1HEVA

Hevein: the nmr assignment and an assessment of solution-state folding for the agglutinin-toxin motif
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
43
structure length
43
Chain Sequence
b'EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEVEIN
publication title Hevein: NMR assignment and assessment of solution-state folding for the agglutinin-toxin motif.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lectin
total genus 10
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1993-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1hevA00
1K7UA 2CWGA 1WGCA 1WKXA 1UHAA 4MPIA 9WGAA 1ULNA 2DKVA 1K7VA 2X52A 2X3TA 1P9ZA 2UVOA 7WGAA 2LB7A 4AMLA 1Q9BA 1P9GA 4WP4A 1HEVA 1WGTA 1ULMA 2WGCA 1ULKA 1K7TA
chains in the Genus database with same CATH superfamily
3D00A 1HPTA 1WGCA 2J87A 2ENZA 2LUYA 1RFHA 5CCMA 2NU1I 2DKVA 2GIVA 1CT2I 3KY9A 1NXUA 2SGEI 2ORVA 3VE5A 1IW4A 3RU0A 1R0RI 1MJBA 3FSYA 3QWPA 1WTJA 1Z2IA 1OMTA 5FUVA 2X3TA 2DIPA 1VDDA 1TBQR 2RC4A 1FYBA 1KBFA 2CWFA 1BMOA 2JYYA 5EX0A 3UGIA 2OU2A 1AN1I 2PQ8A 1P9GA 1KBEA 1NUBA 1MJAA 1Y8FA 2JW6A 1CE3A 4L9MA 2SGPI 2OD1A 2CJSC 2NU2I 1SGRI 3HH2C 2YUUA 2GKTI 1PCEA 1ULMA 3OXLA 5FUXA 3TO9A 3UEYA 5J8FA 5J8CA 1ULKA 1OYVI 1Y1BA 5HI7A 4UXHA 1KMAA 2CWGA 2V1CC 2B8TA 3R5BA 2GVIA 1LR9A 2ELIA 1CT4I 1WKXA 3QTLD 1TOTA 4SGBI 2QPOA 5E3QA 1TURA 2QQCA 2OZUA 3SGBI 1V1HA 1K7VA 2ROWA 2X52A 5E3PA 3VDPA 1SGNI 2B0UC 2V1CA 1PJUA 2M5XA 2QQDA 2UZ3A 2KCXA 3E2IA 4A24A 1W4RA 2P6AC 1CSOI 2KMQA 1Q9BA 2VRWB 3R5AA 1W3SA 2ODDA 1XBTA 3SGQI 1SGQI 2YQPA 2SGFI 1TUSA 5EX3A 4UXJA 3TJQA 1BUSA 1HEVA 3TO6A 1CGJI 1PTQA 1UVGA 1MJ9A 4OVOA 1K7TA 1UVFA 2NU0I 1TIHA 1M8CA 2CWHA 3PDNA 2BUSA 2SGDI 1DS2I 1R79A 1SGDI 2JZMA 1IY6A 2GKRI 3UGDA 5DAEA 5CCLA 2J9RA 5HQ8A 1IY5A 4JCVE 1SGPI 1YTPA 1TGSI 2DB6A 2E5RA 2ORWA 1FAQA 1P9ZA 1DS3I 3OXGA 2V53A 3TO7A 2LB7A 7WGAA 2N1AB 1X74A 4AMLA 1N13A 2ARPF 1M8BA 1TBNA 3OXFA 4DNCA 1Y1CA 1WGTA 2K9HA 2WGCA 3GOXA 1CGII 1YU6C 2RIJA 2L8EA 3UFFA 1K7UA 2F3CI 3B4VC 4E1RA 3OL0A 3MEKA 3QAHA 1UHAA 1SGYI 4MPIA 1X4SA 3R5DA 2WVJA 2N71A 1ULNA 2W0TA 1TBRR 3R5CA 9WGAA 2ERWA 1V1IA 2L7XA 2QQEA 4UXIA 5FUYA 4B6DA 1H0ZA 1CT0I 1U5KA 2Y0MA 4HGUA 5E3RA 2NU3I 4E1PA 1UUCA 2OVOA 3CXLA 3TOBA 1OMUA 3VDUA 1SGEI 2LEOA 2WCYA 1MT1A 2KMRA 2XRCA 1PPFI 2N52A 4GI3C 5JHWC 1LR8A 2KMPA 2ENNA 3OVOA 1XA6A 1S20A 2UVOA 2KMOA 1FARA 2QQ0A 3FSXA 5FUWA 3TOAA 3UGLA 3FC3A 1XX6A 1FY7A 1TBOA 1Z7KB 2E73A 2NU4I 3SEKC 4WP4A 2SGQI 3BJIA 1HDLA 1HJAI 2FNFX 2JXDA 1LR7A 2N17A 1CHOI 4FKDA 2JA1A 3UEJA 2A20A 3UOEA 2GKVA 3E59A 1PTRA 1OVOA
chains in the Genus database with same CATH topology
1K7UA 2CWGA 1WGCA 1WKXA 1UHAA 4MPIA 9WGAA 1ULNA 2DKVA 1K7VA 2X52A 2X3TA 1P9ZA 2UVOA 7WGAA 2LB7A 4AMLA 1Q9BA 1P9GA 4WP4A 1HEVA 1WGTA 1ULMA 2WGCA 1ULKA 1K7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K7U A;  2CWG A;  1WGC A;  1WKX A;  1UHA A;  4MPI A;  9WGA A;  1ULN A;  2DKV A;  1K7V A;  2X52 A;  2X3T A;  1P9Z A;  2UVO A;  7WGA A;  2LB7 A;  4AML A;  1Q9B A;  1P9G A;  4WP4 A;  1HEV A;  1WGT A;  1ULM A;  2WGC A;  1ULK A;  1K7T A; 
#chains in the Genus database with same CATH topology
 3D00 A;  1HPT A;  1WGC A;  2J87 A;  2ENZ A;  2LUY A;  1RFH A;  5CCM A;  2NU1 I;  2DKV A;  2GIV A;  1CT2 I;  3KY9 A;  1NXU A;  2SGE I;  2ORV A;  3VE5 A;  1IW4 A;  3RU0 A;  1R0R I;  1MJB A;  3FSY A;  3QWP A;  1WTJ A;  1Z2I A;  1OMT A;  5FUV A;  2X3T A;  2DIP A;  1VDD A;  1TBQ R;  2RC4 A;  1FYB A;  1KBF A;  2CWF A;  1BMO A;  2JYY A;  5EX0 A;  3UGI A;  2OU2 A;  1AN1 I;  2PQ8 A;  1P9G A;  1KBE A;  1NUB A;  1MJA A;  1Y8F A;  2JW6 A;  1CE3 A;  4L9M A;  2SGP I;  2OD1 A;  2CJS C;  2NU2 I;  1SGR I;  3HH2 C;  2YUU A;  2GKT I;  1PCE A;  1ULM A;  3OXL A;  5FUX A;  3TO9 A;  3UEY A;  5J8F A;  5J8C A;  1ULK A;  1OYV I;  1Y1B A;  5HI7 A;  4UXH A;  1KMA A;  2CWG A;  2V1C C;  2B8T A;  3R5B A;  2GVI A;  1LR9 A;  2ELI A;  1CT4 I;  1WKX A;  3QTL D;  1TOT A;  4SGB I;  2QPO A;  5E3Q A;  1TUR A;  2QQC A;  2OZU A;  3SGB I;  1V1H A;  1K7V A;  2ROW A;  2X52 A;  5E3P A;  3VDP A;  1SGN I;  2B0U C;  2V1C A;  1PJU A;  2M5X A;  2QQD A;  2UZ3 A;  2KCX A;  3E2I A;  4A24 A;  1W4R A;  2P6A C;  1CSO I;  2KMQ A;  1Q9B A;  2VRW B;  3R5A A;  1W3S A;  2ODD A;  1XBT A;  3SGQ I;  1SGQ I;  2YQP A;  2SGF I;  1TUS A;  5EX3 A;  4UXJ A;  3TJQ A;  1BUS A;  1HEV A;  3TO6 A;  1CGJ I;  1PTQ A;  1UVG A;  1MJ9 A;  4OVO A;  1K7T A;  1UVF A;  2NU0 I;  1TIH A;  1M8C A;  2CWH A;  3PDN A;  2BUS A;  2SGD I;  1DS2 I;  1R79 A;  1SGD I;  2JZM A;  1IY6 A;  2GKR I;  3UGD A;  5DAE A;  5CCL A;  2J9R A;  5HQ8 A;  1IY5 A;  4JCV E;  1SGP I;  1YTP A;  1TGS I;  2DB6 A;  2E5R A;  2ORW A;  1FAQ A;  1P9Z A;  1DS3 I;  3OXG A;  2V53 A;  3TO7 A;  2LB7 A;  7WGA A;  2N1A B;  1X74 A;  4AML A;  1N13 A;  2ARP F;  1M8B A;  1TBN A;  3OXF A;  4DNC A;  1Y1C A;  1WGT A;  2K9H A;  2WGC A;  3GOX A;  1CGI I;  1YU6 C;  2RIJ A;  2L8E A;  3UFF A;  1K7U A;  2F3C I;  3B4V C;  4E1R A;  3OL0 A;  3MEK A;  3QAH A;  1UHA A;  1SGY I;  4MPI A;  1X4S A;  3R5D A;  2WVJ A;  2N71 A;  1ULN A;  2W0T A;  1TBR R;  3R5C A;  9WGA A;  2ERW A;  1V1I A;  2L7X A;  2QQE A;  4UXI A;  5FUY A;  4B6D A;  1H0Z A;  1CT0 I;  1U5K A;  2Y0M A;  4HGU A;  5E3R A;  2NU3 I;  4E1P A;  1UUC A;  2OVO A;  3CXL A;  3TOB A;  1OMU A;  3VDU A;  1SGE I;  2LEO A;  2WCY A;  1MT1 A;  2KMR A;  2XRC A;  1PPF I;  2N52 A;  4GI3 C;  5JHW C;  1LR8 A;  2KMP A;  2ENN A;  3OVO A;  1XA6 A;  1S20 A;  2UVO A;  2KMO A;  1FAR A;  2QQ0 A;  3FSX A;  5FUW A;  3TOA A;  3UGL A;  3FC3 A;  1XX6 A;  1FY7 A;  1TBO A;  1Z7K B;  2E73 A;  2NU4 I;  3SEK C;  4WP4 A;  2SGQ I;  3BJI A;  1HDL A;  1HJA I;  2FNF X;  2JXD A;  1LR7 A;  2N17 A;  1CHO I;  4FKD A;  2JA1 A;  3UEJ A;  2A20 A;  3UOE A;  2GKV A;  3E59 A;  1PTR A;  1OVO A; 
#chains in the Genus database with same CATH homology
 1K7U A;  2CWG A;  1WGC A;  1WKX A;  1UHA A;  4MPI A;  9WGA A;  1ULN A;  2DKV A;  1K7V A;  2X52 A;  2X3T A;  1P9Z A;  2UVO A;  7WGA A;  2LB7 A;  4AML A;  1Q9B A;  1P9G A;  4WP4 A;  1HEV A;  1WGT A;  1ULM A;  2WGC A;  1ULK A;  1K7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...