1SGQI

Gly 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTGEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTOMYCES GRISEUS PROTEINASE B
publication title Water molecules participate in proteinase-inhibitor interactions: crystal structures of Leu18, Ala18, and Gly18 variants of turkey ovomucoid inhibitor third domain complexed with Streptomyces griseus proteinase B.
pubmed rcsb
source organism Streptomyces griseus
molecule tags Complex (serine protease/inhibitor)
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1995-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgqI00
2QQDA 2JZMA 1M8BA 2NU4I 1UVFA 1CT4I 2F3CI 3SGQI 2OVOA 2NU2I 1PCEA 2KMQA 1SGNI 1BMOA 1FYBA 2KMRA 4GI3C 1OVOA 1TGSI 2NU1I 2KCXA 4OVOA 1LR8A 2KMPA 1DS2I 2JXDA 1PJUA 1UUCA 2SGDI 1N13A 1TURA 1SGYI 5DAEA 1SGPI 2B0UC 2NU3I 2V53A 3TJQA 3HH2C 1AN1I 1IY6A 1NUBA 2QQCA 2LEOA 1CE3A 2JYYA 1TUSA 1Z7KB 1TIHA 1HDLA 3QTLD 1TBQR 3SGBI 1SGRI 2N71A 1TBRR 1M8CA 1SGEI 2WCYA 2NU0I 3OVOA 1OMUA 1YU6C 2ARPF 1CT0I 1Y1BA 3B4VC 2KMOA 4HGUA 1UVGA 1DS3I 2XRCA 4SGBI 2N17A 1SGDI 1IW4A 2GKRI 1CHOI 5JHWC 1LR7A 1CT2I 1PPFI 2SGQI 1IY5A 1H0ZA 3SEKC 1KMAA 1CSOI 1R0RI 1CGII 1Y1CA 2GKVA 2GKTI 2P6AC 1LR9A 1MT1A 2SGEI 2N52A 1OYVI 1YTPA 1HPTA 2BUSA 2SGPI 2ERWA 1OMTA 1BUSA 1CGJI 2SGFI 1SGQI 2M5XA 1HJAI
chains in the Genus database with same CATH superfamily
1U5KA 2QQDA 2JZMA 1M8BA 2NU4I 2L7XA 1UVFA 1CT4I 2F3CI 3SGQI 3FSXA 2OVOA 2NU2I 1PCEA 2KMQA 2OU2A 3QWPA 3UEYA 5FUXA 3BJIA 1SGNI 1BMOA 1XA6A 3TOAA 1FYBA 2GVIA 2KMRA 4GI3C 1OVOA 1TBNA 1R79A 1TGSI 1W4RA 2NU1I 2KCXA 2W0TA 4OVOA 1LR8A 2KMPA 3UGLA 1P9GA 4B6DA 1DS2I 2JXDA 2WVJA 1PJUA 1PTRA 1UUCA 1K7TA 1Q9BA 3OXFA 4UXIA 7WGAA 2SGDI 4MPIA 1N13A 1ULMA 4AMLA 1TURA 4L9MA 1SGYI 1WKXA 1WTJA 2A20A 1SGPI 5DAEA 5HI7A 2QQEA 2ELIA 1V1IA 2B0UC 2CWGA 3E59A 2JW6A 3KY9A 4A24A 2NU3I 1TBOA 1W3SA 2ODDA 3MEKA 3UFFA 2V53A 3TJQA 5J8FA 3HH2C 5J8CA 3VE5A 1UHAA 1WGTA 2QPOA 1AN1I 2ENZA 4DNCA 1ULKA 4FKDA 3UOEA 1NUBA 2E73A 2QQCA 2V1CC 2LEOA 3R5AA 1IY6A 1CE3A 2UVOA 2JYYA 1TUSA 2RIJA 2DB6A 3E2IA 3UGIA 3TO7A 3TO6A 1MJ9A 1Z7KB 1TIHA 1V1HA 1Y8FA 2QQ0A 4JCVE 1NXUA 2WGCA 1HDLA 3QTLD 5FUVA 1TBQR 2L8EA 1XBTA 2DIPA 2ORWA 4WP4A 2YQPA 5E3QA 5FUYA 3SGBI 1SGRI 1Z2IA 5CCMA 3RU0A 2Y0MA 2CWFA 2N71A 2OZUA 2DKVA 1TBRR 3R5BA 5HQ8A 1M8CA 4UXHA 3UEJA 4E1RA 1SGEI 2WCYA 2NU0I 2YUUA 3OVOA 1OMUA 1YU6C 2ARPF 1CT0I 1FARA 3OXLA 3OXGA 1Y1BA 1P9ZA 4UXJA 1KBFA 3CXLA 3B4VC 2KMOA 4HGUA 1UVGA 1DS3I 1S20A 2XRCA 3R5DA 1ULNA 4SGBI 1PTQA 2N17A 3GOXA 2CJSC 1SGDI 2J87A 2X52A 1IW4A 2X3TA 2GKRI 1CHOI 5JHWC 1HEVA 5FUWA 1LR7A 2B8TA 1FY7A 1VDDA 2J9RA 2ROWA 1CT2I 5EX3A 1X4SA 1PPFI 2LUYA 2PQ8A 1K7VA 2SGQI 2V1CA 4E1PA 1IY5A 1H0ZA 1MJBA 3VDUA 3SEKC 3VDPA 1KMAA 1CSOI 1K7UA 2VRWB 2JA1A 1R0RI 1X74A 2UZ3A 3FSYA 3OL0A 1CGII 1Y1CA 2GKVA 2GKTI 2P6AC 1LR9A 1MT1A 1XX6A 2N1AB 1RFHA 2E5RA 2N52A 2SGEI 1OYVI 1YTPA 1HPTA 5E3PA 9WGAA 1KBEA 2BUSA 2GIVA 3TO9A 2K9HA 2SGPI 3TOBA 1FAQA 2LB7A 2CWHA 3PDNA 1TOTA 5E3RA 2ERWA 1OMTA 1MJAA 3FC3A 1BUSA 1CGJI 3D00A 2SGFI 2ORVA 1SGQI 1WGCA 2ENNA 3R5CA 5EX0A 5CCLA 3UGDA 3QAHA 2RC4A 2M5XA 2OD1A 1HJAI 2FNFX
chains in the Genus database with same CATH topology
1U5KA 2QQDA 2JZMA 1M8BA 2NU4I 2L7XA 1UVFA 1CT4I 2F3CI 3SGQI 2OVOA 2NU2I 1PCEA 2KMQA 3QWPA 3UEYA 5FUXA 3BJIA 1SGNI 1BMOA 1XA6A 1FYBA 2GVIA 2KMRA 4GI3C 1OVOA 1TBNA 1R79A 1TGSI 1W4RA 2NU1I 2KCXA 2W0TA 4OVOA 1LR8A 2KMPA 3UGLA 4B6DA 1DS2I 2JXDA 2WVJA 1PJUA 1PTRA 1UUCA 3OXFA 4UXIA 2SGDI 1N13A 1TURA 4L9MA 1SGYI 2A20A 5DAEA 1SGPI 5HI7A 2QQEA 2ELIA 1V1IA 2B0UC 3KY9A 3E59A 2JW6A 4A24A 2NU3I 1TBOA 1W3SA 2ODDA 3MEKA 3UFFA 2V53A 3TJQA 3HH2C 3VE5A 2QPOA 1AN1I 2ENZA 4FKDA 1IY6A 1NUBA 2E73A 2QQCA 2V1CC 2LEOA 1CE3A 2JYYA 1TUSA 2DB6A 3E2IA 3UGIA 1Z7KB 1TIHA 1V1HA 1Y8FA 2QQ0A 4JCVE 1HDLA 3QTLD 5FUVA 1TBQR 2L8EA 1XBTA 2DIPA 2ORWA 2YQPA 5FUYA 3SGBI 1SGRI 5CCMA 3RU0A 2N71A 1TBRR 5HQ8A 1M8CA 4UXHA 3UEJA 4E1RA 1SGEI 2WCYA 2NU0I 2YUUA 3OVOA 1OMUA 1YU6C 2ARPF 1CT0I 1FARA 3OXLA 3OXGA 1Y1BA 4UXJA 1KBFA 3CXLA 3B4VC 2KMOA 4HGUA 1UVGA 1DS3I 2XRCA 4SGBI 1PTQA 2N17A 3GOXA 2CJSC 1SGDI 2J87A 1IW4A 2GKRI 1CHOI 5JHWC 5FUWA 1LR7A 2B8TA 1VDDA 2J9RA 2ROWA 1CT2I 5EX3A 1X4SA 1PPFI 2LUYA 2SGQI 4E1PA 2V1CA 1IY5A 1H0ZA 3VDUA 3SEKC 3VDPA 1KMAA 1CSOI 2VRWB 2JA1A 1R0RI 1X74A 2UZ3A 3OL0A 1CGII 1Y1CA 2GKVA 2GKTI 2P6AC 1LR9A 1MT1A 1XX6A 2N1AB 1RFHA 2E5RA 2N52A 2SGEI 1OYVI 1YTPA 1HPTA 1KBEA 2BUSA 2K9HA 2SGPI 1FAQA 3PDNA 1TOTA 3FC3A 2ERWA 1OMTA 1BUSA 1CGJI 3D00A 2SGFI 2ORVA 1SGQI 2ENNA 5EX0A 5CCLA 3UGDA 2M5XA 2OD1A 1HJAI 2FNFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQD A;  2JZM A;  1M8B A;  2NU4 I;  1UVF A;  1CT4 I;  2F3C I;  3SGQ I;  2OVO A;  2NU2 I;  1PCE A;  2KMQ A;  1SGN I;  1BMO A;  1FYB A;  2KMR A;  4GI3 C;  1OVO A;  1TGS I;  2NU1 I;  2KCX A;  4OVO A;  1LR8 A;  2KMP A;  1DS2 I;  2JXD A;  1PJU A;  1UUC A;  2SGD I;  1N13 A;  1TUR A;  1SGY I;  5DAE A;  1SGP I;  2B0U C;  2NU3 I;  2V53 A;  3TJQ A;  3HH2 C;  1AN1 I;  1IY6 A;  1NUB A;  2QQC A;  2LEO A;  1CE3 A;  2JYY A;  1TUS A;  1Z7K B;  1TIH A;  1HDL A;  3QTL D;  1TBQ R;  3SGB I;  1SGR I;  2N71 A;  1TBR R;  1M8C A;  1SGE I;  2WCY A;  2NU0 I;  3OVO A;  1OMU A;  1YU6 C;  2ARP F;  1CT0 I;  1Y1B A;  3B4V C;  2KMO A;  4HGU A;  1UVG A;  1DS3 I;  2XRC A;  4SGB I;  2N17 A;  1SGD I;  1IW4 A;  2GKR I;  1CHO I;  5JHW C;  1LR7 A;  1CT2 I;  1PPF I;  2SGQ I;  1IY5 A;  1H0Z A;  3SEK C;  1KMA A;  1CSO I;  1R0R I;  1CGI I;  1Y1C A;  2GKV A;  2GKT I;  2P6A C;  1LR9 A;  1MT1 A;  2SGE I;  2N52 A;  1OYV I;  1YTP A;  1HPT A;  2BUS A;  2SGP I;  2ERW A;  1OMT A;  1BUS A;  1CGJ I;  2SGF I;  1SGQ I;  2M5X A;  1HJA I; 
#chains in the Genus database with same CATH topology
 1U5K A;  2QQD A;  2JZM A;  1M8B A;  2NU4 I;  2L7X A;  1UVF A;  1CT4 I;  2F3C I;  3SGQ I;  3FSX A;  2OVO A;  2NU2 I;  1PCE A;  2KMQ A;  2OU2 A;  3QWP A;  3UEY A;  5FUX A;  3BJI A;  1SGN I;  1BMO A;  1XA6 A;  3TOA A;  1FYB A;  2GVI A;  2KMR A;  4GI3 C;  1OVO A;  1TBN A;  1R79 A;  1TGS I;  1W4R A;  2NU1 I;  2KCX A;  2W0T A;  4OVO A;  1LR8 A;  2KMP A;  3UGL A;  1P9G A;  4B6D A;  1DS2 I;  2JXD A;  2WVJ A;  1PJU A;  1PTR A;  1UUC A;  1K7T A;  1Q9B A;  3OXF A;  4UXI A;  7WGA A;  2SGD I;  4MPI A;  1N13 A;  1ULM A;  4AML A;  1TUR A;  4L9M A;  1SGY I;  1WKX A;  1WTJ A;  2A20 A;  1SGP I;  5DAE A;  5HI7 A;  2QQE A;  2ELI A;  1V1I A;  2B0U C;  2CWG A;  3E59 A;  2JW6 A;  3KY9 A;  4A24 A;  2NU3 I;  1TBO A;  1W3S A;  2ODD A;  3MEK A;  3UFF A;  2V53 A;  3TJQ A;  5J8F A;  3HH2 C;  5J8C A;  3VE5 A;  1UHA A;  1WGT A;  2QPO A;  1AN1 I;  2ENZ A;  4DNC A;  1ULK A;  4FKD A;  3UOE A;  1NUB A;  2E73 A;  2QQC A;  2V1C C;  2LEO A;  3R5A A;  1IY6 A;  1CE3 A;  2UVO A;  2JYY A;  1TUS A;  2RIJ A;  2DB6 A;  3E2I A;  3UGI A;  3TO7 A;  3TO6 A;  1MJ9 A;  1Z7K B;  1TIH A;  1V1H A;  1Y8F A;  2QQ0 A;  4JCV E;  1NXU A;  2WGC A;  1HDL A;  3QTL D;  5FUV A;  1TBQ R;  2L8E A;  1XBT A;  2DIP A;  2ORW A;  4WP4 A;  2YQP A;  5E3Q A;  5FUY A;  3SGB I;  1SGR I;  1Z2I A;  5CCM A;  3RU0 A;  2Y0M A;  2CWF A;  2N71 A;  2OZU A;  2DKV A;  1TBR R;  3R5B A;  5HQ8 A;  1M8C A;  4UXH A;  3UEJ A;  4E1R A;  1SGE I;  2WCY A;  2NU0 I;  2YUU A;  3OVO A;  1OMU A;  1YU6 C;  2ARP F;  1CT0 I;  1FAR A;  3OXL A;  3OXG A;  1Y1B A;  1P9Z A;  4UXJ A;  1KBF A;  3CXL A;  3B4V C;  2KMO A;  4HGU A;  1UVG A;  1DS3 I;  1S20 A;  2XRC A;  3R5D A;  1ULN A;  4SGB I;  1PTQ A;  2N17 A;  3GOX A;  2CJS C;  1SGD I;  2J87 A;  2X52 A;  1IW4 A;  2X3T A;  2GKR I;  1CHO I;  5JHW C;  1HEV A;  5FUW A;  1LR7 A;  2B8T A;  1FY7 A;  1VDD A;  2J9R A;  2ROW A;  1CT2 I;  5EX3 A;  1X4S A;  1PPF I;  2LUY A;  2PQ8 A;  1K7V A;  2SGQ I;  2V1C A;  4E1P A;  1IY5 A;  1H0Z A;  1MJB A;  3VDU A;  3SEK C;  3VDP A;  1KMA A;  1CSO I;  1K7U A;  2VRW B;  2JA1 A;  1R0R I;  1X74 A;  2UZ3 A;  3FSY A;  3OL0 A;  1CGI I;  1Y1C A;  2GKV A;  2GKT I;  2P6A C;  1LR9 A;  1MT1 A;  1XX6 A;  2N1A B;  1RFH A;  2E5R A;  2N52 A;  2SGE I;  1OYV I;  1YTP A;  1HPT A;  5E3P A;  9WGA A;  1KBE A;  2BUS A;  2GIV A;  3TO9 A;  2K9H A;  2SGP I;  3TOB A;  1FAQ A;  2LB7 A;  2CWH A;  3PDN A;  1TOT A;  5E3R A;  2ERW A;  1OMT A;  1MJA A;  3FC3 A;  1BUS A;  1CGJ I;  3D00 A;  2SGF I;  2ORV A;  1SGQ I;  1WGC A;  2ENN A;  3R5C A;  5EX0 A;  5CCL A;  3UGD A;  3QAH A;  2RC4 A;  2M5X A;  2OD1 A;  1HJA I;  2FNF X; 
#chains in the Genus database with same CATH homology
 1U5K A;  2QQD A;  2JZM A;  1M8B A;  2NU4 I;  2L7X A;  1UVF A;  1CT4 I;  2F3C I;  3SGQ I;  2OVO A;  2NU2 I;  1PCE A;  2KMQ A;  3QWP A;  3UEY A;  5FUX A;  3BJI A;  1SGN I;  1BMO A;  1XA6 A;  1FYB A;  2GVI A;  2KMR A;  4GI3 C;  1OVO A;  1TBN A;  1R79 A;  1TGS I;  1W4R A;  2NU1 I;  2KCX A;  2W0T A;  4OVO A;  1LR8 A;  2KMP A;  3UGL A;  4B6D A;  1DS2 I;  2JXD A;  2WVJ A;  1PJU A;  1PTR A;  1UUC A;  3OXF A;  4UXI A;  2SGD I;  1N13 A;  1TUR A;  4L9M A;  1SGY I;  2A20 A;  5DAE A;  1SGP I;  5HI7 A;  2QQE A;  2ELI A;  1V1I A;  2B0U C;  3KY9 A;  3E59 A;  2JW6 A;  4A24 A;  2NU3 I;  1TBO A;  1W3S A;  2ODD A;  3MEK A;  3UFF A;  2V53 A;  3TJQ A;  3HH2 C;  3VE5 A;  2QPO A;  1AN1 I;  2ENZ A;  4FKD A;  1IY6 A;  1NUB A;  2E73 A;  2QQC A;  2V1C C;  2LEO A;  1CE3 A;  2JYY A;  1TUS A;  2DB6 A;  3E2I A;  3UGI A;  1Z7K B;  1TIH A;  1V1H A;  1Y8F A;  2QQ0 A;  4JCV E;  1HDL A;  3QTL D;  5FUV A;  1TBQ R;  2L8E A;  1XBT A;  2DIP A;  2ORW A;  2YQP A;  5FUY A;  3SGB I;  1SGR I;  5CCM A;  3RU0 A;  2N71 A;  1TBR R;  5HQ8 A;  1M8C A;  4UXH A;  3UEJ A;  4E1R A;  1SGE I;  2WCY A;  2NU0 I;  2YUU A;  3OVO A;  1OMU A;  1YU6 C;  2ARP F;  1CT0 I;  1FAR A;  3OXL A;  3OXG A;  1Y1B A;  4UXJ A;  1KBF A;  3CXL A;  3B4V C;  2KMO A;  4HGU A;  1UVG A;  1DS3 I;  2XRC A;  4SGB I;  1PTQ A;  2N17 A;  3GOX A;  2CJS C;  1SGD I;  2J87 A;  1IW4 A;  2GKR I;  1CHO I;  5JHW C;  5FUW A;  1LR7 A;  2B8T A;  1VDD A;  2J9R A;  2ROW A;  1CT2 I;  5EX3 A;  1X4S A;  1PPF I;  2LUY A;  2SGQ I;  4E1P A;  2V1C A;  1IY5 A;  1H0Z A;  3VDU A;  3SEK C;  3VDP A;  1KMA A;  1CSO I;  2VRW B;  2JA1 A;  1R0R I;  1X74 A;  2UZ3 A;  3OL0 A;  1CGI I;  1Y1C A;  2GKV A;  2GKT I;  2P6A C;  1LR9 A;  1MT1 A;  1XX6 A;  2N1A B;  1RFH A;  2E5R A;  2N52 A;  2SGE I;  1OYV I;  1YTP A;  1HPT A;  1KBE A;  2BUS A;  2K9H A;  2SGP I;  1FAQ A;  3PDN A;  1TOT A;  3FC3 A;  2ERW A;  1OMT A;  1BUS A;  1CGJ I;  3D00 A;  2SGF I;  2ORV A;  1SGQ I;  2ENN A;  5EX0 A;  5CCL A;  3UGD A;  2M5X A;  2OD1 A;  1HJA I;  2FNF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...