A;  1Y1C A;  2F3C I;  2J87 A;  2LEO A;  2KMR A;  3BJI A;  3UFF A;  2SGE I;  2ORW A;  2NU0 I;  4UXJ A;  2L8E A;  3OXG A;  3QTL D;  3R5B A;  3VE5 A;  2QQ0 A;  2CWF A;  3E59 A;  5EX0 A;  2ROW A;  3UGL A;  1U5K A;  1UHA A;  2QQD A;  1DS3 I;  1CE3 A;  2KMO A;  2ENZ A;  3R5D A;  3VDP A;  2FNF X;  1WKX A;  1SGR I;  1LR7 A;  1HDL A;  2P6A C;  1TOT A;  2N52 A;  2GKR I;  1UVG A;  2LB7 A;  5E3Q A;  1PCE A;  4A24 A;  1CSO I;  2V53 A;  1LR9 A;  2XRC A;  1R79 A;  3UEY A;  1VDD A;  2LUY A;  2JXD A;  2WVJ A;  4E1R A;  4DNC A;  2V1C A;  3VDU A;  1PTR A;  3QWP A;  4GI3 C;  1CT4 I;  1Z2I A;  3UGI A;  2UVO A;  4L9M A;  1R0R I;  1X74 A;  2ENN A;  1YTP A;  2X3T A;  2JW6 A;  1N13 A;  3KY9 A;  1TBN A;  3TJQ A;  5HI7 A;  1W3S A;  1UUC A;  2E5R A;  5J8F A;  2PQ8 A;  1UVF A;  1K7T A;  4JCV E;  1KBF A;  2NU4 I;  5HQ8 A;  5E3R A;  2KMQ A;  7WGA A;  1S20 A;  1SGE I;  1TBQ R;  1SGY I;  1WTJ A;  1P9Z A;  1AN1 I;  9WGA A;  1IW4 A;  1OYV I;  4UXI A;  3QAH A;  5FUX A;  1SGD I;  1MJA A;  2J9R A;  2NU2 I;  2Y0M A;  4B6D A;  1RFH A;  1KMA A;  2JYY A;  3HH2 C;  2RIJ A;  3E2I A;  1IY5 A;  3OXF A;  2SGF I;  2SGP I;  2OVO A;  5JHW C;  2DKV A;  2B8T A;  2GKV A;  5FUY A;  1W4R A;  2DIP A;  2B0U C;  1ULN A;  2DB6 A;  1BUS A;  2K9H A;  2ELI A;  2X52 A; 
#chains in the Genus database with same CATH homology
 2SGQ I;  1CHO I;  1Y1B A;  2GVI A;  2ERW A;  3OXL A;  1H0Z A;  2SGD I;  2KMP A;  3OL0 A;  1CT0 I;  1OMT A;  1FAR A;  2WCY A;  1XBT A;  2VRW B;  2YQP A;  1TUS A;  3SEK C;  1NUB A;  3D00 A;  1YU6 C;  1PJU A;  1X4S A;  2ARP F;  1OMU A;  1TBO A;  1Z7K B;  1PPF I;  1XX6 A;  1SGQ I;  1TGS I;  4OVO A;  4SGB I;  1Y8F A;  1TBR R;  2BUS A;  1CGI I;  5FUW A;  1KBE A;  2QPO A;  1XA6 A;  2N1A B;  3UEJ A;  4UXH A;  1IY6 A;  3RU0 A;  3SGQ I;  2L7X A;  1V1H A;  2N17 A;  2ODD A;  3PDN A;  2A20 A;  1MT1 A;  3OVO A;  2NU3 I;  3UGD A;  5CCM A;  1LR8 A;  4HGU A;  3B4V C;  2ORV A;  3MEK A;  1PTQ A;  2N71 A;  3SGB I;  2GKT I;  2JZM A;  2UZ3 A;  2KCX A;  1V1I A;  2YUU A;  4E1P A;  1BMO A;  1HPT A;  1TUR A;  5EX3 A;  2NU1 I;  1SGN I;  2OD1 A;  1FAQ A;  2V1C C;  5FUV A;  1FYB A;  2E73 A;  4FKD A;  3GOX A;  1HJA I;  3FC3 A;  1CGJ I;  1M8B A;  3CXL A;  2CJS C;  2QQC A;  5DAE A;  5JHW C;  2QQE A;  1TIH A;  1DS2 I;  1SGP I;  1CT2 I;  1M8C A;  2JA1 A;  2M5X A;  2W0T A;  5CCL A;  1OVO A;  2F3C I;  1Y1C A;  2LEO A;  2J87 A;  3BJI A;  2KMR A;  3UFF A;  2SGE I;  2ORW A;  2NU0 I;  4UXJ A;  2L8E A;  3OXG A;  3QTL D;  3VE5 A;  2QQ0 A;  3E59 A;  5EX0 A;  3UGL A;  2ROW A;  1U5K A;  2QQD A;  1DS3 I;  1CE3 A;  2KMO A;  2ENZ A;  3VDP A;  2FNF X;  1SGR I;  1LR7 A;  1HDL A;  2P6A C;  1TOT A;  2N52 A;  2GKR I;  1UVG A;  4A24 A;  1PCE A;  1CSO I;  2V53 A;  1LR9 A;  2XRC A;  1R79 A;  3UEY A;  1VDD A;  2LUY A;  2JXD A;  2WVJ A;  4E1R A;  2V1C A;  3VDU A;  1PTR A;  3QWP A;  4GI3 C;  1CT4 I;  3UGI A;  4L9M A;  1R0R I;  1X74 A;  2ENN A;  1YTP A;  2JW6 A;  1N13 A;  3KY9 A;  1TBN A;  3TJQ A;  5HI7 A;  1W3S A;  1UUC A;  2E5R A;  1UVF A;  4JCV E;  1KBF A;  2NU4 I;  5HQ8 A;  2KMQ A;  1SGE I;  1TBQ R;  1SGY I;  1IW4 A;  1AN1 I;  1OYV I;  4UXI A;  5FUX A;  1SGD I;  2J9R A;  2NU2 I;  4B6D A;  1RFH A;  1KMA A;  2JYY A;  3HH2 C;  3E2I A;  1IY5 A;  3OXF A;  2SGF I;  2SGP I;  2OVO A;  2B8T A;  2GKV A;  5FUY A;  1W4R A;  2DIP A;  2B0U C;  2DB6 A;  1BUS A;  2K9H A;  2ELI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...