1HEVA

Hevein: the nmr assignment and an assessment of solution-state folding for the agglutinin-toxin motif
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
43
structure length
43
Chain Sequence
EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEVEIN
publication title Hevein: NMR assignment and assessment of solution-state folding for the agglutinin-toxin motif.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lectin
total genus 10
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1993-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1hevA00
1P9GA 2UVOA 4WP4A 1WGTA 1K7VA 1WKXA 4AMLA 1ULKA 2X3TA 1HEVA 1ULMA 1UHAA 2X52A 1WGCA 2CWGA 9WGAA 4MPIA 2DKVA 2WGCA 1Q9BA 7WGAA 1K7TA 1ULNA 1P9ZA 1K7UA 2LB7A
chains in the Genus database with same CATH superfamily
5DAEA 1MJ9A 2DIPA 1HDLA 1AN1I 1NUBA 1X4SA 2K9HA 2N71A 4FKDA 2OZUA 1KBFA 1CGJI 1WKXA 1CT4I 2KMPA 1XX6A 5FUVA 1FAQA 2ELIA 2RC4A 4SGBI 1OYVI 1MJAA 2X3TA 2YQPA 2XRCA 1TGSI 3OXFA 5EX0A 3RU0A 2Y0MA 1DS2I 1FYBA 1R0RI 2QQEA 1OMUA 2OD1A 2X52A 1WTJA 1FY7A 2CWGA 1PTQA 2JW6A 2B8TA 4UXJA 1TBRR 1H0ZA 2E73A 2KCXA 2FNFX 3TOBA 1W4RA 1TURA 1PTRA 2JXDA 1PCEA 2L7XA 2ORVA 2YUUA 1V1IA 3CXLA 3VDPA 2WGCA 5JHWC 1Z2IA 2UZ3A 4UXIA 1MT1A 3HH2C 2W0TA 4A24A 1IW4A 1P9ZA 3B4VC 3FSXA 3OXGA 2KMOA 5CCLA 1TBQR 2LB7A 3R5AA 2N52A 4HGUA 2V53A 1NXUA 2WVJA 3UGIA 1SGPI 2ERWA 5FUWA 4E1RA 3QTLD 1YU6C 2OU2A 4AMLA 1M8CA 2SGQI 3E59A 3VDUA 1HPTA 2ENNA 2P6AC 1HEVA 1CT2I 1U5KA 2M5XA 2NU2I 2SGDI 4UXHA 3SGQI 1BUSA 1CE3A 2N1AB 1TIHA 1FARA 3BJIA 2GKTI 1MJBA 1UVFA 3TO9A 2F3CI 1Q9BA 1R79A 1TOTA 2CWHA 1K7TA 1UUCA 1TBOA 3E2IA 2QPOA 3R5CA 2JZMA 3UFFA 3VE5A 2V1CA 5J8FA 3TO6A 1V1HA 5FUXA 1OMTA 2J87A 1SGDI 2B0UC 3QWPA 4WP4A 5E3PA 5CCMA 3R5BA 3MEKA 1LR8A 1WGTA 3OVOA 1Y8FA 2J9RA 3PDNA 5J8CA 1RFHA 1TBNA 1M8BA 1LR9A 1XA6A 1CHOI 1UHAA 1OVOA 1ULMA 2L8EA 2OVOA 1S20A 1CT0I 5FUYA 1CSOI 1XBTA 3UEYA 3UEJA 3SGBI 3OL0A 1CGII 4B6DA 2ROWA 2DB6A 3D00A 1Y1BA 3GOXA 5HQ8A 4MPIA 2ARPF 2NU0I 3UOEA 3FC3A 2DKVA 1HJAI 3KY9A 1KBEA 2RIJA 2V1CC 2LEOA 3FSYA 7WGAA 2A20A 1ULNA 2NU3I 2QQ0A 2NU4I 2GIVA 2ENZA 2JA1A 2GKVA 1SGRI 1K7UA 1SGQI 2SGFI 1PJUA 3QAHA 3R5DA 4GI3C 5E3QA 3TOAA 1SGNI 1P9GA 2N17A 2UVOA 2BUSA 2GVIA 1K7VA 5HI7A 1LR7A 2LUYA 2WCYA 1ULKA 2E5RA 3UGLA 1W3SA 1N13A 1UVGA 1Y1CA 2SGPI 2QQDA 2ORWA 2QQCA 4JCVE 2KMQA 1YTPA 1PPFI 4OVOA 2GKRI 1WGCA 4E1PA 4L9MA 2NU1I 3TO7A 9WGAA 2KMRA 3TJQA 1IY6A 2JYYA 1SGEI 1SGYI 1IY5A 2CJSC 1X74A 3UGDA 1KMAA 2CWFA 3SEKC 2VRWB 1BMOA 1DS3I 1TUSA 4DNCA 2PQ8A 3OXLA 5E3RA 2ODDA 5EX3A 2SGEI 1VDDA 1Z7KB
chains in the Genus database with same CATH topology
1P9GA 2UVOA 4WP4A 1WGTA 1K7VA 1WKXA 4AMLA 1ULKA 2X3TA 1HEVA 1ULMA 1UHAA 2X52A 1WGCA 2CWGA 9WGAA 4MPIA 2DKVA 2WGCA 1Q9BA 7WGAA 1K7TA 1ULNA 1P9ZA 1K7UA 2LB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P9G A;  2UVO A;  4WP4 A;  1WGT A;  1K7V A;  1WKX A;  4AML A;  1ULK A;  2X3T A;  1HEV A;  1ULM A;  1UHA A;  2X52 A;  1WGC A;  2CWG A;  9WGA A;  4MPI A;  2DKV A;  2WGC A;  1Q9B A;  7WGA A;  1K7T A;  1ULN A;  1P9Z A;  1K7U A;  2LB7 A; 
#chains in the Genus database with same CATH topology
 5DAE A;  1MJ9 A;  2DIP A;  1HDL A;  1AN1 I;  1NUB A;  1X4S A;  2K9H A;  2N71 A;  4FKD A;  2OZU A;  1KBF A;  1CGJ I;  1WKX A;  1CT4 I;  2KMP A;  1XX6 A;  5FUV A;  1FAQ A;  2ELI A;  2RC4 A;  4SGB I;  1OYV I;  1MJA A;  2X3T A;  2YQP A;  2XRC A;  1TGS I;  3OXF A;  5EX0 A;  3RU0 A;  2Y0M A;  1DS2 I;  1FYB A;  1R0R I;  2QQE A;  1OMU A;  2OD1 A;  2X52 A;  1WTJ A;  1FY7 A;  2CWG A;  1PTQ A;  2JW6 A;  2B8T A;  4UXJ A;  1TBR R;  1H0Z A;  2E73 A;  2KCX A;  2FNF X;  3TOB A;  1W4R A;  1TUR A;  1PTR A;  2JXD A;  1PCE A;  2L7X A;  2ORV A;  2YUU A;  1V1I A;  3CXL A;  3VDP A;  2WGC A;  5JHW C;  1Z2I A;  2UZ3 A;  4UXI A;  1MT1 A;  3HH2 C;  2W0T A;  4A24 A;  1IW4 A;  1P9Z A;  3B4V C;  3FSX A;  3OXG A;  2KMO A;  5CCL A;  1TBQ R;  2LB7 A;  3R5A A;  2N52 A;  4HGU A;  2V53 A;  1NXU A;  2WVJ A;  3UGI A;  1SGP I;  2ERW A;  5FUW A;  4E1R A;  3QTL D;  1YU6 C;  2OU2 A;  4AML A;  1M8C A;  2SGQ I;  3E59 A;  3VDU A;  1HPT A;  2ENN A;  2P6A C;  1HEV A;  1CT2 I;  1U5K A;  2M5X A;  2NU2 I;  2SGD I;  4UXH A;  3SGQ I;  1BUS A;  1CE3 A;  2N1A B;  1TIH A;  1FAR A;  3BJI A;  2GKT I;  1MJB A;  1UVF A;  3TO9 A;  2F3C I;  1Q9B A;  1R79 A;  1TOT A;  2CWH A;  1K7T A;  1UUC A;  1TBO A;  3E2I A;  2QPO A;  3R5C A;  2JZM A;  3UFF A;  3VE5 A;  2V1C A;  5J8F A;  3TO6 A;  1V1H A;  5FUX A;  1OMT A;  2J87 A;  1SGD I;  2B0U C;  3QWP A;  4WP4 A;  5E3P A;  5CCM A;  3R5B A;  3MEK A;  1LR8 A;  1WGT A;  3OVO A;  1Y8F A;  2J9R A;  3PDN A;  5J8C A;  1RFH A;  1TBN A;  1M8B A;  1LR9 A;  1XA6 A;  1CHO I;  1UHA A;  1OVO A;  1ULM A;  2L8E A;  2OVO A;  1S20 A;  1CT0 I;  5FUY A;  1CSO I;  1XBT A;  3UEY A;  3UEJ A;  3SGB I;  3OL0 A;  1CGI I;  4B6D A;  2ROW A;  2DB6 A;  3D00 A;  1Y1B A;  3GOX A;  5HQ8 A;  4MPI A;  2ARP F;  2NU0 I;  3UOE A;  3FC3 A;  2DKV A;  1HJA I;  3KY9 A;  1KBE A;  2RIJ A;  2V1C C;  2LEO A;  3FSY A;  7WGA A;  2A20 A;  1ULN A;  2NU3 I;  2QQ0 A;  2NU4 I;  2GIV A;  2ENZ A;  2JA1 A;  2GKV A;  1SGR I;  1K7U A;  1SGQ I;  2SGF I;  1PJU A;  3QAH A;  3R5D A;  4GI3 C;  5E3Q A;  3TOA A;  1SGN I;  1P9G A;  2N17 A;  2UVO A;  2BUS A;  2GVI A;  1K7V A;  5HI7 A;  1LR7 A;  2LUY A;  2WCY A;  1ULK A;  2E5R A;  3UGL A;  1W3S A;  1N13 A;  1UVG A;  1Y1C A;  2SGP I;  2QQD A;  2ORW A;  2QQC A;  4JCV E;  2KMQ A;  1YTP A;  1PPF I;  4OVO A;  2GKR I;  1WGC A;  4E1P A;  4L9M A;  2NU1 I;  3TO7 A;  9WGA A;  2KMR A;  3TJQ A;  1IY6 A;  2JYY A;  1SGE I;  1SGY I;  1IY5 A;  2CJS C;  1X74 A;  3UGD A;  1KMA A;  2CWF A;  3SEK C;  2VRW B;  1BMO A;  1DS3 I;  1TUS A;  4DNC A;  2PQ8 A;  3OXL A;  5E3R A;  2ODD A;  5EX3 A;  2SGE I;  1VDD A;  1Z7K B; 
#chains in the Genus database with same CATH homology
 1P9G A;  2UVO A;  4WP4 A;  1WGT A;  1K7V A;  1WKX A;  4AML A;  1ULK A;  2X3T A;  1HEV A;  1ULM A;  1UHA A;  2X52 A;  1WGC A;  2CWG A;  9WGA A;  4MPI A;  2DKV A;  2WGC A;  1Q9B A;  7WGA A;  1K7T A;  1ULN A;  1P9Z A;  1K7U A;  2LB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...