1SGQI

Gly 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTGEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTOMYCES GRISEUS PROTEINASE B
publication title Water molecules participate in proteinase-inhibitor interactions: crystal structures of Leu18, Ala18, and Gly18 variants of turkey ovomucoid inhibitor third domain complexed with Streptomyces griseus proteinase B.
pubmed rcsb
source organism Streptomyces griseus
molecule tags Complex (serine protease/inhibitor)
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1995-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgqI00
2JZMA 2ARPF 1OVOA 2N71A 4HGUA 1SGPI 1Z7KB 1Y1BA 4GI3C 1CT4I 1SGNI 2N17A 2NU2I 1KMAA 1OMTA 1YTPA 1AN1I 1SGEI 2KMOA 3QTLD 1IY5A 1YU6C 1LR7A 1LR9A 1TURA 1DS2I 2KMQA 3B4VC 1H0ZA 1OYVI 1IY6A 2GKVA 2KCXA 2QQCA 2LEOA 1M8BA 2SGPI 3OVOA 1CT2I 1SGYI 1HJAI 3HH2C 2NU4I 2SGQI 1MT1A 2NU1I 1PPFI 1TBQR 4OVOA 1CT0I 1TUSA 1SGQI 2KMRA 2P6AC 2SGEI 2WCYA 1IW4A 1UVGA 2GKRI 2JYYA 2KMPA 1BUSA 1NUBA 2NU0I 2OVOA 1TGSI 1SGDI 5JHWC 2BUSA 2GKTI 1HPTA 2SGFI 3SGQI 1TIHA 2SGDI 1CGJI 1N13A 1R0RI 1OMUA 1CSOI 1SGRI 2N52A 1TBRR 2V53A 1M8CA 2QQDA 3SEKC 3SGBI 1LR8A 1CGII 1PJUA 1UUCA 1Y1CA 1BMOA 2NU3I 2B0UC 1PCEA 2JXDA 2F3CI 1HDLA 4SGBI 1UVFA 2XRCA 1FYBA 5DAEA 3TJQA 2M5XA 1CE3A 2ERWA 1DS3I 1CHOI
chains in the Genus database with same CATH superfamily
4WP4A 2JZMA 2YUUA 3KY9A 2ARPF 1OVOA 2OD1A 1PTRA 1K7VA 2N71A 1U5KA 3R5BA 1SGPI 4HGUA 4AMLA 3UFFA 1Z7KB 4E1RA 1W3SA 2DKVA 1MJ9A 1Y1BA 1MJAA 2CWFA 4GI3C 5CCMA 2GIVA 1WTJA 1CT4I 2ENNA 2X3TA 3QWPA 1Y8FA 1SGNI 2N17A 2NU2I 4UXHA 1PTQA 1KMAA 1OMTA 3VDUA 1XBTA 1YTPA 4MPIA 1AN1I 3UEJA 1SGEI 2KMOA 3FSYA 3QTLD 1IY5A 5FUVA 4B6DA 2QPOA 1YU6C 4FKDA 1LR7A 1LR9A 1TURA 4UXIA 1X4SA 1DS2I 2KMQA 5E3PA 3B4VC 1H0ZA 4E1PA 2PQ8A 1X74A 1OYVI 1IY6A 1K7UA 3E2IA 2GKVA 2KCXA 3FC3A 2QQCA 2LEOA 3MEKA 2E5RA 5CCLA 1M8BA 2RC4A 2WGCA 2SGPI 2GVIA 1K7TA 3OVOA 1R79A 1ULNA 1WKXA 5J8FA 2JW6A 2ORVA 2QQ0A 3UGIA 1CT2I 1KBFA 3VDPA 2J87A 3OXFA 3TOAA 1SGYI 1HJAI 4DNCA 2V1CC 5EX3A 3CXLA 2UVOA 3FSXA 3HH2C 1MJBA 2NU4I 2SGQI 2ENZA 7WGAA 2CWHA 1MT1A 2NU1I 2K9HA 1PPFI 1W4RA 3UOEA 3UEYA 3TO7A 1TBQR 4OVOA 1CT0I 4UXJA 1TUSA 1FY7A 3PDNA 2A20A 1SGQI 2KMRA 2L8EA 1FARA 2V1CA 2FNFX 2Y0MA 2P6AC 1V1IA 1V1HA 2SGEI 2WCYA 2X52A 1IW4A 5FUYA 1UVGA 2GKRI 2CWGA 2JYYA 2KMPA 1Q9BA 1NUBA 1P9ZA 2NU0I 1BUSA 3UGLA 2W0TA 1KBEA 2OVOA 1TGSI 1SGDI 2ELIA 3D00A 1TBOA 5JHWC 2RIJA 3TO6A 5J8CA 2BUSA 2J9RA 2WVJA 2GKTI 2VRWB 1HPTA 2SGFI 5E3QA 2E73A 1Z2IA 3E59A 3OL0A 3SGQI 1TIHA 2B8TA 2SGDI 3GOXA 1CGJI 1N13A 3R5CA 1TOTA 1R0RI 1HEVA 1OMUA 2LB7A 2L7XA 2ORWA 1CSOI 1SGRI 1WGTA 2N52A 3UGDA 1TBRR 2V53A 1M8CA 5HQ8A 2UZ3A 2ODDA 2QQDA 3SEKC 1ULMA 4A24A 2QQEA 3SGBI 1TBNA 5FUWA 3VE5A 5E3RA 2CJSC 3OXLA 5FUXA 1RFHA 1LR8A 2N1AB 1VDDA 1P9GA 1CGII 1PJUA 3TOBA 1UUCA 1Y1CA 2YQPA 1BMOA 2NU3I 4L9MA 1FAQA 1XA6A 5EX0A 2B0UC 1PCEA 1XX6A 2F3CI 2JXDA 2OZUA 1ULKA 2DIPA 1HDLA 4SGBI 1UVFA 2XRCA 1UHAA 2JA1A 3BJIA 3QAHA 1WGCA 3R5DA 1S20A 1FYBA 5HI7A 5DAEA 2OU2A 1NXUA 2DB6A 3OXGA 3TJQA 2LUYA 9WGAA 4JCVE 2M5XA 2ROWA 3RU0A 1CE3A 2ERWA 1DS3I 3TO9A 3R5AA 1CHOI
chains in the Genus database with same CATH topology
2JZMA 2YUUA 3KY9A 2ARPF 1OVOA 2OD1A 1PTRA 2N71A 4HGUA 1U5KA 1SGPI 3UFFA 1Z7KB 4E1RA 1W3SA 1Y1BA 4GI3C 5CCMA 1CT4I 2ENNA 3QWPA 1Y8FA 1SGNI 2N17A 2NU2I 4UXHA 1PTQA 1KMAA 1OMTA 3VDUA 1XBTA 1YTPA 3UEJA 1AN1I 1SGEI 2KMOA 3QTLD 1IY5A 5FUVA 4B6DA 2QPOA 1YU6C 4FKDA 1LR7A 1LR9A 1TURA 4UXIA 1X4SA 1DS2I 2KMQA 3B4VC 1H0ZA 4E1PA 1X74A 1OYVI 1IY6A 3E2IA 2GKVA 2KCXA 3FC3A 2QQCA 2LEOA 3MEKA 2E5RA 5CCLA 1M8BA 2SGPI 2GVIA 3OVOA 1R79A 2JW6A 2ORVA 2QQ0A 3UGIA 1CT2I 1KBFA 3VDPA 2J87A 3OXFA 1SGYI 1HJAI 2V1CC 5EX3A 3CXLA 3HH2C 2NU4I 2SGQI 2ENZA 1MT1A 2NU1I 2K9HA 1PPFI 1W4RA 3UEYA 1TBQR 4OVOA 1CT0I 4UXJA 1TUSA 3PDNA 2A20A 1SGQI 2KMRA 2L8EA 1FARA 2V1CA 2FNFX 2P6AC 1V1IA 1V1HA 2SGEI 2WCYA 1IW4A 5FUYA 1UVGA 2GKRI 2JYYA 2KMPA 1BUSA 1NUBA 2NU0I 3UGLA 2W0TA 1KBEA 2OVOA 1TGSI 1SGDI 2ELIA 3D00A 1TBOA 5JHWC 2BUSA 2J9RA 2WVJA 2GKTI 2VRWB 1HPTA 2SGFI 2E73A 3E59A 3OL0A 3SGQI 1TIHA 2B8TA 2SGDI 3GOXA 1CGJI 1N13A 1TOTA 1R0RI 1OMUA 2ORWA 2L7XA 1CSOI 1SGRI 2N52A 3UGDA 1TBRR 2V53A 1M8CA 5HQ8A 2UZ3A 2ODDA 2QQDA 3SEKC 4A24A 2QQEA 3SGBI 1TBNA 5FUWA 3VE5A 2CJSC 3OXLA 5FUXA 1RFHA 1LR8A 2N1AB 1VDDA 1CGII 1PJUA 1UUCA 1Y1CA 2YQPA 1BMOA 2NU3I 4L9MA 1FAQA 1XA6A 5EX0A 2B0UC 1PCEA 1XX6A 2F3CI 2JXDA 2DIPA 1HDLA 4SGBI 1UVFA 2XRCA 2JA1A 3BJIA 1FYBA 5HI7A 5DAEA 2DB6A 3OXGA 3TJQA 2LUYA 4JCVE 2M5XA 2ROWA 3RU0A 1CE3A 2ERWA 1DS3I 1CHOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZM A;  2ARP F;  1OVO A;  2N71 A;  4HGU A;  1SGP I;  1Z7K B;  1Y1B A;  4GI3 C;  1CT4 I;  1SGN I;  2N17 A;  2NU2 I;  1KMA A;  1OMT A;  1YTP A;  1AN1 I;  1SGE I;  2KMO A;  3QTL D;  1IY5 A;  1YU6 C;  1LR7 A;  1LR9 A;  1TUR A;  1DS2 I;  2KMQ A;  3B4V C;  1H0Z A;  1OYV I;  1IY6 A;  2GKV A;  2KCX A;  2QQC A;  2LEO A;  1M8B A;  2SGP I;  3OVO A;  1CT2 I;  1SGY I;  1HJA I;  3HH2 C;  2NU4 I;  2SGQ I;  1MT1 A;  2NU1 I;  1PPF I;  1TBQ R;  4OVO A;  1CT0 I;  1TUS A;  1SGQ I;  2KMR A;  2P6A C;  2SGE I;  2WCY A;  1IW4 A;  1UVG A;  2GKR I;  2JYY A;  2KMP A;  1BUS A;  1NUB A;  2NU0 I;  2OVO A;  1TGS I;  1SGD I;  5JHW C;  2BUS A;  2GKT I;  1HPT A;  2SGF I;  3SGQ I;  1TIH A;  2SGD I;  1CGJ I;  1N13 A;  1R0R I;  1OMU A;  1CSO I;  1SGR I;  2N52 A;  1TBR R;  2V53 A;  1M8C A;  2QQD A;  3SEK C;  3SGB I;  1LR8 A;  1CGI I;  1PJU A;  1UUC A;  1Y1C A;  1BMO A;  2NU3 I;  2B0U C;  1PCE A;  2JXD A;  2F3C I;  1HDL A;  4SGB I;  1UVF A;  2XRC A;  1FYB A;  5DAE A;  3TJQ A;  2M5X A;  1CE3 A;  2ERW A;  1DS3 I;  1CHO I; 
#chains in the Genus database with same CATH topology
 4WP4 A;  2JZM A;  2YUU A;  3KY9 A;  2ARP F;  1OVO A;  2OD1 A;  1PTR A;  1K7V A;  2N71 A;  1U5K A;  3R5B A;  1SGP I;  4HGU A;  4AML A;  3UFF A;  1Z7K B;  4E1R A;  1W3S A;  2DKV A;  1MJ9 A;  1Y1B A;  1MJA A;  2CWF A;  4GI3 C;  5CCM A;  2GIV A;  1WTJ A;  1CT4 I;  2ENN A;  2X3T A;  3QWP A;  1Y8F A;  1SGN I;  2N17 A;  2NU2 I;  4UXH A;  1PTQ A;  1KMA A;  1OMT A;  3VDU A;  1XBT A;  1YTP A;  4MPI A;  1AN1 I;  3UEJ A;  1SGE I;  2KMO A;  3FSY A;  3QTL D;  1IY5 A;  5FUV A;  4B6D A;  2QPO A;  1YU6 C;  4FKD A;  1LR7 A;  1LR9 A;  1TUR A;  4UXI A;  1X4S A;  1DS2 I;  2KMQ A;  5E3P A;  3B4V C;  1H0Z A;  4E1P A;  2PQ8 A;  1X74 A;  1OYV I;  1IY6 A;  1K7U A;  3E2I A;  2GKV A;  2KCX A;  3FC3 A;  2QQC A;  2LEO A;  3MEK A;  2E5R A;  5CCL A;  1M8B A;  2RC4 A;  2WGC A;  2SGP I;  2GVI A;  1K7T A;  3OVO A;  1R79 A;  1ULN A;  1WKX A;  5J8F A;  2JW6 A;  2ORV A;  2QQ0 A;  3UGI A;  1CT2 I;  1KBF A;  3VDP A;  2J87 A;  3OXF A;  3TOA A;  1SGY I;  1HJA I;  4DNC A;  2V1C C;  5EX3 A;  3CXL A;  2UVO A;  3FSX A;  3HH2 C;  1MJB A;  2NU4 I;  2SGQ I;  2ENZ A;  7WGA A;  2CWH A;  1MT1 A;  2NU1 I;  2K9H A;  1PPF I;  1W4R A;  3UOE A;  3UEY A;  3TO7 A;  1TBQ R;  4OVO A;  1CT0 I;  4UXJ A;  1TUS A;  1FY7 A;  3PDN A;  2A20 A;  1SGQ I;  2KMR A;  2L8E A;  1FAR A;  2V1C A;  2FNF X;  2Y0M A;  2P6A C;  1V1I A;  1V1H A;  2SGE I;  2WCY A;  2X52 A;  1IW4 A;  5FUY A;  1UVG A;  2GKR I;  2CWG A;  2JYY A;  2KMP A;  1Q9B A;  1NUB A;  1P9Z A;  2NU0 I;  1BUS A;  3UGL A;  2W0T A;  1KBE A;  2OVO A;  1TGS I;  1SGD I;  2ELI A;  3D00 A;  1TBO A;  5JHW C;  2RIJ A;  3TO6 A;  5J8C A;  2BUS A;  2J9R A;  2WVJ A;  2GKT I;  2VRW B;  1HPT A;  2SGF I;  5E3Q A;  2E73 A;  1Z2I A;  3E59 A;  3OL0 A;  3SGQ I;  1TIH A;  2B8T A;  2SGD I;  3GOX A;  1CGJ I;  1N13 A;  3R5C A;  1TOT A;  1R0R I;  1HEV A;  1OMU A;  2LB7 A;  2L7X A;  2ORW A;  1CSO I;  1SGR I;  1WGT A;  2N52 A;  3UGD A;  1TBR R;  2V53 A;  1M8C A;  5HQ8 A;  2UZ3 A;  2ODD A;  2QQD A;  3SEK C;  1ULM A;  4A24 A;  2QQE A;  3SGB I;  1TBN A;  5FUW A;  3VE5 A;  5E3R A;  2CJS C;  3OXL A;  5FUX A;  1RFH A;  1LR8 A;  2N1A B;  1VDD A;  1P9G A;  1CGI I;  1PJU A;  3TOB A;  1UUC A;  1Y1C A;  2YQP A;  1BMO A;  2NU3 I;  4L9M A;  1FAQ A;  1XA6 A;  5EX0 A;  2B0U C;  1PCE A;  1XX6 A;  2F3C I;  2JXD A;  2OZU A;  1ULK A;  2DIP A;  1HDL A;  4SGB I;  1UVF A;  2XRC A;  1UHA A;  2JA1 A;  3BJI A;  3QAH A;  1WGC A;  3R5D A;  1S20 A;  1FYB A;  5HI7 A;  5DAE A;  2OU2 A;  1NXU A;  2DB6 A;  3OXG A;  3TJQ A;  2LUY A;  9WGA A;  4JCV E;  2M5X A;  2ROW A;  3RU0 A;  1CE3 A;  2ERW A;  1DS3 I;  3TO9 A;  3R5A A;  1CHO I; 
#chains in the Genus database with same CATH homology
 2JZM A;  2YUU A;  3KY9 A;  2ARP F;  1OVO A;  2OD1 A;  1PTR A;  2N71 A;  4HGU A;  1U5K A;  1SGP I;  3UFF A;  1Z7K B;  4E1R A;  1W3S A;  1Y1B A;  4GI3 C;  5CCM A;  1CT4 I;  2ENN A;  3QWP A;  1Y8F A;  1SGN I;  2N17 A;  2NU2 I;  4UXH A;  1PTQ A;  1KMA A;  1OMT A;  3VDU A;  1XBT A;  1YTP A;  3UEJ A;  1AN1 I;  1SGE I;  2KMO A;  3QTL D;  1IY5 A;  5FUV A;  4B6D A;  2QPO A;  1YU6 C;  4FKD A;  1LR7 A;  1LR9 A;  1TUR A;  4UXI A;  1X4S A;  1DS2 I;  2KMQ A;  3B4V C;  1H0Z A;  4E1P A;  1X74 A;  1OYV I;  1IY6 A;  3E2I A;  2GKV A;  2KCX A;  3FC3 A;  2QQC A;  2LEO A;  3MEK A;  2E5R A;  5CCL A;  1M8B A;  2SGP I;  2GVI A;  3OVO A;  1R79 A;  2JW6 A;  2ORV A;  2QQ0 A;  3UGI A;  1CT2 I;  1KBF A;  3VDP A;  2J87 A;  3OXF A;  1SGY I;  1HJA I;  2V1C C;  5EX3 A;  3CXL A;  3HH2 C;  2NU4 I;  2SGQ I;  2ENZ A;  1MT1 A;  2NU1 I;  2K9H A;  1PPF I;  1W4R A;  3UEY A;  1TBQ R;  4OVO A;  1CT0 I;  4UXJ A;  1TUS A;  3PDN A;  2A20 A;  1SGQ I;  2KMR A;  2L8E A;  1FAR A;  2V1C A;  2FNF X;  2P6A C;  1V1I A;  1V1H A;  2SGE I;  2WCY A;  1IW4 A;  5FUY A;  1UVG A;  2GKR I;  2JYY A;  2KMP A;  1BUS A;  1NUB A;  2NU0 I;  3UGL A;  2W0T A;  1KBE A;  2OVO A;  1TGS I;  1SGD I;  2ELI A;  3D00 A;  1TBO A;  5JHW C;  2BUS A;  2J9R A;  2WVJ A;  2GKT I;  2VRW B;  1HPT A;  2SGF I;  2E73 A;  3E59 A;  3OL0 A;  3SGQ I;  1TIH A;  2B8T A;  2SGD I;  3GOX A;  1CGJ I;  1N13 A;  1TOT A;  1R0R I;  1OMU A;  2ORW A;  2L7X A;  1CSO I;  1SGR I;  2N52 A;  3UGD A;  1TBR R;  2V53 A;  1M8C A;  5HQ8 A;  2UZ3 A;  2ODD A;  2QQD A;  3SEK C;  4A24 A;  2QQE A;  3SGB I;  1TBN A;  5FUW A;  3VE5 A;  2CJS C;  3OXL A;  5FUX A;  1RFH A;  1LR8 A;  2N1A B;  1VDD A;  1CGI I;  1PJU A;  1UUC A;  1Y1C A;  2YQP A;  1BMO A;  2NU3 I;  4L9M A;  1FAQ A;  1XA6 A;  5EX0 A;  2B0U C;  1PCE A;  1XX6 A;  2F3C I;  2JXD A;  2DIP A;  1HDL A;  4SGB I;  1UVF A;  2XRC A;  2JA1 A;  3BJI A;  1FYB A;  5HI7 A;  5DAE A;  2DB6 A;  3OXG A;  3TJQ A;  2LUY A;  4JCV E;  2M5X A;  2ROW A;  3RU0 A;  1CE3 A;  2ERW A;  1DS3 I;  1CHO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...