2N1AB

Docked structure between sumo1 and zz-domain from cbp
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
53
structure length
53
Chain Sequence
GQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Small ubiquitin-related modifier 1
publication title Structural Analysis of a Complex between Small Ubiquitin-like Modifier 1 (SUMO1) and the ZZ Domain of CREB-binding Protein (CBP/p300) Reveals a New Interaction Surface on SUMO.
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 53
sequence length 53
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.90 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2n1aB00
2N1AB 2E5RA 2DIPA 1TOTA
chains in the Genus database with same CATH superfamily
2CWFA 3VE5A 1Z7KB 4WP4A 2SGQI 4SGBI 1SGNI 1TBNA 1K7VA 2E5RA 4UXIA 5FUVA 1ULNA 1MJAA 3TJQA 2N17A 3QTLD 1ULKA 3GOXA 2N71A 1TIHA 1IY6A 4A24A 3SEKC 2WCYA 5J8FA 2SGDI 5E3QA 2X3TA 3VDPA 2SGFI 4E1PA 1KMAA 2W0TA 4DNCA 1SGRI 2JYYA 2RIJA 1HJAI 1TBQR 1W3SA 2J9RA 1CT2I 1KBEA 1YTPA 5DAEA 2FNFX 1HDLA 1XA6A 5HI7A 2ORVA 3SGQI 3R5CA 3FC3A 2B8TA 1M8CA 2GVIA 1WKXA 4MPIA 5J8CA 2XRCA 1KBFA 2Y0MA 1DS2I 1PCEA 1XX6A 5CCMA 1H0ZA 3E59A 4AMLA 1XBTA 3QAHA 2QQEA 3FSYA 5FUYA 1BMOA 1V1IA 1NXUA 1SGEI 1CGII 3UOEA 1CE3A 1U5KA 4UXJA 5HQ8A 1P9GA 1RFHA 1CT0I 1UHAA 3FSXA 2WGCA 5EX0A 2KMQA 2LEOA 5FUWA 1M8BA 2DKVA 2F3CI 3B4VC 1YU6C 2LUYA 3VDUA 1CHOI 2JW6A 1MJ9A 1WGTA 1S20A 2JXDA 1TUSA 2YQPA 3E2IA 1CGJI 2DB6A 4UXHA 1Y8FA 1WGCA 2B0UC 3TOBA 4E1RA 2SGPI 2DIPA 3MEKA 2OU2A 2ODDA 4L9MA 1IW4A 1CT4I 5EX3A 2KMOA 3RU0A 2GKRI 2OZUA 2UVOA 1PJUA 3OVOA 1K7UA 2NU1I 2N1AB 1LR9A 2A20A 1LR8A 1UUCA 2L7XA 1TBRR 2ENZA 1FYBA 3TO7A 2NU3I 2QQDA 1OMUA 2V1CC 2KMPA 4OVOA 1PTRA 2PQ8A 1Y1CA 3UFFA 3UGDA 1DS3I 2J87A 2VRWB 3KY9A 3QWPA 3HH2C 1HPTA 3D00A 1N13A 2SGEI 1CSOI 1TBOA 2QQ0A 3UGIA 2ARPF 1FAQA 5E3PA 3SGBI 3UGLA 1WTJA 2QQCA 3PDNA 2YUUA 2ROWA 1MJBA 4GI3C 1SGYI 2M5XA 2OVOA 3OXLA 1HEVA 4JCVE 1Q9BA 1K7TA 1PPFI 1SGPI 1BUSA 2GIVA 3OL0A 2ELIA 1P9ZA 1FARA 2GKVA 1TURA 2V1CA 5E3RA 5CCLA 2QPOA 3R5DA 2CWHA 3TOAA 4B6DA 1OVOA 1X4SA 2GKTI 2K9HA 1PTQA 1W4RA 1R0RI 2CWGA 1UVGA 2JA1A 2CJSC 2LB7A 1FY7A 1V1HA 2N52A 2NU4I 3R5BA 1X74A 1Z2IA 2V53A 2L8EA 1TGSI 3CXLA 1NUBA 2NU2I 2WVJA 4FKDA 1LR7A 1OMTA 2ERWA 1MT1A 3TO9A 1AN1I 2KCXA 2RC4A 4HGUA 1UVFA 2UZ3A 3UEYA 1OYVI 2P6AC 1SGQI 7WGAA 2NU0I 3OXGA 9WGAA 2ENNA 2X52A 1Y1BA 2JZMA 1R79A 2ORWA 2BUSA 3R5AA 2OD1A 5JHWC 1VDDA 1IY5A 1SGDI 2E73A 3BJIA 3OXFA 5FUXA 1ULMA 3TO6A 3UEJA 2KMRA 1TOTA
chains in the Genus database with same CATH topology
3VE5A 1Z7KB 2SGQI 4SGBI 1SGNI 1TBNA 2E5RA 4UXIA 5FUVA 3TJQA 2N17A 3QTLD 3GOXA 2N71A 1TIHA 1IY6A 4A24A 3SEKC 2WCYA 2SGDI 3VDPA 2SGFI 4E1PA 1KMAA 2W0TA 1SGRI 2JYYA 1HJAI 1TBQR 1W3SA 2J9RA 1CT2I 1KBEA 5DAEA 2FNFX 1HDLA 1XA6A 5HI7A 2ORVA 3SGQI 3FC3A 2B8TA 1M8CA 2GVIA 2XRCA 1KBFA 1DS2I 1PCEA 1XX6A 5CCMA 3E59A 1TOTA 1XBTA 2QQEA 5FUYA 1BMOA 1V1IA 1SGEI 1CGII 1CE3A 1U5KA 4UXJA 5HQ8A 1RFHA 1CT0I 5EX0A 2KMQA 2LEOA 5FUWA 1M8BA 2F3CI 3B4VC 1YU6C 2LUYA 3VDUA 1CHOI 2JW6A 2JXDA 1TUSA 2YQPA 3E2IA 1CGJI 2DB6A 4UXHA 1Y8FA 2B0UC 4E1RA 2SGPI 2DIPA 3MEKA 2ODDA 4L9MA 1IW4A 1CT4I 5EX3A 2KMOA 3RU0A 2GKRI 1PJUA 3OVOA 2NU1I 2N1AB 1LR9A 2A20A 1LR8A 1UUCA 2L7XA 1TBRR 2ENZA 1FYBA 2NU3I 2QQDA 1OMUA 2V1CC 2KMPA 4OVOA 1PTRA 1Y1CA 3UFFA 3UGDA 1DS3I 2J87A 2VRWB 3KY9A 3QWPA 3HH2C 1HPTA 3D00A 1N13A 2SGEI 1CSOI 1TBOA 2QQ0A 3UGIA 2ARPF 1FAQA 3SGBI 3UGLA 2QQCA 3PDNA 2YUUA 2ROWA 4GI3C 1SGYI 2M5XA 2OVOA 3OXLA 4JCVE 1PPFI 1SGPI 1BUSA 3OL0A 2ELIA 1FARA 2GKVA 1TURA 2V1CA 5CCLA 2QPOA 4B6DA 1OVOA 1X4SA 2GKTI 2K9HA 1PTQA 1W4RA 1R0RI 2JA1A 1UVGA 4FKDA 2CJSC 1H0ZA 2N52A 1V1HA 2NU4I 1X74A 2V53A 2L8EA 1TGSI 3CXLA 1NUBA 2NU2I 2WVJA 1LR7A 1OMTA 2ERWA 1MT1A 1AN1I 2KCXA 4HGUA 3UEYA 1UVFA 2UZ3A 1OYVI 2P6AC 1SGQI 2NU0I 3OXGA 2ENNA 1Y1BA 2JZMA 1R79A 2ORWA 2BUSA 2OD1A 5JHWC 1VDDA 1IY5A 1SGDI 2E73A 3BJIA 3OXFA 5FUXA 3UEJA 2KMRA 1YTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1A B;  2E5R A;  2DIP A;  1TOT A; 
#chains in the Genus database with same CATH topology
 2CWF A;  3VE5 A;  1Z7K B;  4WP4 A;  2SGQ I;  4SGB I;  1SGN I;  1TBN A;  1K7V A;  2E5R A;  4UXI A;  5FUV A;  1ULN A;  1MJA A;  3TJQ A;  2N17 A;  3QTL D;  1ULK A;  3GOX A;  2N71 A;  1TIH A;  1IY6 A;  4A24 A;  3SEK C;  2WCY A;  5J8F A;  2SGD I;  5E3Q A;  2X3T A;  3VDP A;  2SGF I;  4E1P A;  1KMA A;  2W0T A;  4DNC A;  1SGR I;  2JYY A;  2RIJ A;  1HJA I;  1TBQ R;  1W3S A;  2J9R A;  1CT2 I;  1KBE A;  1YTP A;  5DAE A;  2FNF X;  1HDL A;  1XA6 A;  5HI7 A;  2ORV A;  3SGQ I;  3R5C A;  3FC3 A;  2B8T A;  1M8C A;  2GVI A;  1WKX A;  4MPI A;  5J8C A;  2XRC A;  1KBF A;  2Y0M A;  1DS2 I;  1PCE A;  1XX6 A;  5CCM A;  1H0Z A;  3E59 A;  4AML A;  1XBT A;  3QAH A;  2QQE A;  3FSY A;  5FUY A;  1BMO A;  1V1I A;  1NXU A;  1SGE I;  1CGI I;  3UOE A;  1CE3 A;  1U5K A;  4UXJ A;  5HQ8 A;  1P9G A;  1RFH A;  1CT0 I;  1UHA A;  3FSX A;  2WGC A;  5EX0 A;  2KMQ A;  2LEO A;  5FUW A;  1M8B A;  2DKV A;  2F3C I;  3B4V C;  1YU6 C;  2LUY A;  3VDU A;  1CHO I;  2JW6 A;  1MJ9 A;  1WGT A;  1S20 A;  2JXD A;  1TUS A;  2YQP A;  3E2I A;  1CGJ I;  2DB6 A;  4UXH A;  1Y8F A;  1WGC A;  2B0U C;  3TOB A;  4E1R A;  2SGP I;  2DIP A;  3MEK A;  2OU2 A;  2ODD A;  4L9M A;  1IW4 A;  1CT4 I;  5EX3 A;  2KMO A;  3RU0 A;  2GKR I;  2OZU A;  2UVO A;  1PJU A;  3OVO A;  1K7U A;  2NU1 I;  2N1A B;  1LR9 A;  2A20 A;  1LR8 A;  1UUC A;  2L7X A;  1TBR R;  2ENZ A;  1FYB A;  3TO7 A;  2NU3 I;  2QQD A;  1OMU A;  2V1C C;  2KMP A;  4OVO A;  1PTR A;  2PQ8 A;  1Y1C A;  3UFF A;  3UGD A;  1DS3 I;  2J87 A;  2VRW B;  3KY9 A;  3QWP A;  3HH2 C;  1HPT A;  3D00 A;  1N13 A;  2SGE I;  1CSO I;  1TBO A;  2QQ0 A;  3UGI A;  2ARP F;  1FAQ A;  5E3P A;  3SGB I;  3UGL A;  1WTJ A;  2QQC A;  3PDN A;  2YUU A;  2ROW A;  1MJB A;  4GI3 C;  1SGY I;  2M5X A;  2OVO A;  3OXL A;  1HEV A;  4JCV E;  1Q9B A;  1K7T A;  1PPF I;  1SGP I;  1BUS A;  2GIV A;  3OL0 A;  2ELI A;  1P9Z A;  1FAR A;  2GKV A;  1TUR A;  2V1C A;  5E3R A;  5CCL A;  2QPO A;  3R5D A;  2CWH A;  3TOA A;  4B6D A;  1OVO A;  1X4S A;  2GKT I;  2K9H A;  1PTQ A;  1W4R A;  1R0R I;  2CWG A;  1UVG A;  2JA1 A;  2CJS C;  2LB7 A;  1FY7 A;  1V1H A;  2N52 A;  2NU4 I;  3R5B A;  1X74 A;  1Z2I A;  2V53 A;  2L8E A;  1TGS I;  3CXL A;  1NUB A;  2NU2 I;  2WVJ A;  4FKD A;  1LR7 A;  1OMT A;  2ERW A;  1MT1 A;  3TO9 A;  1AN1 I;  2KCX A;  2RC4 A;  4HGU A;  1UVF A;  2UZ3 A;  3UEY A;  1OYV I;  2P6A C;  1SGQ I;  7WGA A;  2NU0 I;  3OXG A;  9WGA A;  2ENN A;  2X52 A;  1Y1B A;  2JZM A;  1R79 A;  2ORW A;  2BUS A;  3R5A A;  2OD1 A;  5JHW C;  1VDD A;  1IY5 A;  1SGD I;  2E73 A;  3BJI A;  3OXF A;  5FUX A;  1ULM A;  3TO6 A;  3UEJ A;  2KMR A;  1TOT A; 
#chains in the Genus database with same CATH homology
 3VE5 A;  1Z7K B;  2SGQ I;  4SGB I;  1SGN I;  1TBN A;  2E5R A;  4UXI A;  5FUV A;  3TJQ A;  2N17 A;  3QTL D;  3GOX A;  2N71 A;  1TIH A;  1IY6 A;  4A24 A;  3SEK C;  2WCY A;  2SGD I;  3VDP A;  2SGF I;  4E1P A;  1KMA A;  2W0T A;  1SGR I;  2JYY A;  1HJA I;  1TBQ R;  1W3S A;  2J9R A;  1CT2 I;  1KBE A;  5DAE A;  2FNF X;  1HDL A;  1XA6 A;  5HI7 A;  2ORV A;  3SGQ I;  3FC3 A;  2B8T A;  1M8C A;  2GVI A;  2XRC A;  1KBF A;  1DS2 I;  1PCE A;  1XX6 A;  5CCM A;  3E59 A;  1TOT A;  1XBT A;  2QQE A;  5FUY A;  1BMO A;  1V1I A;  1SGE I;  1CGI I;  1CE3 A;  1U5K A;  4UXJ A;  5HQ8 A;  1RFH A;  1CT0 I;  5EX0 A;  2KMQ A;  2LEO A;  5FUW A;  1M8B A;  2F3C I;  3B4V C;  1YU6 C;  2LUY A;  3VDU A;  1CHO I;  2JW6 A;  2JXD A;  1TUS A;  2YQP A;  3E2I A;  1CGJ I;  2DB6 A;  4UXH A;  1Y8F A;  2B0U C;  4E1R A;  2SGP I;  2DIP A;  3MEK A;  2ODD A;  4L9M A;  1IW4 A;  1CT4 I;  5EX3 A;  2KMO A;  3RU0 A;  2GKR I;  1PJU A;  3OVO A;  2NU1 I;  2N1A B;  1LR9 A;  2A20 A;  1LR8 A;  1UUC A;  2L7X A;  1TBR R;  2ENZ A;  1FYB A;  2NU3 I;  2QQD A;  1OMU A;  2V1C C;  2KMP A;  4OVO A;  1PTR A;  1Y1C A;  3UFF A;  3UGD A;  1DS3 I;  2J87 A;  2VRW B;  3KY9 A;  3QWP A;  3HH2 C;  1HPT A;  3D00 A;  1N13 A;  2SGE I;  1CSO I;  1TBO A;  2QQ0 A;  3UGI A;  2ARP F;  1FAQ A;  3SGB I;  3UGL A;  2QQC A;  3PDN A;  2YUU A;  2ROW A;  4GI3 C;  1SGY I;  2M5X A;  2OVO A;  3OXL A;  4JCV E;  1PPF I;  1SGP I;  1BUS A;  3OL0 A;  2ELI A;  1FAR A;  2GKV A;  1TUR A;  2V1C A;  5CCL A;  2QPO A;  4B6D A;  1OVO A;  1X4S A;  2GKT I;  2K9H A;  1PTQ A;  1W4R A;  1R0R I;  2JA1 A;  1UVG A;  4FKD A;  2CJS C;  1H0Z A;  2N52 A;  1V1H A;  2NU4 I;  1X74 A;  2V53 A;  2L8E A;  1TGS I;  3CXL A;  1NUB A;  2NU2 I;  2WVJ A;  1LR7 A;  1OMT A;  2ERW A;  1MT1 A;  1AN1 I;  2KCX A;  4HGU A;  3UEY A;  1UVF A;  2UZ3 A;  1OYV I;  2P6A C;  1SGQ I;  2NU0 I;  3OXG A;  2ENN A;  1Y1B A;  2JZM A;  1R79 A;  2ORW A;  2BUS A;  2OD1 A;  5JHW C;  1VDD A;  1IY5 A;  1SGD I;  2E73 A;  3BJI A;  3OXF A;  5FUX A;  3UEJ A;  2KMR A;  1YTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...