1PCEA

Solution structure and dynamics of pec-60, a protein of the kazal type inhibitor family, determined by nuclear magnetic resonance spectroscopy
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
EKQVFSRMPICEHMTESPDCSRIYDPVCGTDGVTYESECKLCLARIENKQDIQIVKDGEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEC-60
publication title Solution structure and dynamics of PEC-60, a protein of the Kazal type inhibitor family, determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Proteinase inhibitor(kazal type)
total genus 12
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1pceA00
2KCXA 4HGUA 3B4VC 2V53A 4OVOA 1CGJI 1SGYI 1Y1CA 1BUSA 3SGQI 3SGBI 1IY6A 2F3CI 1AN1I 1CT4I 2NU1I 1SGRI 1KMAA 2KMOA 1OMTA 2N52A 2LEOA 1HPTA 1SGEI 2NU3I 2GKVA 1IW4A 2SGFI 2WCYA 1CE3A 1N13A 1CT0I 1TBQR 3TJQA 1TGSI 1PCEA 1Z7KB 2KMQA 2XRCA 1OVOA 2NU0I 2QQCA 2ARPF 3OVOA 2P6AC 2BUSA 2GKTI 1TIHA 2SGQI 3SEKC 1BMOA 2JXDA 4SGBI 1LR9A 2SGDI 2JZMA 1CT2I 4GI3C 1SGPI 2KMPA 5DAEA 1FYBA 1LR8A 1Y1BA 1UUCA 5JHWC 1MT1A 1TUSA 2KMRA 3QTLD 1LR7A 1SGNI 1SGDI 1OYVI 1R0RI 2N17A 1DS3I 2QQDA 1M8CA 1IY5A 1OMUA 1SGQI 2NU4I 3HH2C 1HDLA 1PJUA 2GKRI 2SGEI 1CGII 2M5XA 2B0UC 2JYYA 2N71A 1CHOI 1HJAI 1H0ZA 2ERWA 2NU2I 1CSOI 1DS2I 1TBRR 1M8BA 2OVOA 1UVFA 1UVGA 1YTPA 1PPFI 2SGPI 1TURA 1NUBA 1YU6C
chains in the Genus database with same CATH superfamily
1MJBA 1W4RA 3VDPA 2KCXA 2L8EA 5FUYA 1V1HA 3D00A 3GOXA 2LUYA 1Q9BA 3B4VC 4HGUA 2V53A 2FNFX 3OXGA 4L9MA 2RIJA 3UGIA 5J8FA 1MJ9A 3FSYA 1WKXA 4UXJA 4OVOA 1CGJI 1SGYI 1Y1CA 5FUVA 1BUSA 3SGQI 5FUWA 3SGBI 3TOAA 1IY6A 2F3CI 1AN1I 2E5RA 1CT4I 2NU1I 1SGRI 4AMLA 5EX0A 2J9RA 1KMAA 5E3PA 3R5AA 2KMOA 2L7XA 2UZ3A 1OMTA 2N52A 2LEOA 1XBTA 2B8TA 1HPTA 3E59A 1R79A 4FKDA 1SGEI 4UXHA 2NU3I 2GKVA 1K7UA 2JA1A 2ORWA 4DNCA 1S20A 1IW4A 1ULMA 2GIVA 1TOTA 3QWPA 1RFHA 1V1IA 2ELIA 2LB7A 2ROWA 2SGFI 2WCYA 1WGCA 3UGDA 2X3TA 5HQ8A 1K7VA 1N13A 2UVOA 1CT0I 1CE3A 1HEVA 1KBFA 1TBQR 3TJQA 2YQPA 3TO9A 1TGSI 1PCEA 1Z7KB 2GVIA 2KMQA 2N1AB 3TO6A 2XRCA 1WTJA 2ENZA 3R5CA 1OVOA 3R5DA 3RU0A 2NU0I 2QQCA 5FUXA 1K7TA 1KBEA 2ARPF 3OVOA 3TO7A 2P6AC 5CCMA 2BUSA 2GKTI 1TIHA 2SGQI 2J87A 4A24A 3OXFA 3SEKC 2WVJA 1BMOA 2JXDA 5E3QA 3TOBA 1FARA 4SGBI 3KY9A 1LR9A 1XA6A 2SGDI 3UFFA 1Z2IA 1WGTA 2ODDA 3E2IA 4UXIA 2JZMA 1CT2I 4GI3C 1SGPI 2KMPA 2QQEA 4WP4A 1XX6A 2PQ8A 3MEKA 4MPIA 5DAEA 3UGLA 4E1PA 3BJIA 2CWFA 2X52A 1X74A 3UEYA 2OU2A 1Y8FA 2DKVA 1FYBA 2ORVA 1ULKA 1LR8A 5EX3A 2Y0MA 2K9HA 1Y1BA 1UUCA 1U5KA 1MT1A 1TUSA 5JHWC 3UEJA 4E1RA 2KMRA 2WGCA 9WGAA 3QTLD 2A20A 1LR7A 1SGNI 1MJAA 1SGDI 2E73A 2OD1A 1OYVI 1PTRA 2DIPA 2V1CA 5CCLA 1R0RI 2CWGA 1DS3I 2CWHA 2N17A 3OL0A 3PDNA 2QQDA 7WGAA 1M8CA 4JCVE 1IY5A 1FAQA 1OMUA 1SGQI 2VRWB 5HI7A 2JW6A 1TBOA 2NU4I 2V1CC 4B6DA 3FC3A 3HH2C 3UOEA 2DB6A 2W0TA 1HDLA 1PJUA 1NXUA 1ULNA 1PTQA 2GKRI 1CGII 2M5XA 1W3SA 2RC4A 2SGEI 3VDUA 1P9GA 3VE5A 2B0UC 1FY7A 2JYYA 1X4SA 2N71A 1TBNA 1CHOI 1HJAI 3QAHA 1H0ZA 3CXLA 2ERWA 2NU2I 3FSXA 5E3RA 1VDDA 3R5BA 5J8CA 2OZUA 1CSOI 1DS2I 3OXLA 1TBRR 2CJSC 1M8BA 2OVOA 1UVFA 1UVGA 1YTPA 2YUUA 2QPOA 1PPFI 2SGPI 2QQ0A 1P9ZA 1TURA 1NUBA 1YU6C 2ENNA 1UHAA
chains in the Genus database with same CATH topology
1W4RA 3VDPA 2KCXA 2L8EA 5FUYA 1V1HA 3D00A 3GOXA 2LUYA 3B4VC 4HGUA 4L9MA 2V53A 2FNFX 3OXGA 3UGIA 4UXJA 4OVOA 1CGJI 1SGYI 1Y1CA 5FUVA 1BUSA 3SGQI 5FUWA 3SGBI 1IY6A 2F3CI 1AN1I 2E5RA 1CT4I 2NU1I 1SGRI 5EX0A 2J9RA 1KMAA 2KMOA 2L7XA 2UZ3A 1OMTA 2N52A 2LEOA 1XBTA 2B8TA 1HPTA 3E59A 1R79A 4FKDA 1SGEI 4UXHA 2NU3I 2GKVA 2JA1A 2ORWA 1IW4A 1TOTA 3QWPA 1RFHA 1V1IA 2ELIA 2SGFI 2ROWA 2WCYA 3UGDA 5HQ8A 1CE3A 1N13A 1CT0I 1KBFA 1TBQR 3TJQA 2YQPA 1TGSI 1PCEA 1Z7KB 2GVIA 2KMQA 2N1AB 2XRCA 3RU0A 2ENZA 1OVOA 2NU0I 2QQCA 5FUXA 1KBEA 5CCMA 2ARPF 3OVOA 2P6AC 2BUSA 2GKTI 1TIHA 2SGQI 2J87A 4A24A 3OXFA 3SEKC 2WVJA 1BMOA 2JXDA 1FARA 4SGBI 3KY9A 1XA6A 1LR9A 2SGDI 3UFFA 3E2IA 2ODDA 4UXIA 2JZMA 1CT2I 4GI3C 1SGPI 2KMPA 2QQEA 5DAEA 1XX6A 3MEKA 3UGLA 4E1PA 3BJIA 1X74A 3UEYA 1Y8FA 1FYBA 2ORVA 1LR8A 5EX3A 2K9HA 1Y1BA 1UUCA 1U5KA 1MT1A 1TUSA 5JHWC 3UEJA 4E1RA 2KMRA 3QTLD 2A20A 1LR7A 1SGNI 1SGDI 2E73A 2OD1A 1OYVI 1PTRA 2DIPA 2V1CA 5CCLA 1R0RI 2N17A 1DS3I 3OL0A 3PDNA 2QQDA 1M8CA 4JCVE 1IY5A 1FAQA 1OMUA 1SGQI 2VRWB 5HI7A 2JW6A 1TBOA 2NU4I 2V1CC 4B6DA 3FC3A 3HH2C 2DB6A 2W0TA 1HDLA 1PJUA 2GKRI 2SGEI 1PTQA 1CGII 2M5XA 1W3SA 3VE5A 3VDUA 2B0UC 2JYYA 1X4SA 2N71A 1TBNA 1CHOI 1HJAI 1H0ZA 3CXLA 2ERWA 2NU2I 1VDDA 1CSOI 1DS2I 3OXLA 1TBRR 2CJSC 1M8BA 2OVOA 1UVFA 1UVGA 1YTPA 2YUUA 2QPOA 1PPFI 2SGPI 2QQ0A 1TURA 1NUBA 1YU6C 2ENNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCX A;  4HGU A;  3B4V C;  2V53 A;  4OVO A;  1CGJ I;  1SGY I;  1Y1C A;  1BUS A;  3SGQ I;  3SGB I;  1IY6 A;  2F3C I;  1AN1 I;  1CT4 I;  2NU1 I;  1SGR I;  1KMA A;  2KMO A;  1OMT A;  2N52 A;  2LEO A;  1HPT A;  1SGE I;  2NU3 I;  2GKV A;  1IW4 A;  2SGF I;  2WCY A;  1CE3 A;  1N13 A;  1CT0 I;  1TBQ R;  3TJQ A;  1TGS I;  1PCE A;  1Z7K B;  2KMQ A;  2XRC A;  1OVO A;  2NU0 I;  2QQC A;  2ARP F;  3OVO A;  2P6A C;  2BUS A;  2GKT I;  1TIH A;  2SGQ I;  3SEK C;  1BMO A;  2JXD A;  4SGB I;  1LR9 A;  2SGD I;  2JZM A;  1CT2 I;  4GI3 C;  1SGP I;  2KMP A;  5DAE A;  1FYB A;  1LR8 A;  1Y1B A;  1UUC A;  5JHW C;  1MT1 A;  1TUS A;  2KMR A;  3QTL D;  1LR7 A;  1SGN I;  1SGD I;  1OYV I;  1R0R I;  2N17 A;  1DS3 I;  2QQD A;  1M8C A;  1IY5 A;  1OMU A;  1SGQ I;  2NU4 I;  3HH2 C;  1HDL A;  1PJU A;  2GKR I;  2SGE I;  1CGI I;  2M5X A;  2B0U C;  2JYY A;  2N71 A;  1CHO I;  1HJA I;  1H0Z A;  2ERW A;  2NU2 I;  1CSO I;  1DS2 I;  1TBR R;  1M8B A;  2OVO A;  1UVF A;  1UVG A;  1YTP A;  1PPF I;  2SGP I;  1TUR A;  1NUB A;  1YU6 C; 
#chains in the Genus database with same CATH topology
 1MJB A;  1W4R A;  3VDP A;  2KCX A;  2L8E A;  5FUY A;  1V1H A;  3D00 A;  3GOX A;  2LUY A;  1Q9B A;  3B4V C;  4HGU A;  2V53 A;  2FNF X;  3OXG A;  4L9M A;  2RIJ A;  3UGI A;  5J8F A;  1MJ9 A;  3FSY A;  1WKX A;  4UXJ A;  4OVO A;  1CGJ I;  1SGY I;  1Y1C A;  5FUV A;  1BUS A;  3SGQ I;  5FUW A;  3SGB I;  3TOA A;  1IY6 A;  2F3C I;  1AN1 I;  2E5R A;  1CT4 I;  2NU1 I;  1SGR I;  4AML A;  5EX0 A;  2J9R A;  1KMA A;  5E3P A;  3R5A A;  2KMO A;  2L7X A;  2UZ3 A;  1OMT A;  2N52 A;  2LEO A;  1XBT A;  2B8T A;  1HPT A;  3E59 A;  1R79 A;  4FKD A;  1SGE I;  4UXH A;  2NU3 I;  2GKV A;  1K7U A;  2JA1 A;  2ORW A;  4DNC A;  1S20 A;  1IW4 A;  1ULM A;  2GIV A;  1TOT A;  3QWP A;  1RFH A;  1V1I A;  2ELI A;  2LB7 A;  2ROW A;  2SGF I;  2WCY A;  1WGC A;  3UGD A;  2X3T A;  5HQ8 A;  1K7V A;  1N13 A;  2UVO A;  1CT0 I;  1CE3 A;  1HEV A;  1KBF A;  1TBQ R;  3TJQ A;  2YQP A;  3TO9 A;  1TGS I;  1PCE A;  1Z7K B;  2GVI A;  2KMQ A;  2N1A B;  3TO6 A;  2XRC A;  1WTJ A;  2ENZ A;  3R5C A;  1OVO A;  3R5D A;  3RU0 A;  2NU0 I;  2QQC A;  5FUX A;  1K7T A;  1KBE A;  2ARP F;  3OVO A;  3TO7 A;  2P6A C;  5CCM A;  2BUS A;  2GKT I;  1TIH A;  2SGQ I;  2J87 A;  4A24 A;  3OXF A;  3SEK C;  2WVJ A;  1BMO A;  2JXD A;  5E3Q A;  3TOB A;  1FAR A;  4SGB I;  3KY9 A;  1LR9 A;  1XA6 A;  2SGD I;  3UFF A;  1Z2I A;  1WGT A;  2ODD A;  3E2I A;  4UXI A;  2JZM A;  1CT2 I;  4GI3 C;  1SGP I;  2KMP A;  2QQE A;  4WP4 A;  1XX6 A;  2PQ8 A;  3MEK A;  4MPI A;  5DAE A;  3UGL A;  4E1P A;  3BJI A;  2CWF A;  2X52 A;  1X74 A;  3UEY A;  2OU2 A;  1Y8F A;  2DKV A;  1FYB A;  2ORV A;  1ULK A;  1LR8 A;  5EX3 A;  2Y0M A;  2K9H A;  1Y1B A;  1UUC A;  1U5K A;  1MT1 A;  1TUS A;  5JHW C;  3UEJ A;  4E1R A;  2KMR A;  2WGC A;  9WGA A;  3QTL D;  2A20 A;  1LR7 A;  1SGN I;  1MJA A;  1SGD I;  2E73 A;  2OD1 A;  1OYV I;  1PTR A;  2DIP A;  2V1C A;  5CCL A;  1R0R I;  2CWG A;  1DS3 I;  2CWH A;  2N17 A;  3OL0 A;  3PDN A;  2QQD A;  7WGA A;  1M8C A;  4JCV E;  1IY5 A;  1FAQ A;  1OMU A;  1SGQ I;  2VRW B;  5HI7 A;  2JW6 A;  1TBO A;  2NU4 I;  2V1C C;  4B6D A;  3FC3 A;  3HH2 C;  3UOE A;  2DB6 A;  2W0T A;  1HDL A;  1PJU A;  1NXU A;  1ULN A;  1PTQ A;  2GKR I;  1CGI I;  2M5X A;  1W3S A;  2RC4 A;  2SGE I;  3VDU A;  1P9G A;  3VE5 A;  2B0U C;  1FY7 A;  2JYY A;  1X4S A;  2N71 A;  1TBN A;  1CHO I;  1HJA I;  3QAH A;  1H0Z A;  3CXL A;  2ERW A;  2NU2 I;  3FSX A;  5E3R A;  1VDD A;  3R5B A;  5J8C A;  2OZU A;  1CSO I;  1DS2 I;  3OXL A;  1TBR R;  2CJS C;  1M8B A;  2OVO A;  1UVF A;  1UVG A;  1YTP A;  2YUU A;  2QPO A;  1PPF I;  2SGP I;  2QQ0 A;  1P9Z A;  1TUR A;  1NUB A;  1YU6 C;  2ENN A;  1UHA A; 
#chains in the Genus database with same CATH homology
 1W4R A;  3VDP A;  2KCX A;  2L8E A;  5FUY A;  1V1H A;  3D00 A;  3GOX A;  2LUY A;  3B4V C;  4HGU A;  4L9M A;  2V53 A;  2FNF X;  3OXG A;  3UGI A;  4UXJ A;  4OVO A;  1CGJ I;  1SGY I;  1Y1C A;  5FUV A;  1BUS A;  3SGQ I;  5FUW A;  3SGB I;  1IY6 A;  2F3C I;  1AN1 I;  2E5R A;  1CT4 I;  2NU1 I;  1SGR I;  5EX0 A;  2J9R A;  1KMA A;  2KMO A;  2L7X A;  2UZ3 A;  1OMT A;  2N52 A;  2LEO A;  1XBT A;  2B8T A;  1HPT A;  3E59 A;  1R79 A;  4FKD A;  1SGE I;  4UXH A;  2NU3 I;  2GKV A;  2JA1 A;  2ORW A;  1IW4 A;  1TOT A;  3QWP A;  1RFH A;  1V1I A;  2ELI A;  2SGF I;  2ROW A;  2WCY A;  3UGD A;  5HQ8 A;  1CE3 A;  1N13 A;  1CT0 I;  1KBF A;  1TBQ R;  3TJQ A;  2YQP A;  1TGS I;  1PCE A;  1Z7K B;  2GVI A;  2KMQ A;  2N1A B;  2XRC A;  3RU0 A;  2ENZ A;  1OVO A;  2NU0 I;  2QQC A;  5FUX A;  1KBE A;  5CCM A;  2ARP F;  3OVO A;  2P6A C;  2BUS A;  2GKT I;  1TIH A;  2SGQ I;  2J87 A;  4A24 A;  3OXF A;  3SEK C;  2WVJ A;  1BMO A;  2JXD A;  1FAR A;  4SGB I;  3KY9 A;  1XA6 A;  1LR9 A;  2SGD I;  3UFF A;  3E2I A;  2ODD A;  4UXI A;  2JZM A;  1CT2 I;  4GI3 C;  1SGP I;  2KMP A;  2QQE A;  5DAE A;  1XX6 A;  3MEK A;  3UGL A;  4E1P A;  3BJI A;  1X74 A;  3UEY A;  1Y8F A;  1FYB A;  2ORV A;  1LR8 A;  5EX3 A;  2K9H A;  1Y1B A;  1UUC A;  1U5K A;  1MT1 A;  1TUS A;  5JHW C;  3UEJ A;  4E1R A;  2KMR A;  3QTL D;  2A20 A;  1LR7 A;  1SGN I;  1SGD I;  2E73 A;  2OD1 A;  1OYV I;  1PTR A;  2DIP A;  2V1C A;  5CCL A;  1R0R I;  2N17 A;  1DS3 I;  3OL0 A;  3PDN A;  2QQD A;  1M8C A;  4JCV E;  1IY5 A;  1FAQ A;  1OMU A;  1SGQ I;  2VRW B;  5HI7 A;  2JW6 A;  1TBO A;  2NU4 I;  2V1C C;  4B6D A;  3FC3 A;  3HH2 C;  2DB6 A;  2W0T A;  1HDL A;  1PJU A;  2GKR I;  2SGE I;  1PTQ A;  1CGI I;  2M5X A;  1W3S A;  3VE5 A;  3VDU A;  2B0U C;  2JYY A;  1X4S A;  2N71 A;  1TBN A;  1CHO I;  1HJA I;  1H0Z A;  3CXL A;  2ERW A;  2NU2 I;  1VDD A;  1CSO I;  1DS2 I;  3OXL A;  1TBR R;  2CJS C;  1M8B A;  2OVO A;  1UVF A;  1UVG A;  1YTP A;  2YUU A;  2QPO A;  1PPF I;  2SGP I;  2QQ0 A;  1TUR A;  1NUB A;  1YU6 C;  2ENN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...