1HEVA

Hevein: the nmr assignment and an assessment of solution-state folding for the agglutinin-toxin motif
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
43
structure length
43
Chain Sequence
EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords HEVEIN
publication title Hevein: NMR assignment and assessment of solution-state folding for the agglutinin-toxin motif.
pubmed doi rcsb
source organism Hevea brasiliensis
total genus 10
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1993-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1hevA00
1ULKA 2CWGA 1P9ZA 1WGCA 1Q9BA 2UVOA 4MPIA 2X3TA 4WP4A 1ULNA 1K7VA 1P9GA 9WGAA 2DKVA 2WGCA 1HEVA 2LB7A 2X52A 1WGTA 1K7UA 4AMLA 7WGAA 1UHAA 1ULMA 1WKXA 1K7TA
chains in the Genus database with same CATH superfamily
3VDUA 2JYYA 2ORWA 2F3CI 2ODDA 3R5BA 1PJUA 3QWPA 1KBEA 1CSOI 1S20A 1PPFI 1WTJA 1M8CA 2SGPI 4OVOA 2JW6A 3UFFA 1OVOA 1Q9BA 4MPIA 1YU6C 1CE3A 1TIHA 4FKDA 1Z7KB 1CT0I 2QQDA 2VRWB 1SGRI 2WVJA 3B4VC 1TURA 3TOAA 3UEYA 2B8TA 2JXDA 1P9GA 4L9MA 3OVOA 1TOTA 3D00A 2FNFX 3HH2C 2KMRA 2NU0I 3FSXA 5HQ8A 2LB7A 2X52A 1IY5A 1R79A 4DNCA 1FAQA 2E73A 3UGLA 1SGEI 1CGII 1Y8FA 2DB6A 1SGDI 5E3PA 1MJAA 1W4RA 3UGDA 1TBNA 5E3QA 3BJIA 5FUVA 5HI7A 3TO7A 5CCMA 2CWHA 1TBOA 2GKTI 2SGEI 1X4SA 2N17A 2ARPF 1V1HA 1K7TA 2NU3I 2J9RA 4E1PA 5J8CA 5CCLA 1X74A 2V1CC 2KCXA 1DS3I 1HJAI 1OYVI 2GVIA 1FY7A 3R5DA 2QQCA 1W3SA 1CT2I 2UVOA 4GI3C 1ULNA 2BUSA 5J8FA 1BMOA 1M8BA 1SGQI 2M5XA 2V53A 9WGAA 2GIVA 1HDLA 2K9HA 4JCVE 1MT1A 2B0UC 2LUYA 2SGQI 1DS2I 2E5RA 2QQ0A 2ERWA 1WGTA 5FUWA 1KMAA 3OXFA 2L8EA 1MJ9A 2CJSC 2QPOA 1PCEA 1VDDA 2KMQA 7WGAA 2LEOA 1CHOI 3CXLA 2WCYA 2V1CA 3RU0A 2KMPA 2UZ3A 1RFHA 1XA6A 2ROWA 1CT4I 1ULKA 2RIJA 4A24A 1XX6A 1R0RI 4UXJA 1SGYI 4HGUA 1PTRA 1FARA 1FYBA 1V1IA 3OXLA 5EX3A 1OMUA 2OZUA 1NUBA 2N71A 3VDPA 1LR7A 2J87A 2JA1A 3R5CA 3TO9A 1MJBA 4UXHA 5E3RA 3FC3A 2WGCA 2P6AC 1HEVA 1CGJI 2SGDI 5DAEA 5FUYA 4B6DA 3OXGA 1LR9A 2DIPA 2OD1A 3MEKA 1Z2IA 2GKVA 2YUUA 1K7UA 1IW4A 3E2IA 1UUCA 1TBRR 1TBQR 1AN1I 1TGSI 1WKXA 1BUSA 1TUSA 3UGIA 4E1RA 3TO6A 2W0TA 4SGBI 2NU1I 3TJQA 2A20A 3TOBA 1Y1BA 2CWGA 2OVOA 3E59A 4UXIA 1P9ZA 2QQEA 1WGCA 2ENNA 3OL0A 2NU2I 2OU2A 3QTLD 2NU4I 4WP4A 2X3TA 1OMTA 2Y0MA 3R5AA 3PDNA 2N52A 2ELIA 1XBTA 1K7VA 2N1AB 2PQ8A 2ENZA 3SEKC 1UVGA 1PTQA 5EX0A 3SGBI 3GOXA 3UOEA 1H0ZA 2DKVA 1SGPI 1U5KA 1YTPA 3QAHA 1IY6A 3VE5A 1HPTA 1UVFA 2JZMA 1N13A 2SGFI 3UEJA 1NXUA 2GKRI 2XRCA 2KMOA 2ORVA 3SGQI 3FSYA 4AMLA 1SGNI 1LR8A 5FUXA 1UHAA 5JHWC 2CWFA 1KBFA 2YQPA 1ULMA 1Y1CA 3KY9A 2RC4A 2L7XA
chains in the Genus database with same CATH topology
1ULKA 2CWGA 1P9ZA 1WGCA 1Q9BA 2UVOA 4MPIA 2X3TA 4WP4A 1ULNA 1K7VA 1P9GA 9WGAA 2DKVA 2WGCA 1HEVA 2LB7A 2X52A 1WGTA 1K7UA 4AMLA 7WGAA 1UHAA 1ULMA 1WKXA 1K7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULK A;  2CWG A;  1P9Z A;  1WGC A;  1Q9B A;  2UVO A;  4MPI A;  2X3T A;  4WP4 A;  1ULN A;  1K7V A;  1P9G A;  9WGA A;  2DKV A;  2WGC A;  1HEV A;  2LB7 A;  2X52 A;  1WGT A;  1K7U A;  4AML A;  7WGA A;  1UHA A;  1ULM A;  1WKX A;  1K7T A; 
#chains in the Genus database with same CATH topology
 3VDU A;  2JYY A;  2ORW A;  2F3C I;  2ODD A;  3R5B A;  1PJU A;  3QWP A;  1KBE A;  1CSO I;  1S20 A;  1PPF I;  1WTJ A;  1M8C A;  2SGP I;  4OVO A;  2JW6 A;  3UFF A;  1OVO A;  1Q9B A;  4MPI A;  1YU6 C;  1CE3 A;  1TIH A;  4FKD A;  1Z7K B;  1CT0 I;  2QQD A;  2VRW B;  1SGR I;  2WVJ A;  3B4V C;  1TUR A;  3TOA A;  3UEY A;  2B8T A;  2JXD A;  1P9G A;  4L9M A;  3OVO A;  1TOT A;  3D00 A;  2FNF X;  3HH2 C;  2KMR A;  2NU0 I;  3FSX A;  5HQ8 A;  2LB7 A;  2X52 A;  1IY5 A;  1R79 A;  4DNC A;  1FAQ A;  2E73 A;  3UGL A;  1SGE I;  1CGI I;  1Y8F A;  2DB6 A;  1SGD I;  5E3P A;  1MJA A;  1W4R A;  3UGD A;  1TBN A;  5E3Q A;  3BJI A;  5FUV A;  5HI7 A;  3TO7 A;  5CCM A;  2CWH A;  1TBO A;  2GKT I;  2SGE I;  1X4S A;  2N17 A;  2ARP F;  1V1H A;  1K7T A;  2NU3 I;  2J9R A;  4E1P A;  5J8C A;  5CCL A;  1X74 A;  2V1C C;  2KCX A;  1DS3 I;  1HJA I;  1OYV I;  2GVI A;  1FY7 A;  3R5D A;  2QQC A;  1W3S A;  1CT2 I;  2UVO A;  4GI3 C;  1ULN A;  2BUS A;  5J8F A;  1BMO A;  1M8B A;  1SGQ I;  2M5X A;  2V53 A;  9WGA A;  2GIV A;  1HDL A;  2K9H A;  4JCV E;  1MT1 A;  2B0U C;  2LUY A;  2SGQ I;  1DS2 I;  2E5R A;  2QQ0 A;  2ERW A;  1WGT A;  5FUW A;  1KMA A;  3OXF A;  2L8E A;  1MJ9 A;  2CJS C;  2QPO A;  1PCE A;  1VDD A;  2KMQ A;  7WGA A;  2LEO A;  1CHO I;  3CXL A;  2WCY A;  2V1C A;  3RU0 A;  2KMP A;  2UZ3 A;  1RFH A;  1XA6 A;  2ROW A;  1CT4 I;  1ULK A;  2RIJ A;  4A24 A;  1XX6 A;  1R0R I;  4UXJ A;  1SGY I;  4HGU A;  1PTR A;  1FAR A;  1FYB A;  1V1I A;  3OXL A;  5EX3 A;  1OMU A;  2OZU A;  1NUB A;  2N71 A;  3VDP A;  1LR7 A;  2J87 A;  2JA1 A;  3R5C A;  3TO9 A;  1MJB A;  4UXH A;  5E3R A;  3FC3 A;  2WGC A;  2P6A C;  1HEV A;  1CGJ I;  2SGD I;  5DAE A;  5FUY A;  4B6D A;  3OXG A;  1LR9 A;  2DIP A;  2OD1 A;  3MEK A;  1Z2I A;  2GKV A;  2YUU A;  1K7U A;  1IW4 A;  3E2I A;  1UUC A;  1TBR R;  1TBQ R;  1AN1 I;  1TGS I;  1WKX A;  1BUS A;  1TUS A;  3UGI A;  4E1R A;  3TO6 A;  2W0T A;  4SGB I;  2NU1 I;  3TJQ A;  2A20 A;  3TOB A;  1Y1B A;  2CWG A;  2OVO A;  3E59 A;  4UXI A;  1P9Z A;  2QQE A;  1WGC A;  2ENN A;  3OL0 A;  2NU2 I;  2OU2 A;  3QTL D;  2NU4 I;  4WP4 A;  2X3T A;  1OMT A;  2Y0M A;  3R5A A;  3PDN A;  2N52 A;  2ELI A;  1XBT A;  1K7V A;  2N1A B;  2PQ8 A;  2ENZ A;  3SEK C;  1UVG A;  1PTQ A;  5EX0 A;  3SGB I;  3GOX A;  3UOE A;  1H0Z A;  2DKV A;  1SGP I;  1U5K A;  1YTP A;  3QAH A;  1IY6 A;  3VE5 A;  1HPT A;  1UVF A;  2JZM A;  1N13 A;  2SGF I;  3UEJ A;  1NXU A;  2GKR I;  2XRC A;  2KMO A;  2ORV A;  3SGQ I;  3FSY A;  4AML A;  1SGN I;  1LR8 A;  5FUX A;  1UHA A;  5JHW C;  2CWF A;  1KBF A;  2YQP A;  1ULM A;  1Y1C A;  3KY9 A;  2RC4 A;  2L7X A; 
#chains in the Genus database with same CATH homology
 1ULK A;  2CWG A;  1P9Z A;  1WGC A;  1Q9B A;  2UVO A;  4MPI A;  2X3T A;  4WP4 A;  1ULN A;  1K7V A;  1P9G A;  9WGA A;  2DKV A;  2WGC A;  1HEV A;  2LB7 A;  2X52 A;  1WGT A;  1K7U A;  4AML A;  7WGA A;  1UHA A;  1ULM A;  1WKX A;  1K7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...