1SGQI

Gly 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTGEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (serine protease/inhibitor)
molecule keywords STREPTOMYCES GRISEUS PROTEINASE B
publication title Water molecules participate in proteinase-inhibitor interactions: crystal structures of Leu18, Ala18, and Gly18 variants of turkey ovomucoid inhibitor third domain complexed with Streptomyces griseus proteinase B.
pubmed rcsb
source organism Streptomyces griseus
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1995-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgqI00
1TGSI 1FYBA 1Y1BA 1CT0I 3HH2C 1DS3I 2N71A 2JXDA 1Y1CA 2SGEI 3B4VC 1SGPI 2QQDA 1PCEA 1SGDI 1YU6C 2KMOA 1N13A 4SGBI 2SGQI 1BUSA 2ARPF 2GKTI 2GKRI 1UVFA 1UVGA 1CT4I 1R0RI 2KCXA 1SGRI 2NU1I 2N17A 1OYVI 1Z7KB 2P6AC 2NU3I 1SGYI 1CE3A 2KMRA 1PJUA 1LR9A 2BUSA 2NU0I 2M5XA 2V53A 1SGEI 1YTPA 2SGFI 2SGPI 3QTLD 4OVOA 2JZMA 2B0UC 1KMAA 2WCYA 2XRCA 1CT2I 1PPFI 2GKVA 3SGBI 2ERWA 1HPTA 1M8BA 1M8CA 3TJQA 1CSOI 2OVOA 1HDLA 1TURA 2KMPA 3SGQI 1CGII 1BMOA 1DS2I 2F3CI 2LEOA 1NUBA 2KMQA 1MT1A 2N52A 1TUSA 1CHOI 1OMTA 5JHWC 1TBQR 1IY5A 1IY6A 1TBRR 1OMUA 2JYYA 1LR8A 1HJAI 1OVOA 1AN1I 3OVOA 1TIHA 3SEKC 1SGQI 1IW4A 1H0ZA 1UUCA 2QQCA 2SGDI 4HGUA 1LR7A 1CGJI 2NU2I 4GI3C 1SGNI 2NU4I 5DAEA
chains in the Genus database with same CATH superfamily
2ODDA 5J8CA 7WGAA 5E3QA 1TGSI 1FYBA 1Y1BA 3BJIA 1CT0I 1WKXA 2YQPA 3HH2C 1FAQA 1W3SA 3TO7A 1DS3I 2LUYA 1Y8FA 1K7UA 1WGCA 1K7TA 1K7VA 3UGIA 2N71A 2JXDA 1Y1CA 2SGEI 3B4VC 1SGPI 3QWPA 2A20A 2CWHA 2QQDA 1PCEA 1SGDI 1YU6C 2KMOA 1N13A 1KBEA 2GVIA 3OXLA 4SGBI 1MJ9A 2SGQI 3TOAA 1BUSA 1ULNA 2V1CA 2Y0MA 5J8FA 1TOTA 2ARPF 2GKTI 2E73A 2GKRI 1UVFA 1UVGA 3FSXA 5E3RA 5FUYA 2J87A 2ORVA 1U5KA 1CT4I 1RFHA 1R0RI 1P9GA 3OXGA 3CXLA 2KCXA 1SGRI 3TO9A 1IY6A 2NU1I 2N17A 1OYVI 1ULKA 1Q9BA 1W4RA 2X52A 3E2IA 1Z7KB 1X4SA 2ELIA 1Z2IA 1SGYI 2NU3I 1NXUA 2P6AC 2W0TA 2WGCA 2X3TA 4DNCA 2KMRA 1PJUA 1S20A 9WGAA 4UXJA 1LR9A 2BUSA 2CWGA 2NU0I 1MJBA 3UFFA 2M5XA 2ORWA 2V53A 1P9ZA 3KY9A 1SGEI 1YTPA 2SGFI 2UVOA 2N1AB 2RIJA 2SGPI 2JW6A 2GIVA 2J9RA 3QTLD 2YUUA 3D00A 2V1CC 3E59A 2JZMA 1TBNA 2B0UC 4OVOA 4L9MA 2ENZA 2QQ0A 1FY7A 2WCYA 1KMAA 2VRWB 3TO6A 5EX3A 2XRCA 3R5CA 1CT2I 1PPFI 2OD1A 4UXIA 3PDNA 2B8TA 2GKVA 3SGBI 2ERWA 5CCMA 1HPTA 5FUXA 1M8BA 2RC4A 1M8CA 1CE3A 3TJQA 1CSOI 2OVOA 1HDLA 1MJAA 1TURA 2KMPA 2ENNA 5CCLA 3SGQI 1TBOA 1CGII 1BMOA 1DS2I 1WTJA 2F3CI 1PTQA 2LEOA 3UGLA 1NUBA 2KMQA 3OXFA 5FUVA 4B6DA 3R5BA 3QAHA 2OZUA 1MT1A 1V1HA 3UGDA 1X74A 3GOXA 2N52A 1TUSA 1CHOI 1OMTA 2CJSC 1TBQR 2K9HA 3OL0A 5JHWC 1IY5A 2PQ8A 2JA1A 1TBRR 2E5RA 2L8EA 3UOEA 1OMUA 2OU2A 1V1IA 3RU0A 1XA6A 4E1PA 1XBTA 2JYYA 1LR8A 4AMLA 2QPOA 1R79A 2DB6A 1HJAI 3R5AA 4JCVE 3VDUA 2QQEA 1OVOA 1AN1I 1PTRA 4E1RA 3OVOA 3FC3A 1FARA 1TIHA 2CWFA 3MEKA 4UXHA 3SEKC 1SGQI 1UHAA 3VDPA 1IW4A 1H0ZA 1UUCA 5E3PA 2L7XA 2WVJA 4MPIA 2LB7A 3FSYA 5FUWA 5HI7A 2QQCA 3TOBA 2SGDI 4HGUA 1LR7A 4A24A 1CGJI 2NU2I 1VDDA 2FNFX 2UZ3A 5HQ8A 3VE5A 1KBFA 3UEYA 1XX6A 4GI3C 1SGNI 1ULMA 1WGTA 4FKDA 2NU4I 2DKVA 2ROWA 4WP4A 3R5DA 5EX0A 1HEVA 3UEJA 2DIPA 5DAEA
chains in the Genus database with same CATH topology
2ODDA 1TGSI 1FYBA 1Y1BA 3BJIA 1CT0I 2YQPA 3HH2C 1FAQA 1W3SA 1DS3I 2LUYA 1Y8FA 3UGIA 2N71A 2JXDA 1Y1CA 2SGEI 3B4VC 1SGPI 3QWPA 2A20A 2QQDA 1PCEA 1SGDI 1YU6C 2KMOA 1N13A 1KBEA 2GVIA 3OXLA 4SGBI 2SGQI 1BUSA 2V1CA 1TOTA 2ARPF 2GKTI 2E73A 2GKRI 1UVFA 1UVGA 5FUYA 2J87A 2ORVA 1U5KA 1CT4I 1RFHA 1R0RI 3OXGA 3CXLA 2KCXA 1SGRI 2NU1I 2N17A 1OYVI 1W4RA 3E2IA 1Z7KB 1X4SA 2ELIA 2NU3I 1SGYI 2P6AC 2W0TA 1CE3A 2KMRA 1PJUA 4UXJA 1LR9A 2BUSA 2NU0I 3UFFA 2M5XA 2ORWA 2V53A 3KY9A 1SGEI 1YTPA 2SGFI 2N1AB 2SGPI 2JW6A 2J9RA 3QTLD 2YUUA 3D00A 2V1CC 3E59A 2JZMA 1TBNA 2B0UC 4OVOA 4L9MA 2ENZA 2QQ0A 1KMAA 2WCYA 2VRWB 5EX3A 2XRCA 1CT2I 1PPFI 2OD1A 4UXIA 3PDNA 2B8TA 2GKVA 3SGBI 2ERWA 5CCMA 1HPTA 5FUXA 1M8BA 1M8CA 3TJQA 1CSOI 2OVOA 1HDLA 1TURA 2KMPA 2ENNA 5CCLA 3SGQI 1TBOA 1CGII 1BMOA 1DS2I 2F3CI 1PTQA 2LEOA 3UGLA 1NUBA 2KMQA 3OXFA 5FUVA 4B6DA 1MT1A 1V1HA 3UGDA 1X74A 3GOXA 2N52A 1TUSA 1CHOI 1OMTA 2CJSC 1TBQR 2K9HA 3OL0A 5JHWC 1IY5A 1IY6A 2JA1A 1TBRR 2E5RA 2L8EA 1OMUA 1V1IA 3RU0A 1XA6A 4E1PA 1XBTA 2JYYA 1LR8A 2QPOA 1R79A 2DB6A 1HJAI 4JCVE 3VDUA 2QQEA 1OVOA 1AN1I 1PTRA 4E1RA 3OVOA 3FC3A 1FARA 1TIHA 3MEKA 4UXHA 3SEKC 1SGQI 3VDPA 1IW4A 1H0ZA 1UUCA 2L7XA 2WVJA 5FUWA 5HI7A 2QQCA 2SGDI 4HGUA 1LR7A 4A24A 1CGJI 2NU2I 1VDDA 2FNFX 2UZ3A 5HQ8A 3VE5A 1KBFA 3UEYA 1XX6A 4GI3C 1SGNI 4FKDA 2NU4I 2ROWA 5EX0A 3UEJA 2DIPA 5DAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TGS I;  1FYB A;  1Y1B A;  1CT0 I;  3HH2 C;  1DS3 I;  2N71 A;  2JXD A;  1Y1C A;  2SGE I;  3B4V C;  1SGP I;  2QQD A;  1PCE A;  1SGD I;  1YU6 C;  2KMO A;  1N13 A;  4SGB I;  2SGQ I;  1BUS A;  2ARP F;  2GKT I;  2GKR I;  1UVF A;  1UVG A;  1CT4 I;  1R0R I;  2KCX A;  1SGR I;  2NU1 I;  2N17 A;  1OYV I;  1Z7K B;  2P6A C;  2NU3 I;  1SGY I;  1CE3 A;  2KMR A;  1PJU A;  1LR9 A;  2BUS A;  2NU0 I;  2M5X A;  2V53 A;  1SGE I;  1YTP A;  2SGF I;  2SGP I;  3QTL D;  4OVO A;  2JZM A;  2B0U C;  1KMA A;  2WCY A;  2XRC A;  1CT2 I;  1PPF I;  2GKV A;  3SGB I;  2ERW A;  1HPT A;  1M8B A;  1M8C A;  3TJQ A;  1CSO I;  2OVO A;  1HDL A;  1TUR A;  2KMP A;  3SGQ I;  1CGI I;  1BMO A;  1DS2 I;  2F3C I;  2LEO A;  1NUB A;  2KMQ A;  1MT1 A;  2N52 A;  1TUS A;  1CHO I;  1OMT A;  5JHW C;  1TBQ R;  1IY5 A;  1IY6 A;  1TBR R;  1OMU A;  2JYY A;  1LR8 A;  1HJA I;  1OVO A;  1AN1 I;  3OVO A;  1TIH A;  3SEK C;  1SGQ I;  1IW4 A;  1H0Z A;  1UUC A;  2QQC A;  2SGD I;  4HGU A;  1LR7 A;  1CGJ I;  2NU2 I;  4GI3 C;  1SGN I;  2NU4 I;  5DAE A; 
#chains in the Genus database with same CATH topology
 2ODD A;  5J8C A;  7WGA A;  5E3Q A;  1TGS I;  1FYB A;  1Y1B A;  3BJI A;  1CT0 I;  1WKX A;  2YQP A;  3HH2 C;  1FAQ A;  1W3S A;  3TO7 A;  1DS3 I;  2LUY A;  1Y8F A;  1K7U A;  1WGC A;  1K7T A;  1K7V A;  3UGI A;  2N71 A;  2JXD A;  1Y1C A;  2SGE I;  3B4V C;  1SGP I;  3QWP A;  2A20 A;  2CWH A;  2QQD A;  1PCE A;  1SGD I;  1YU6 C;  2KMO A;  1N13 A;  1KBE A;  2GVI A;  3OXL A;  4SGB I;  1MJ9 A;  2SGQ I;  3TOA A;  1BUS A;  1ULN A;  2V1C A;  2Y0M A;  5J8F A;  1TOT A;  2ARP F;  2GKT I;  2E73 A;  2GKR I;  1UVF A;  1UVG A;  3FSX A;  5E3R A;  5FUY A;  2J87 A;  2ORV A;  1U5K A;  1CT4 I;  1RFH A;  1R0R I;  1P9G A;  3OXG A;  3CXL A;  2KCX A;  1SGR I;  3TO9 A;  1IY6 A;  2NU1 I;  2N17 A;  1OYV I;  1ULK A;  1Q9B A;  1W4R A;  2X52 A;  3E2I A;  1Z7K B;  1X4S A;  2ELI A;  1Z2I A;  1SGY I;  2NU3 I;  1NXU A;  2P6A C;  2W0T A;  2WGC A;  2X3T A;  4DNC A;  2KMR A;  1PJU A;  1S20 A;  9WGA A;  4UXJ A;  1LR9 A;  2BUS A;  2CWG A;  2NU0 I;  1MJB A;  3UFF A;  2M5X A;  2ORW A;  2V53 A;  1P9Z A;  3KY9 A;  1SGE I;  1YTP A;  2SGF I;  2UVO A;  2N1A B;  2RIJ A;  2SGP I;  2JW6 A;  2GIV A;  2J9R A;  3QTL D;  2YUU A;  3D00 A;  2V1C C;  3E59 A;  2JZM A;  1TBN A;  2B0U C;  4OVO A;  4L9M A;  2ENZ A;  2QQ0 A;  1FY7 A;  2WCY A;  1KMA A;  2VRW B;  3TO6 A;  5EX3 A;  2XRC A;  3R5C A;  1CT2 I;  1PPF I;  2OD1 A;  4UXI A;  3PDN A;  2B8T A;  2GKV A;  3SGB I;  2ERW A;  5CCM A;  1HPT A;  5FUX A;  1M8B A;  2RC4 A;  1M8C A;  1CE3 A;  3TJQ A;  1CSO I;  2OVO A;  1HDL A;  1MJA A;  1TUR A;  2KMP A;  2ENN A;  5CCL A;  3SGQ I;  1TBO A;  1CGI I;  1BMO A;  1DS2 I;  1WTJ A;  2F3C I;  1PTQ A;  2LEO A;  3UGL A;  1NUB A;  2KMQ A;  3OXF A;  5FUV A;  4B6D A;  3R5B A;  3QAH A;  2OZU A;  1MT1 A;  1V1H A;  3UGD A;  1X74 A;  3GOX A;  2N52 A;  1TUS A;  1CHO I;  1OMT A;  2CJS C;  1TBQ R;  2K9H A;  3OL0 A;  5JHW C;  1IY5 A;  2PQ8 A;  2JA1 A;  1TBR R;  2E5R A;  2L8E A;  3UOE A;  1OMU A;  2OU2 A;  1V1I A;  3RU0 A;  1XA6 A;  4E1P A;  1XBT A;  2JYY A;  1LR8 A;  4AML A;  2QPO A;  1R79 A;  2DB6 A;  1HJA I;  3R5A A;  4JCV E;  3VDU A;  2QQE A;  1OVO A;  1AN1 I;  1PTR A;  4E1R A;  3OVO A;  3FC3 A;  1FAR A;  1TIH A;  2CWF A;  3MEK A;  4UXH A;  3SEK C;  1SGQ I;  1UHA A;  3VDP A;  1IW4 A;  1H0Z A;  1UUC A;  5E3P A;  2L7X A;  2WVJ A;  4MPI A;  2LB7 A;  3FSY A;  5FUW A;  5HI7 A;  2QQC A;  3TOB A;  2SGD I;  4HGU A;  1LR7 A;  4A24 A;  1CGJ I;  2NU2 I;  1VDD A;  2FNF X;  2UZ3 A;  5HQ8 A;  3VE5 A;  1KBF A;  3UEY A;  1XX6 A;  4GI3 C;  1SGN I;  1ULM A;  1WGT A;  4FKD A;  2NU4 I;  2DKV A;  2ROW A;  4WP4 A;  3R5D A;  5EX0 A;  1HEV A;  3UEJ A;  2DIP A;  5DAE A; 
#chains in the Genus database with same CATH homology
 2ODD A;  1TGS I;  1FYB A;  1Y1B A;  3BJI A;  1CT0 I;  2YQP A;  3HH2 C;  1FAQ A;  1W3S A;  1DS3 I;  2LUY A;  1Y8F A;  3UGI A;  2N71 A;  2JXD A;  1Y1C A;  2SGE I;  3B4V C;  1SGP I;  3QWP A;  2A20 A;  2QQD A;  1PCE A;  1SGD I;  1YU6 C;  2KMO A;  1N13 A;  1KBE A;  2GVI A;  3OXL A;  4SGB I;  2SGQ I;  1BUS A;  2V1C A;  1TOT A;  2ARP F;  2GKT I;  2E73 A;  2GKR I;  1UVF A;  1UVG A;  5FUY A;  2J87 A;  2ORV A;  1U5K A;  1CT4 I;  1RFH A;  1R0R I;  3OXG A;  3CXL A;  2KCX A;  1SGR I;  2NU1 I;  2N17 A;  1OYV I;  1W4R A;  3E2I A;  1Z7K B;  1X4S A;  2ELI A;  2NU3 I;  1SGY I;  2P6A C;  2W0T A;  1CE3 A;  2KMR A;  1PJU A;  4UXJ A;  1LR9 A;  2BUS A;  2NU0 I;  3UFF A;  2M5X A;  2ORW A;  2V53 A;  3KY9 A;  1SGE I;  1YTP A;  2SGF I;  2N1A B;  2SGP I;  2JW6 A;  2J9R A;  3QTL D;  2YUU A;  3D00 A;  2V1C C;  3E59 A;  2JZM A;  1TBN A;  2B0U C;  4OVO A;  4L9M A;  2ENZ A;  2QQ0 A;  1KMA A;  2WCY A;  2VRW B;  5EX3 A;  2XRC A;  1CT2 I;  1PPF I;  2OD1 A;  4UXI A;  3PDN A;  2B8T A;  2GKV A;  3SGB I;  2ERW A;  5CCM A;  1HPT A;  5FUX A;  1M8B A;  1M8C A;  3TJQ A;  1CSO I;  2OVO A;  1HDL A;  1TUR A;  2KMP A;  2ENN A;  5CCL A;  3SGQ I;  1TBO A;  1CGI I;  1BMO A;  1DS2 I;  2F3C I;  1PTQ A;  2LEO A;  3UGL A;  1NUB A;  2KMQ A;  3OXF A;  5FUV A;  4B6D A;  1MT1 A;  1V1H A;  3UGD A;  1X74 A;  3GOX A;  2N52 A;  1TUS A;  1CHO I;  1OMT A;  2CJS C;  1TBQ R;  2K9H A;  3OL0 A;  5JHW C;  1IY5 A;  1IY6 A;  2JA1 A;  1TBR R;  2E5R A;  2L8E A;  1OMU A;  1V1I A;  3RU0 A;  1XA6 A;  4E1P A;  1XBT A;  2JYY A;  1LR8 A;  2QPO A;  1R79 A;  2DB6 A;  1HJA I;  4JCV E;  3VDU A;  2QQE A;  1OVO A;  1AN1 I;  1PTR A;  4E1R A;  3OVO A;  3FC3 A;  1FAR A;  1TIH A;  3MEK A;  4UXH A;  3SEK C;  1SGQ I;  3VDP A;  1IW4 A;  1H0Z A;  1UUC A;  2L7X A;  2WVJ A;  5FUW A;  5HI7 A;  2QQC A;  2SGD I;  4HGU A;  1LR7 A;  4A24 A;  1CGJ I;  2NU2 I;  1VDD A;  2FNF X;  2UZ3 A;  5HQ8 A;  3VE5 A;  1KBF A;  3UEY A;  1XX6 A;  4GI3 C;  1SGN I;  4FKD A;  2NU4 I;  2ROW A;  5EX0 A;  3UEJ A;  2DIP A;  5DAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...