1SGQI

Gly 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
b'VDCSEYPKPACTGEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTOMYCES GRISEUS PROTEINASE B
publication title Water molecules participate in proteinase-inhibitor interactions: crystal structures of Leu18, Ala18, and Gly18 variants of turkey ovomucoid inhibitor third domain complexed with Streptomyces griseus proteinase B.
pubmed rcsb
source organism Streptomyces griseus
molecule tags Complex (serine protease/inhibitor)
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1995-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgqI00
2ARPF 2BUSA 2N17A 1CE3A 1CHOI 1Z7KB 2SGQI 3QTLD 1SGEI 1SGQI 1LR9A 1CT2I 1UVFA 4OVOA 1N13A 1SGDI 2GKVA 1TUSA 1OVOA 2QQCA 2ERWA 2QQDA 2M5XA 1TBRR 2XRCA 2P6AC 2OVOA 1PPFI 2KMPA 3SGBI 2GKRI 1YU6C 1DS3I 3B4VC 1CGII 2KCXA 1HPTA 3TJQA 2NU1I 1OYVI 1SGNI 1PCEA 5JHWC 1FYBA 2LEOA 1CT4I 2WCYA 1MT1A 3HH2C 1SGPI 2SGDI 2N71A 3OVOA 1H0ZA 2KMRA 2JZMA 2SGFI 1TBQR 2N52A 2KMQA 1IY6A 1AN1I 1NUBA 1UVGA 2V53A 2GKTI 1Y1CA 1BUSA 1CGJI 2JXDA 1BMOA 1Y1BA 2KMOA 1TGSI 1LR8A 2NU0I 1IY5A 1R0RI 4HGUA 1M8CA 2NU4I 2SGPI 1HJAI 1SGRI 1CSOI 4GI3C 1CT0I 1TIHA 1SGYI 1UUCA 2JYYA 4SGBI 2NU3I 1HDLA 1OMTA 2B0UC 3SEKC 1LR7A 1IW4A 1YTPA 3SGQI 2F3CI 1KMAA 1M8BA 2SGEI 2NU2I 5DAEA 1DS2I 1OMUA 1TURA 1PJUA
chains in the Genus database with same CATH superfamily
2ARPF 2BUSA 2N17A 2OU2A 3D00A 3E2IA 1CE3A 1CHOI 1Z7KB 2SGQI 3QTLD 3TO9A 1SGEI 4L9MA 1Z2IA 5CCMA 1SGQI 1LR9A 1CT2I 1UVFA 5CCLA 2JA1A 4OVOA 2E73A 2CWGA 1N13A 1SGDI 2GKVA 3PDNA 1TUSA 1R79A 1OVOA 2QQCA 2CWHA 1K7UA 3FSXA 3KY9A 1KBFA 2ERWA 2QQDA 2M5XA 2CWFA 2DKVA 1XX6A 2YUUA 3OL0A 4MPIA 3UGDA 3GOXA 1TBRR 2V1CC 2XRCA 3RU0A 2P6AC 5J8FA 3UEJA 1FARA 3UFFA 2OVOA 1PPFI 2KMPA 1X4SA 3SGBI 2GKRI 2ORVA 1YU6C 5FUWA 3OXLA 1DS3I 3TOBA 3VE5A 3B4VC 1ULKA 1MJBA 1CGII 2LUYA 4AMLA 2KCXA 2RC4A 2WVJA 1HPTA 3TJQA 5EX0A 1TBNA 2NU1I 1OYVI 1SGNI 2QPOA 3BJIA 1UHAA 3MEKA 2WGCA 1PCEA 1ULMA 2QQ0A 3FSYA 1V1HA 2LB7A 2LEOA 2QQEA 1V1IA 2YQPA 5FUVA 3E59A 1FYBA 2GIVA 1CT4I 2OZUA 7WGAA 2L7XA 2WCYA 1MT1A 2ENNA 2UVOA 2ODDA 3HH2C 5EX3A 1SGPI 2X3TA 2UZ3A 1MJAA 1ULNA 1NXUA 1PTQA 1XA6A 2A20A 2E5RA 2K9HA 2SGDI 2N71A 1FAQA 3OVOA 1K7TA 2V1CA 2JZMA 2KMRA 2Y0MA 5HQ8A 1H0ZA 4WP4A 1Y8FA 2SGFI 2PQ8A 1U5KA 3UEYA 2W0TA 1WKXA 1W3SA 1TBQR 1XBTA 2N52A 5E3PA 2RIJA 2KMQA 4B6DA 1KBEA 4UXIA 2B8TA 1AN1I 1IY6A 1NUBA 5E3QA 3OXFA 2VRWB 1UVGA 2ORWA 1WGTA 2L8EA 2V53A 9WGAA 1S20A 2GKTI 5J8CA 1Y1CA 1W4RA 1BUSA 3QWPA 1CGJI 2J87A 1BMOA 2JXDA 3TO7A 1Y1BA 2CJSC 2KMOA 4A24A 1TGSI 3UGLA 1LR8A 2NU0I 1X74A 2ELIA 3R5AA 1TOTA 3OXGA 3R5CA 4JCVE 1R0RI 1IY5A 1WTJA 2X52A 1FY7A 4UXJA 3TOAA 1WGCA 4HGUA 1HEVA 5FUYA 5E3RA 3UGIA 3QAHA 1M8CA 2NU4I 5JHWC 3R5BA 2SGPI 1PJUA 2ENZA 1HJAI 1SGRI 2DB6A 3R5DA 1CSOI 1K7VA 4GI3C 5FUXA 3VDPA 1CT0I 1MJ9A 1P9GA 1TIHA 1SGYI 1UUCA 2JYYA 4FKDA 4SGBI 4UXHA 1PTRA 3UOEA 2NU3I 1HDLA 3VDUA 1OMTA 2B0UC 2OD1A 2ROWA 3SEKC 3FC3A 2N1AB 3CXLA 1LR7A 2GVIA 1YTPA 2JW6A 1IW4A 3SGQI 4E1PA 2F3CI 4DNCA 3TO6A 1M8BA 1Q9BA 2FNFX 2SGEI 1KMAA 2NU2I 5DAEA 5HI7A 1DS2I 1OMUA 1P9ZA 2DIPA 2J9RA 4E1RA 1RFHA 1TBOA 1TURA 1VDDA
chains in the Genus database with same CATH topology
2ARPF 2BUSA 2N17A 3D00A 3E2IA 1CE3A 1CHOI 1Z7KB 2SGQI 3QTLD 1SGEI 4L9MA 5CCMA 1SGQI 1LR9A 1CT2I 1UVFA 5CCLA 2JA1A 4OVOA 2E73A 1N13A 1SGDI 2GKVA 3PDNA 1R79A 1OVOA 1TUSA 2QQCA 4B6DA 3KY9A 1KBFA 2ERWA 2QQDA 2M5XA 1XX6A 2YUUA 3OL0A 3UGDA 3GOXA 1TBRR 2V1CC 2XRCA 3RU0A 2P6AC 3UEJA 1FARA 3UFFA 2OVOA 1PPFI 2KMPA 1X4SA 3SGBI 2GKRI 2ORVA 1YU6C 5FUWA 3OXLA 1DS3I 3VE5A 3B4VC 1CGII 2LUYA 2KCXA 2WVJA 1HPTA 3TJQA 5EX0A 1TBNA 2NU1I 1OYVI 1SGNI 2QPOA 3BJIA 3MEKA 1PCEA 2QQ0A 5JHWC 1V1HA 1FYBA 2LEOA 2QQEA 1V1IA 2YQPA 5FUVA 3E59A 1CT4I 2L7XA 2WCYA 1MT1A 2ENNA 2ODDA 3HH2C 5EX3A 1SGPI 2UZ3A 1PTQA 1XA6A 2A20A 2E5RA 2K9HA 2SGDI 2N71A 1FAQA 3OVOA 1H0ZA 2V1CA 2JZMA 2KMRA 5HQ8A 1Y8FA 2SGFI 3UEYA 1U5KA 2W0TA 1W3SA 1TBQR 1XBTA 2N52A 2KMQA 1KBEA 4UXIA 2B8TA 1AN1I 1IY6A 1NUBA 3OXFA 2VRWB 1UVGA 2ORWA 2L8EA 2V53A 2GKTI 1Y1CA 1W4RA 1BUSA 3QWPA 1CGJI 2J87A 1BMOA 2JXDA 1Y1BA 2CJSC 2KMOA 4A24A 1TGSI 3UGLA 1LR8A 2NU0I 1X74A 2ELIA 1TOTA 3OXGA 4JCVE 1IY5A 1R0RI 4UXJA 4HGUA 5FUYA 3UGIA 1M8CA 2NU4I 2SGPI 1PJUA 2ENZA 1HJAI 1SGRI 2DB6A 1CSOI 4GI3C 5FUXA 3VDPA 1CT0I 1TIHA 1SGYI 1UUCA 2JYYA 4FKDA 4SGBI 4UXHA 1PTRA 2NU3I 1HDLA 3VDUA 1OMTA 2B0UC 2OD1A 2ROWA 3SEKC 3FC3A 2N1AB 3CXLA 1LR7A 2GVIA 1YTPA 2JW6A 1IW4A 3SGQI 4E1PA 2F3CI 1KMAA 1M8BA 2FNFX 2SGEI 2NU2I 5DAEA 5HI7A 1DS2I 1OMUA 2DIPA 2J9RA 4E1RA 1RFHA 1TBOA 1TURA 1VDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARP F;  2BUS A;  2N17 A;  1CE3 A;  1CHO I;  1Z7K B;  2SGQ I;  3QTL D;  1SGE I;  1SGQ I;  1LR9 A;  1CT2 I;  1UVF A;  4OVO A;  1N13 A;  1SGD I;  2GKV A;  1TUS A;  1OVO A;  2QQC A;  2ERW A;  2QQD A;  2M5X A;  1TBR R;  2XRC A;  2P6A C;  2OVO A;  1PPF I;  2KMP A;  3SGB I;  2GKR I;  1YU6 C;  1DS3 I;  3B4V C;  1CGI I;  2KCX A;  1HPT A;  3TJQ A;  2NU1 I;  1OYV I;  1SGN I;  1PCE A;  5JHW C;  1FYB A;  2LEO A;  1CT4 I;  2WCY A;  1MT1 A;  3HH2 C;  1SGP I;  2SGD I;  2N71 A;  3OVO A;  1H0Z A;  2KMR A;  2JZM A;  2SGF I;  1TBQ R;  2N52 A;  2KMQ A;  1IY6 A;  1AN1 I;  1NUB A;  1UVG A;  2V53 A;  2GKT I;  1Y1C A;  1BUS A;  1CGJ I;  2JXD A;  1BMO A;  1Y1B A;  2KMO A;  1TGS I;  1LR8 A;  2NU0 I;  1IY5 A;  1R0R I;  4HGU A;  1M8C A;  2NU4 I;  2SGP I;  1HJA I;  1SGR I;  1CSO I;  4GI3 C;  1CT0 I;  1TIH A;  1SGY I;  1UUC A;  2JYY A;  4SGB I;  2NU3 I;  1HDL A;  1OMT A;  2B0U C;  3SEK C;  1LR7 A;  1IW4 A;  1YTP A;  3SGQ I;  2F3C I;  1KMA A;  1M8B A;  2SGE I;  2NU2 I;  5DAE A;  1DS2 I;  1OMU A;  1TUR A;  1PJU A; 
#chains in the Genus database with same CATH topology
 2ARP F;  2BUS A;  2N17 A;  2OU2 A;  3D00 A;  3E2I A;  1CE3 A;  1CHO I;  1Z7K B;  2SGQ I;  3QTL D;  3TO9 A;  1SGE I;  4L9M A;  1Z2I A;  5CCM A;  1SGQ I;  1LR9 A;  1CT2 I;  1UVF A;  5CCL A;  2JA1 A;  4OVO A;  2E73 A;  2CWG A;  1N13 A;  1SGD I;  2GKV A;  3PDN A;  1TUS A;  1R79 A;  1OVO A;  2QQC A;  2CWH A;  1K7U A;  3FSX A;  3KY9 A;  1KBF A;  2ERW A;  2QQD A;  2M5X A;  2CWF A;  2DKV A;  1XX6 A;  2YUU A;  3OL0 A;  4MPI A;  3UGD A;  3GOX A;  1TBR R;  2V1C C;  2XRC A;  3RU0 A;  2P6A C;  5J8F A;  3UEJ A;  1FAR A;  3UFF A;  2OVO A;  1PPF I;  2KMP A;  1X4S A;  3SGB I;  2GKR I;  2ORV A;  1YU6 C;  5FUW A;  3OXL A;  1DS3 I;  3TOB A;  3VE5 A;  3B4V C;  1ULK A;  1MJB A;  1CGI I;  2LUY A;  4AML A;  2KCX A;  2RC4 A;  2WVJ A;  1HPT A;  3TJQ A;  5EX0 A;  1TBN A;  2NU1 I;  1OYV I;  1SGN I;  2QPO A;  3BJI A;  1UHA A;  3MEK A;  2WGC A;  1PCE A;  1ULM A;  2QQ0 A;  3FSY A;  1V1H A;  2LB7 A;  2LEO A;  2QQE A;  1V1I A;  2YQP A;  5FUV A;  3E59 A;  1FYB A;  2GIV A;  1CT4 I;  2OZU A;  7WGA A;  2L7X A;  2WCY A;  1MT1 A;  2ENN A;  2UVO A;  2ODD A;  3HH2 C;  5EX3 A;  1SGP I;  2X3T A;  2UZ3 A;  1MJA A;  1ULN A;  1NXU A;  1PTQ A;  1XA6 A;  2A20 A;  2E5R A;  2K9H A;  2SGD I;  2N71 A;  1FAQ A;  3OVO A;  1K7T A;  2V1C A;  2JZM A;  2KMR A;  2Y0M A;  5HQ8 A;  1H0Z A;  4WP4 A;  1Y8F A;  2SGF I;  2PQ8 A;  1U5K A;  3UEY A;  2W0T A;  1WKX A;  1W3S A;  1TBQ R;  1XBT A;  2N52 A;  5E3P A;  2RIJ A;  2KMQ A;  4B6D A;  1KBE A;  4UXI A;  2B8T A;  1AN1 I;  1IY6 A;  1NUB A;  5E3Q A;  3OXF A;  2VRW B;  1UVG A;  2ORW A;  1WGT A;  2L8E A;  2V53 A;  9WGA A;  1S20 A;  2GKT I;  5J8C A;  1Y1C A;  1W4R A;  1BUS A;  3QWP A;  1CGJ I;  2J87 A;  1BMO A;  2JXD A;  3TO7 A;  1Y1B A;  2CJS C;  2KMO A;  4A24 A;  1TGS I;  3UGL A;  1LR8 A;  2NU0 I;  1X74 A;  2ELI A;  3R5A A;  1TOT A;  3OXG A;  3R5C A;  4JCV E;  1R0R I;  1IY5 A;  1WTJ A;  2X52 A;  1FY7 A;  4UXJ A;  3TOA A;  1WGC A;  4HGU A;  1HEV A;  5FUY A;  5E3R A;  3UGI A;  3QAH A;  1M8C A;  2NU4 I;  5JHW C;  3R5B A;  2SGP I;  1PJU A;  2ENZ A;  1HJA I;  1SGR I;  2DB6 A;  3R5D A;  1CSO I;  1K7V A;  4GI3 C;  5FUX A;  3VDP A;  1CT0 I;  1MJ9 A;  1P9G A;  1TIH A;  1SGY I;  1UUC A;  2JYY A;  4FKD A;  4SGB I;  4UXH A;  1PTR A;  3UOE A;  2NU3 I;  1HDL A;  3VDU A;  1OMT A;  2B0U C;  2OD1 A;  2ROW A;  3SEK C;  3FC3 A;  2N1A B;  3CXL A;  1LR7 A;  2GVI A;  1YTP A;  2JW6 A;  1IW4 A;  3SGQ I;  4E1P A;  2F3C I;  4DNC A;  3TO6 A;  1M8B A;  1Q9B A;  2FNF X;  2SGE I;  1KMA A;  2NU2 I;  5DAE A;  5HI7 A;  1DS2 I;  1OMU A;  1P9Z A;  2DIP A;  2J9R A;  4E1R A;  1RFH A;  1TBO A;  1TUR A;  1VDD A; 
#chains in the Genus database with same CATH homology
 2ARP F;  2BUS A;  2N17 A;  3D00 A;  3E2I A;  1CE3 A;  1CHO I;  1Z7K B;  2SGQ I;  3QTL D;  1SGE I;  4L9M A;  5CCM A;  1SGQ I;  1LR9 A;  1CT2 I;  1UVF A;  5CCL A;  2JA1 A;  4OVO A;  2E73 A;  1N13 A;  1SGD I;  2GKV A;  3PDN A;  1R79 A;  1OVO A;  1TUS A;  2QQC A;  4B6D A;  3KY9 A;  1KBF A;  2ERW A;  2QQD A;  2M5X A;  1XX6 A;  2YUU A;  3OL0 A;  3UGD A;  3GOX A;  1TBR R;  2V1C C;  2XRC A;  3RU0 A;  2P6A C;  3UEJ A;  1FAR A;  3UFF A;  2OVO A;  1PPF I;  2KMP A;  1X4S A;  3SGB I;  2GKR I;  2ORV A;  1YU6 C;  5FUW A;  3OXL A;  1DS3 I;  3VE5 A;  3B4V C;  1CGI I;  2LUY A;  2KCX A;  2WVJ A;  1HPT A;  3TJQ A;  5EX0 A;  1TBN A;  2NU1 I;  1OYV I;  1SGN I;  2QPO A;  3BJI A;  3MEK A;  1PCE A;  2QQ0 A;  5JHW C;  1V1H A;  1FYB A;  2LEO A;  2QQE A;  1V1I A;  2YQP A;  5FUV A;  3E59 A;  1CT4 I;  2L7X A;  2WCY A;  1MT1 A;  2ENN A;  2ODD A;  3HH2 C;  5EX3 A;  1SGP I;  2UZ3 A;  1PTQ A;  1XA6 A;  2A20 A;  2E5R A;  2K9H A;  2SGD I;  2N71 A;  1FAQ A;  3OVO A;  1H0Z A;  2V1C A;  2JZM A;  2KMR A;  5HQ8 A;  1Y8F A;  2SGF I;  3UEY A;  1U5K A;  2W0T A;  1W3S A;  1TBQ R;  1XBT A;  2N52 A;  2KMQ A;  1KBE A;  4UXI A;  2B8T A;  1AN1 I;  1IY6 A;  1NUB A;  3OXF A;  2VRW B;  1UVG A;  2ORW A;  2L8E A;  2V53 A;  2GKT I;  1Y1C A;  1W4R A;  1BUS A;  3QWP A;  1CGJ I;  2J87 A;  1BMO A;  2JXD A;  1Y1B A;  2CJS C;  2KMO A;  4A24 A;  1TGS I;  3UGL A;  1LR8 A;  2NU0 I;  1X74 A;  2ELI A;  1TOT A;  3OXG A;  4JCV E;  1IY5 A;  1R0R I;  4UXJ A;  4HGU A;  5FUY A;  3UGI A;  1M8C A;  2NU4 I;  2SGP I;  1PJU A;  2ENZ A;  1HJA I;  1SGR I;  2DB6 A;  1CSO I;  4GI3 C;  5FUX A;  3VDP A;  1CT0 I;  1TIH A;  1SGY I;  1UUC A;  2JYY A;  4FKD A;  4SGB I;  4UXH A;  1PTR A;  2NU3 I;  1HDL A;  3VDU A;  1OMT A;  2B0U C;  2OD1 A;  2ROW A;  3SEK C;  3FC3 A;  2N1A B;  3CXL A;  1LR7 A;  2GVI A;  1YTP A;  2JW6 A;  1IW4 A;  3SGQ I;  4E1P A;  2F3C I;  1KMA A;  1M8B A;  2FNF X;  2SGE I;  2NU2 I;  5DAE A;  5HI7 A;  1DS2 I;  1OMU A;  2DIP A;  2J9R A;  4E1R A;  1RFH A;  1TBO A;  1TUR A;  1VDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...