2L8EA

Solution nmr structure of fcs domain of human polyhomeotic homolog 1 (hph1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
49
structure length
49
Chain Sequence
GTRGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyhomeotic-like protein 1
publication title 1H, 15N and 13C assigned chemical shifts of FCS domain from human polyhomeotic homolog 1
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 9
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2011-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.160 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2l8eA00
2W0TA 2L8EA
chains in the Genus database with same CATH superfamily
3CXLA 1CE3A 1PJUA 2RIJA 3QTLD 3R5BA 5E3RA 1LR9A 2ROWA 2SGEI 3OVOA 4WP4A 1Z2IA 2N17A 5FUWA 5HI7A 1SGEI 3QAHA 5J8FA 5J8CA 4UXIA 2OVOA 3OXFA 1X4SA 2J87A 2QQCA 3E59A 1TBRR 4A24A 1OVOA 2GIVA 1WGTA 4JCVE 2DB6A 3UEJA 1SGPI 1NUBA 3PDNA 3UGLA 1LR7A 1PTQA 2NU0I 3R5CA 1PPFI 5CCLA 1V1IA 1DS2I 2B8TA 2JW6A 1K7TA 5JHWC 1CHOI 2M5XA 3QWPA 2XRCA 1IY6A 1Z7KB 2ELIA 3VDPA 1BUSA 1Y1BA 2B0UC 2WCYA 3SEKC 3UEYA 1CGII 2DIPA 1HDLA 1SGDI 2YQPA 3FC3A 2GKTI 1CT2I 3BJIA 1FAQA 1MJBA 2DKVA 1W3SA 2SGFI 2J9RA 4HGUA 1FYBA 1Q9BA 1WGCA 2QPOA 2CWGA 1R0RI 2F3CI 2ENNA 2OU2A 2GKVA 1AN1I 3FSXA 1TOTA 1XX6A 2BUSA 2OZUA 2JYYA 4E1PA 2RC4A 2N52A 2UZ3A 2NU1I 1YU6C 5E3PA 1CT0I 3D00A 1UHAA 5FUYA 3E2IA 1OYVI 1PTRA 3UOEA 1OMUA 5DAEA 1IW4A 4B6DA 1ULMA 2ENZA 3B4VC 4L9MA 1SGYI 2K9HA 2CWFA 2FNFX 2ORVA 2QQEA 1HJAI 1BMOA 2JZMA 3TOBA 1TBQR 1SGRI 2JA1A 3MEKA 5EX3A 1KBEA 5FUVA 5FUXA 1SGQI 1U5KA 3TJQA 1SGNI 1MJ9A 3UFFA 1H0ZA 2GVIA 5E3QA 1LR8A 3TO6A 2L8EA 2VRWB 3R5AA 3VDUA 1CT4I 1MJAA 3TOAA 1FY7A 2L7XA 1UVGA 1N13A 2LUYA 1KBFA 4UXHA 1TGSI 1HEVA 1NXUA 3OL0A 3SGBI 2NU2I 2SGDI 4AMLA 9WGAA 1VDDA 1RFHA 1TBOA 2ODDA 3TO9A 4OVOA 2E73A 1CGJI 1IY5A 1XBTA 1DS3I 2JXDA 1HPTA 1Y8FA 4GI3C 4UXJA 4E1RA 5HQ8A 2UVOA 2ORWA 2GKRI 1W4RA 2NU3I 4DNCA 1S20A 1P9ZA 1FARA 2Y0MA 3SGQI 2P6AC 3OXLA 1MT1A 1YTPA 2CWHA 2QQ0A 2QQDA 2E5RA 2WVJA 1K7UA 2CJSC 1TURA 1TUSA 1WTJA 1OMTA 2OD1A 2SGQI 1ULNA 2KMOA 2V1CA 2WGCA 2KMQA 3HH2C 3OXGA 4SGBI 1P9GA 2ARPF 1R79A 2KCXA 2N1AB 4MPIA 2ERWA 1UVFA 2KMRA 1PCEA 1K7VA 2LB7A 3RU0A 1ULKA 1UUCA 3UGIA 1V1HA 2X3TA 1WKXA 2V53A 2PQ8A 2NU4I 3KY9A 2N71A 3FSYA 1KMAA 1TBNA 1X74A 1TIHA 1CSOI 1XA6A 2V1CC 2YUUA 4FKDA 3TO7A 2LEOA 3UGDA 5CCMA 2X52A 7WGAA 1Y1CA 2KMPA 2SGPI 3R5DA 3GOXA 2W0TA 1M8CA 2A20A 1M8BA 3VE5A 5EX0A
chains in the Genus database with same CATH topology
3CXLA 1CE3A 1PJUA 3QTLD 1LR9A 2ROWA 2SGEI 3OVOA 2N17A 5FUWA 5HI7A 1SGEI 4UXIA 2OVOA 3OXFA 1X4SA 2J87A 2QQCA 3E59A 1TBRR 4A24A 1OVOA 4JCVE 2DB6A 3UEJA 1SGPI 1NUBA 3PDNA 3UGLA 1LR7A 1PTQA 2NU0I 1PPFI 5CCLA 1V1IA 1DS2I 2B8TA 2JW6A 5JHWC 1CHOI 2M5XA 3QWPA 2XRCA 1IY6A 1Z7KB 2ELIA 3VDPA 1BUSA 1Y1BA 2B0UC 2WCYA 3SEKC 1HDLA 1CGII 2DIPA 1SGDI 2YQPA 3FC3A 2GKTI 1CT2I 3BJIA 1FAQA 1FYBA 1W3SA 2SGFI 2J9RA 4HGUA 3UEYA 2QPOA 1R0RI 2F3CI 2ENNA 2GKVA 1AN1I 1TOTA 1XX6A 2BUSA 2JYYA 4E1PA 2N52A 2UZ3A 2NU1I 1YU6C 1CT0I 3D00A 5FUYA 3E2IA 1OYVI 1PTRA 1OMUA 5DAEA 1IW4A 4B6DA 2ENZA 3B4VC 4L9MA 1SGYI 2K9HA 2FNFX 2ORVA 2QQEA 1HJAI 1BMOA 2JZMA 1TBQR 1SGRI 2JA1A 3MEKA 5EX3A 1KBEA 5FUVA 5FUXA 1SGQI 1U5KA 3TJQA 1SGNI 3UFFA 1H0ZA 2GVIA 1LR8A 2L8EA 2VRWB 3VDUA 1CT4I 2L7XA 1UVGA 1N13A 2LUYA 1KBFA 4UXHA 1TGSI 3OL0A 3SGBI 2NU2I 2SGDI 1VDDA 1RFHA 1TBOA 2ODDA 4OVOA 2E73A 1CGJI 1IY5A 1XBTA 1DS3I 2JXDA 1HPTA 1Y8FA 4GI3C 4UXJA 4E1RA 5HQ8A 2ORWA 2GKRI 1W4RA 2NU3I 1FARA 3SGQI 2P6AC 3OXLA 1MT1A 1YTPA 2QQ0A 2QQDA 2E5RA 2WVJA 2CJSC 1TURA 1TUSA 1OMTA 2OD1A 2SGQI 2KMOA 2V1CA 3HH2C 2KMQA 3OXGA 4SGBI 2ARPF 1R79A 2KCXA 2N1AB 2ERWA 1UVFA 2KMRA 1PCEA 3RU0A 1UUCA 3UGIA 1V1HA 2V53A 2NU4I 3KY9A 2N71A 1KMAA 1TBNA 1X74A 1TIHA 1CSOI 1XA6A 2V1CC 2YUUA 4FKDA 3UGDA 2LEOA 5CCMA 1Y1CA 2KMPA 2SGPI 3GOXA 2W0TA 1M8CA 2A20A 1M8BA 3VE5A 5EX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0T A;  2L8E A; 
#chains in the Genus database with same CATH topology
 3CXL A;  1CE3 A;  1PJU A;  2RIJ A;  3QTL D;  3R5B A;  5E3R A;  1LR9 A;  2ROW A;  2SGE I;  3OVO A;  4WP4 A;  1Z2I A;  2N17 A;  5FUW A;  5HI7 A;  1SGE I;  3QAH A;  5J8F A;  5J8C A;  4UXI A;  2OVO A;  3OXF A;  1X4S A;  2J87 A;  2QQC A;  3E59 A;  1TBR R;  4A24 A;  1OVO A;  2GIV A;  1WGT A;  4JCV E;  2DB6 A;  3UEJ A;  1SGP I;  1NUB A;  3PDN A;  3UGL A;  1LR7 A;  1PTQ A;  2NU0 I;  3R5C A;  1PPF I;  5CCL A;  1V1I A;  1DS2 I;  2B8T A;  2JW6 A;  1K7T A;  5JHW C;  1CHO I;  2M5X A;  3QWP A;  2XRC A;  1IY6 A;  1Z7K B;  2ELI A;  3VDP A;  1BUS A;  1Y1B A;  2B0U C;  2WCY A;  3SEK C;  3UEY A;  1CGI I;  2DIP A;  1HDL A;  1SGD I;  2YQP A;  3FC3 A;  2GKT I;  1CT2 I;  3BJI A;  1FAQ A;  1MJB A;  2DKV A;  1W3S A;  2SGF I;  2J9R A;  4HGU A;  1FYB A;  1Q9B A;  1WGC A;  2QPO A;  2CWG A;  1R0R I;  2F3C I;  2ENN A;  2OU2 A;  2GKV A;  1AN1 I;  3FSX A;  1TOT A;  1XX6 A;  2BUS A;  2OZU A;  2JYY A;  4E1P A;  2RC4 A;  2N52 A;  2UZ3 A;  2NU1 I;  1YU6 C;  5E3P A;  1CT0 I;  3D00 A;  1UHA A;  5FUY A;  3E2I A;  1OYV I;  1PTR A;  3UOE A;  1OMU A;  5DAE A;  1IW4 A;  4B6D A;  1ULM A;  2ENZ A;  3B4V C;  4L9M A;  1SGY I;  2K9H A;  2CWF A;  2FNF X;  2ORV A;  2QQE A;  1HJA I;  1BMO A;  2JZM A;  3TOB A;  1TBQ R;  1SGR I;  2JA1 A;  3MEK A;  5EX3 A;  1KBE A;  5FUV A;  5FUX A;  1SGQ I;  1U5K A;  3TJQ A;  1SGN I;  1MJ9 A;  3UFF A;  1H0Z A;  2GVI A;  5E3Q A;  1LR8 A;  3TO6 A;  2L8E A;  2VRW B;  3R5A A;  3VDU A;  1CT4 I;  1MJA A;  3TOA A;  1FY7 A;  2L7X A;  1UVG A;  1N13 A;  2LUY A;  1KBF A;  4UXH A;  1TGS I;  1HEV A;  1NXU A;  3OL0 A;  3SGB I;  2NU2 I;  2SGD I;  4AML A;  9WGA A;  1VDD A;  1RFH A;  1TBO A;  2ODD A;  3TO9 A;  4OVO A;  2E73 A;  1CGJ I;  1IY5 A;  1XBT A;  1DS3 I;  2JXD A;  1HPT A;  1Y8F A;  4GI3 C;  4UXJ A;  4E1R A;  5HQ8 A;  2UVO A;  2ORW A;  2GKR I;  1W4R A;  2NU3 I;  4DNC A;  1S20 A;  1P9Z A;  1FAR A;  2Y0M A;  3SGQ I;  2P6A C;  3OXL A;  1MT1 A;  1YTP A;  2CWH A;  2QQ0 A;  2QQD A;  2E5R A;  2WVJ A;  1K7U A;  2CJS C;  1TUR A;  1TUS A;  1WTJ A;  1OMT A;  2OD1 A;  2SGQ I;  1ULN A;  2KMO A;  2V1C A;  2WGC A;  2KMQ A;  3HH2 C;  3OXG A;  4SGB I;  1P9G A;  2ARP F;  1R79 A;  2KCX A;  2N1A B;  4MPI A;  2ERW A;  1UVF A;  2KMR A;  1PCE A;  1K7V A;  2LB7 A;  3RU0 A;  1ULK A;  1UUC A;  3UGI A;  1V1H A;  2X3T A;  1WKX A;  2V53 A;  2PQ8 A;  2NU4 I;  3KY9 A;  2N71 A;  3FSY A;  1KMA A;  1TBN A;  1X74 A;  1TIH A;  1CSO I;  1XA6 A;  2V1C C;  2YUU A;  4FKD A;  3TO7 A;  2LEO A;  3UGD A;  5CCM A;  2X52 A;  7WGA A;  1Y1C A;  2KMP A;  2SGP I;  3R5D A;  3GOX A;  2W0T A;  1M8C A;  2A20 A;  1M8B A;  3VE5 A;  5EX0 A; 
#chains in the Genus database with same CATH homology
 3CXL A;  1CE3 A;  1PJU A;  3QTL D;  1LR9 A;  2ROW A;  2SGE I;  3OVO A;  2N17 A;  5FUW A;  5HI7 A;  1SGE I;  4UXI A;  2OVO A;  3OXF A;  1X4S A;  2J87 A;  2QQC A;  3E59 A;  1TBR R;  4A24 A;  1OVO A;  4JCV E;  2DB6 A;  3UEJ A;  1SGP I;  1NUB A;  3PDN A;  3UGL A;  1LR7 A;  1PTQ A;  2NU0 I;  1PPF I;  5CCL A;  1V1I A;  1DS2 I;  2B8T A;  2JW6 A;  5JHW C;  1CHO I;  2M5X A;  3QWP A;  2XRC A;  1IY6 A;  1Z7K B;  2ELI A;  3VDP A;  1BUS A;  1Y1B A;  2B0U C;  2WCY A;  3SEK C;  1HDL A;  1CGI I;  2DIP A;  1SGD I;  2YQP A;  3FC3 A;  2GKT I;  1CT2 I;  3BJI A;  1FAQ A;  1FYB A;  1W3S A;  2SGF I;  2J9R A;  4HGU A;  3UEY A;  2QPO A;  1R0R I;  2F3C I;  2ENN A;  2GKV A;  1AN1 I;  1TOT A;  1XX6 A;  2BUS A;  2JYY A;  4E1P A;  2N52 A;  2UZ3 A;  2NU1 I;  1YU6 C;  1CT0 I;  3D00 A;  5FUY A;  3E2I A;  1OYV I;  1PTR A;  1OMU A;  5DAE A;  1IW4 A;  4B6D A;  2ENZ A;  3B4V C;  4L9M A;  1SGY I;  2K9H A;  2FNF X;  2ORV A;  2QQE A;  1HJA I;  1BMO A;  2JZM A;  1TBQ R;  1SGR I;  2JA1 A;  3MEK A;  5EX3 A;  1KBE A;  5FUV A;  5FUX A;  1SGQ I;  1U5K A;  3TJQ A;  1SGN I;  3UFF A;  1H0Z A;  2GVI A;  1LR8 A;  2L8E A;  2VRW B;  3VDU A;  1CT4 I;  2L7X A;  1UVG A;  1N13 A;  2LUY A;  1KBF A;  4UXH A;  1TGS I;  3OL0 A;  3SGB I;  2NU2 I;  2SGD I;  1VDD A;  1RFH A;  1TBO A;  2ODD A;  4OVO A;  2E73 A;  1CGJ I;  1IY5 A;  1XBT A;  1DS3 I;  2JXD A;  1HPT A;  1Y8F A;  4GI3 C;  4UXJ A;  4E1R A;  5HQ8 A;  2ORW A;  2GKR I;  1W4R A;  2NU3 I;  1FAR A;  3SGQ I;  2P6A C;  3OXL A;  1MT1 A;  1YTP A;  2QQ0 A;  2QQD A;  2E5R A;  2WVJ A;  2CJS C;  1TUR A;  1TUS A;  1OMT A;  2OD1 A;  2SGQ I;  2KMO A;  2V1C A;  3HH2 C;  2KMQ A;  3OXG A;  4SGB I;  2ARP F;  1R79 A;  2KCX A;  2N1A B;  2ERW A;  1UVF A;  2KMR A;  1PCE A;  3RU0 A;  1UUC A;  3UGI A;  1V1H A;  2V53 A;  2NU4 I;  3KY9 A;  2N71 A;  1KMA A;  1TBN A;  1X74 A;  1TIH A;  1CSO I;  1XA6 A;  2V1C C;  2YUU A;  4FKD A;  3UGD A;  2LEO A;  5CCM A;  1Y1C A;  2KMP A;  2SGP I;  3GOX A;  2W0T A;  1M8C A;  2A20 A;  1M8B A;  3VE5 A;  5EX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...