2L8EA

Solution nmr structure of fcs domain of human polyhomeotic homolog 1 (hph1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
49
structure length
49
Chain Sequence
GTRGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Polyhomeotic-like protein 1
publication title 1H, 15N and 13C assigned chemical shifts of FCS domain from human polyhomeotic homolog 1
rcsb
source organism Homo sapiens
total genus 9
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2011-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.160 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2l8eA00
2L8EA 2W0TA
chains in the Genus database with same CATH superfamily
1BUSA 4HGUA 1HEVA 1KBFA 2N17A 3CXLA 1NUBA 2N71A 1KBEA 3HH2C 1IY6A 2WCYA 1WKXA 2DIPA 1TUSA 1YTPA 1Q9BA 2B8TA 1OVOA 1DS3I 2YUUA 1UVFA 2WVJA 2SGPI 2SGEI 2NU0I 2OU2A 3OVOA 1W3SA 3E59A 2N1AB 2KMQA 1SGRI 1CT4I 1TBQR 5FUVA 1WGTA 3TO7A 1WTJA 3OXLA 3D00A 3PDNA 2RC4A 1TBRR 4OVOA 2ORVA 4E1RA 2J9RA 2JYYA 2F3CI 4FKDA 2PQ8A 3TJQA 3VDUA 1FAQA 1Z2IA 2CWHA 1PTQA 1AN1I 1SGQI 2A20A 1HDLA 1PJUA 3SGQI 4SGBI 3UGDA 2GKTI 1K7VA 3TO6A 1DS2I 5E3QA 1FARA 1IW4A 2UZ3A 2X3TA 2ODDA 3UGIA 2E5RA 1SGDI 1FYBA 3FSXA 4WP4A 1V1IA 3OL0A 2GVIA 1ULMA 2SGFI 2FNFX 1P9ZA 3TOAA 1IY5A 1TURA 1UHAA 1XX6A 2ELIA 2ENNA 3VDPA 2Y0MA 1Y1CA 5FUYA 2B0UC 2JXDA 3OXFA 5FUXA 1YU6C 2QQCA 2GKRI 2E73A 2QQDA 2W0TA 2DKVA 2X52A 3KY9A 2NU1I 3FSYA 1FY7A 1ULNA 3RU0A 3SGBI 4B6DA 1CGII 2GIVA 4GI3C 2M5XA 2RIJA 2L8EA 2QQ0A 1Y1BA 1OMTA 2ROWA 3QTLD 1M8CA 2LUYA 2JA1A 3R5AA 5FUWA 1TBNA 3B4VC 5J8FA 3MEKA 2ORWA 1R0RI 4A24A 5JHWC 1KMAA 2XRCA 1XA6A 2CJSC 1PTRA 3TOBA 2ARPF 3GOXA 5CCMA 1P9GA 1K7TA 5CCLA 5HQ8A 4MPIA 7WGAA 3R5CA 3SEKC 4JCVE 1HPTA 2SGDI 4E1PA 1W4RA 1OMUA 1SGEI 2CWFA 2SGQI 1Z7KB 2KCXA 3UFFA 1LR7A 1CGJI 2OVOA 1R79A 1U5KA 1Y8FA 3QAHA 1CT0I 2P6AC 3UGLA 1MJAA 1CE3A 2ERWA 1HJAI 5EX3A 5HI7A 1SGYI 2CWGA 3UEJA 3UEYA 3QWPA 2JZMA 3R5BA 1M8BA 4DNCA 1CSOI 4L9MA 5EX0A 2OZUA 3R5DA 4UXHA 1TOTA 2NU3I 2JW6A 1XBTA 2BUSA 1MJBA 1UVGA 1X4SA 1S20A 2NU4I 1VDDA 2QQEA 4AMLA 1SGNI 1H0ZA 1TBOA 2YQPA 3BJIA 5DAEA 4UXIA 1ULKA 1BMOA 1OYVI 2N52A 2V1CA 2DB6A 2LB7A 1TIHA 1UUCA 1LR9A 2ENZA 2LEOA 2NU2I 5J8CA 2V1CC 1SGPI 2L7XA 1MT1A 4UXJA 5E3RA 3VE5A 1V1HA 2WGCA 9WGAA 1NXUA 1CHOI 1MJ9A 2K9HA 2KMRA 2VRWB 2OD1A 2QPOA 3TO9A 3UOEA 3FC3A 1TGSI 1CT2I 1WGCA 2V53A 5E3PA 3OXGA 1RFHA 2J87A 1LR8A 2KMPA 2UVOA 1K7UA 1X74A 1PCEA 2GKVA 3E2IA 1N13A 1PPFI 2KMOA
chains in the Genus database with same CATH topology
1BUSA 4HGUA 1KBFA 2N17A 3CXLA 1NUBA 2N71A 1KBEA 3HH2C 1IY6A 2WCYA 2DIPA 1TUSA 1YTPA 2B8TA 1OVOA 1DS3I 2YUUA 1UVFA 2WVJA 2SGPI 2SGEI 2NU0I 3OVOA 1W3SA 3E59A 2N1AB 2KMQA 1SGRI 1CT4I 1TBQR 5FUVA 3OXLA 3D00A 3PDNA 1TBRR 4OVOA 2ORVA 4E1RA 2J9RA 2JYYA 2F3CI 4FKDA 3TJQA 3VDUA 1FAQA 1PTQA 1AN1I 1SGQI 2A20A 1HDLA 1PJUA 3SGQI 4SGBI 3UGDA 2GKTI 1DS2I 1FARA 1IW4A 2UZ3A 2ODDA 3UGIA 2E5RA 1SGDI 1FYBA 1V1IA 3OL0A 2GVIA 2SGFI 2FNFX 1IY5A 1TURA 1XX6A 2ELIA 2ENNA 3VDPA 1Y1CA 5FUYA 2B0UC 2JXDA 3OXFA 5FUXA 1YU6C 2QQCA 2GKRI 2E73A 2QQDA 2W0TA 3KY9A 2NU1I 3SGBI 3RU0A 4B6DA 1CGII 4GI3C 2M5XA 2L8EA 2QQ0A 1Y1BA 1OMTA 2ROWA 3QTLD 1M8CA 2LUYA 2JA1A 5FUWA 1TBNA 3B4VC 5JHWC 3MEKA 2ORWA 1R0RI 4A24A 2XRCA 1XA6A 2CJSC 1PTRA 2ARPF 3GOXA 5CCMA 5CCLA 5HQ8A 3SEKC 4JCVE 1HPTA 2SGDI 4E1PA 1W4RA 1OMUA 1SGEI 2SGQI 1Z7KB 2KCXA 3UFFA 1LR7A 1CGJI 2OVOA 1R79A 1U5KA 1Y8FA 1CT0I 2P6AC 3UGLA 1CE3A 2ERWA 1HJAI 5EX3A 5HI7A 1SGYI 3UEJA 3UEYA 1KMAA 3QWPA 2JZMA 1M8BA 1CSOI 4L9MA 5EX0A 4UXHA 1TOTA 2NU3I 2JW6A 1XBTA 2BUSA 1UVGA 1X4SA 2QQEA 2NU4I 1VDDA 1SGNI 1H0ZA 1TBOA 2YQPA 3BJIA 5DAEA 4UXIA 1BMOA 1OYVI 2N52A 2V1CA 2DB6A 1TIHA 1UUCA 1LR9A 2ENZA 2LEOA 2NU2I 2V1CC 1SGPI 2L7XA 1MT1A 4UXJA 3VE5A 1V1HA 1CHOI 2K9HA 2KMRA 2VRWB 2OD1A 2QPOA 3FC3A 1TGSI 1CT2I 2V53A 3OXGA 1RFHA 2J87A 1LR8A 2KMPA 1X74A 2GKVA 1PCEA 3E2IA 1N13A 1PPFI 2KMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8E A;  2W0T A; 
#chains in the Genus database with same CATH topology
 1BUS A;  4HGU A;  1HEV A;  1KBF A;  2N17 A;  3CXL A;  1NUB A;  2N71 A;  1KBE A;  3HH2 C;  1IY6 A;  2WCY A;  1WKX A;  2DIP A;  1TUS A;  1YTP A;  1Q9B A;  2B8T A;  1OVO A;  1DS3 I;  2YUU A;  1UVF A;  2WVJ A;  2SGP I;  2SGE I;  2NU0 I;  2OU2 A;  3OVO A;  1W3S A;  3E59 A;  2N1A B;  2KMQ A;  1SGR I;  1CT4 I;  1TBQ R;  5FUV A;  1WGT A;  3TO7 A;  1WTJ A;  3OXL A;  3D00 A;  3PDN A;  2RC4 A;  1TBR R;  4OVO A;  2ORV A;  4E1R A;  2J9R A;  2JYY A;  2F3C I;  4FKD A;  2PQ8 A;  3TJQ A;  3VDU A;  1FAQ A;  1Z2I A;  2CWH A;  1PTQ A;  1AN1 I;  1SGQ I;  2A20 A;  1HDL A;  1PJU A;  3SGQ I;  4SGB I;  3UGD A;  2GKT I;  1K7V A;  3TO6 A;  1DS2 I;  5E3Q A;  1FAR A;  1IW4 A;  2UZ3 A;  2X3T A;  2ODD A;  3UGI A;  2E5R A;  1SGD I;  1FYB A;  3FSX A;  4WP4 A;  1V1I A;  3OL0 A;  2GVI A;  1ULM A;  2SGF I;  2FNF X;  1P9Z A;  3TOA A;  1IY5 A;  1TUR A;  1UHA A;  1XX6 A;  2ELI A;  2ENN A;  3VDP A;  2Y0M A;  1Y1C A;  5FUY A;  2B0U C;  2JXD A;  3OXF A;  5FUX A;  1YU6 C;  2QQC A;  2GKR I;  2E73 A;  2QQD A;  2W0T A;  2DKV A;  2X52 A;  3KY9 A;  2NU1 I;  3FSY A;  1FY7 A;  1ULN A;  3RU0 A;  3SGB I;  4B6D A;  1CGI I;  2GIV A;  4GI3 C;  2M5X A;  2RIJ A;  2L8E A;  2QQ0 A;  1Y1B A;  1OMT A;  2ROW A;  3QTL D;  1M8C A;  2LUY A;  2JA1 A;  3R5A A;  5FUW A;  1TBN A;  3B4V C;  5J8F A;  3MEK A;  2ORW A;  1R0R I;  4A24 A;  5JHW C;  1KMA A;  2XRC A;  1XA6 A;  2CJS C;  1PTR A;  3TOB A;  2ARP F;  3GOX A;  5CCM A;  1P9G A;  1K7T A;  5CCL A;  5HQ8 A;  4MPI A;  7WGA A;  3R5C A;  3SEK C;  4JCV E;  1HPT A;  2SGD I;  4E1P A;  1W4R A;  1OMU A;  1SGE I;  2CWF A;  2SGQ I;  1Z7K B;  2KCX A;  3UFF A;  1LR7 A;  1CGJ I;  2OVO A;  1R79 A;  1U5K A;  1Y8F A;  3QAH A;  1CT0 I;  2P6A C;  3UGL A;  1MJA A;  1CE3 A;  2ERW A;  1HJA I;  5EX3 A;  5HI7 A;  1SGY I;  2CWG A;  3UEJ A;  3UEY A;  3QWP A;  2JZM A;  3R5B A;  1M8B A;  4DNC A;  1CSO I;  4L9M A;  5EX0 A;  2OZU A;  3R5D A;  4UXH A;  1TOT A;  2NU3 I;  2JW6 A;  1XBT A;  2BUS A;  1MJB A;  1UVG A;  1X4S A;  1S20 A;  2NU4 I;  1VDD A;  2QQE A;  4AML A;  1SGN I;  1H0Z A;  1TBO A;  2YQP A;  3BJI A;  5DAE A;  4UXI A;  1ULK A;  1BMO A;  1OYV I;  2N52 A;  2V1C A;  2DB6 A;  2LB7 A;  1TIH A;  1UUC A;  1LR9 A;  2ENZ A;  2LEO A;  2NU2 I;  5J8C A;  2V1C C;  1SGP I;  2L7X A;  1MT1 A;  4UXJ A;  5E3R A;  3VE5 A;  1V1H A;  2WGC A;  9WGA A;  1NXU A;  1CHO I;  1MJ9 A;  2K9H A;  2KMR A;  2VRW B;  2OD1 A;  2QPO A;  3TO9 A;  3UOE A;  3FC3 A;  1TGS I;  1CT2 I;  1WGC A;  2V53 A;  5E3P A;  3OXG A;  1RFH A;  2J87 A;  1LR8 A;  2KMP A;  2UVO A;  1K7U A;  1X74 A;  1PCE A;  2GKV A;  3E2I A;  1N13 A;  1PPF I;  2KMO A; 
#chains in the Genus database with same CATH homology
 1BUS A;  4HGU A;  1KBF A;  2N17 A;  3CXL A;  1NUB A;  2N71 A;  1KBE A;  3HH2 C;  1IY6 A;  2WCY A;  2DIP A;  1TUS A;  1YTP A;  2B8T A;  1OVO A;  1DS3 I;  2YUU A;  1UVF A;  2WVJ A;  2SGP I;  2SGE I;  2NU0 I;  3OVO A;  1W3S A;  3E59 A;  2N1A B;  2KMQ A;  1SGR I;  1CT4 I;  1TBQ R;  5FUV A;  3OXL A;  3D00 A;  3PDN A;  1TBR R;  4OVO A;  2ORV A;  4E1R A;  2J9R A;  2JYY A;  2F3C I;  4FKD A;  3TJQ A;  3VDU A;  1FAQ A;  1PTQ A;  1AN1 I;  1SGQ I;  2A20 A;  1HDL A;  1PJU A;  3SGQ I;  4SGB I;  3UGD A;  2GKT I;  1DS2 I;  1FAR A;  1IW4 A;  2UZ3 A;  2ODD A;  3UGI A;  2E5R A;  1SGD I;  1FYB A;  1V1I A;  3OL0 A;  2GVI A;  2SGF I;  2FNF X;  1IY5 A;  1TUR A;  1XX6 A;  2ELI A;  2ENN A;  3VDP A;  1Y1C A;  5FUY A;  2B0U C;  2JXD A;  3OXF A;  5FUX A;  1YU6 C;  2QQC A;  2GKR I;  2E73 A;  2QQD A;  2W0T A;  3KY9 A;  2NU1 I;  3SGB I;  3RU0 A;  4B6D A;  1CGI I;  4GI3 C;  2M5X A;  2L8E A;  2QQ0 A;  1Y1B A;  1OMT A;  2ROW A;  3QTL D;  1M8C A;  2LUY A;  2JA1 A;  5FUW A;  1TBN A;  3B4V C;  5JHW C;  3MEK A;  2ORW A;  1R0R I;  4A24 A;  2XRC A;  1XA6 A;  2CJS C;  1PTR A;  2ARP F;  3GOX A;  5CCM A;  5CCL A;  5HQ8 A;  3SEK C;  4JCV E;  1HPT A;  2SGD I;  4E1P A;  1W4R A;  1OMU A;  1SGE I;  2SGQ I;  1Z7K B;  2KCX A;  3UFF A;  1LR7 A;  1CGJ I;  2OVO A;  1R79 A;  1U5K A;  1Y8F A;  1CT0 I;  2P6A C;  3UGL A;  1CE3 A;  2ERW A;  1HJA I;  5EX3 A;  5HI7 A;  1SGY I;  3UEJ A;  3UEY A;  1KMA A;  3QWP A;  2JZM A;  1M8B A;  1CSO I;  4L9M A;  5EX0 A;  4UXH A;  1TOT A;  2NU3 I;  2JW6 A;  1XBT A;  2BUS A;  1UVG A;  1X4S A;  2QQE A;  2NU4 I;  1VDD A;  1SGN I;  1H0Z A;  1TBO A;  2YQP A;  3BJI A;  5DAE A;  4UXI A;  1BMO A;  1OYV I;  2N52 A;  2V1C A;  2DB6 A;  1TIH A;  1UUC A;  1LR9 A;  2ENZ A;  2LEO A;  2NU2 I;  2V1C C;  1SGP I;  2L7X A;  1MT1 A;  4UXJ A;  3VE5 A;  1V1H A;  1CHO I;  2K9H A;  2KMR A;  2VRW B;  2OD1 A;  2QPO A;  3FC3 A;  1TGS I;  1CT2 I;  2V53 A;  3OXG A;  1RFH A;  2J87 A;  1LR8 A;  2KMP A;  1X74 A;  2GKV A;  1PCE A;  3E2I A;  1N13 A;  1PPF I;  2KMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...