1SGEI

Glu 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTEEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgeI00
1TGSI 1HJAI 1Y1BA 2KMQA 2KMPA 2QQCA 1CHOI 1CGII 3SGQI 1OYVI 4OVOA 1SGNI 2ERWA 2NU4I 1LR8A 1SGYI 1IY5A 2OVOA 1HDLA 2V53A 1M8CA 1CT4I 2NU1I 2BUSA 2P6AC 2JZMA 2JXDA 2NU0I 1H0ZA 1SGRI 1Z7KB 1TUSA 1UUCA 3HH2C 3QTLD 1SGEI 2GKTI 1DS2I 2QQDA 2KMRA 1FYBA 1NUBA 1R0RI 3SGBI 1YU6C 1OVOA 3TJQA 1YTPA 2SGQI 3B4VC 4HGUA 2N17A 1SGPI 1BUSA 1OMTA 2SGDI 2KCXA 5DAEA 1UVGA 2SGEI 1PCEA 1IW4A 1TBRR 1LR7A 2B0UC 4SGBI 2M5XA 1BMOA 1PJUA 2SGFI 2GKRI 1SGQI 1TURA 3OVOA 2KMOA 1TBQR 2N52A 1TIHA 2F3CI 1LR9A 1UVFA 1AN1I 1M8BA 1CSOI 1CT2I 2JYYA 2LEOA 1N13A 1SGDI 1HPTA 1Y1CA 5JHWC 1IY6A 3SEKC 2NU3I 1OMUA 2GKVA 2XRCA 1KMAA 1MT1A 1CE3A 2NU2I 2SGPI 1DS3I 1CGJI 1CT0I 2WCYA 4GI3C 1PPFI 2ARPF 2N71A
chains in the Genus database with same CATH superfamily
1TGSI 2ENZA 1HJAI 1Y1BA 3KY9A 2KMQA 1VDDA 2CWFA 2QQEA 2KMPA 2QQCA 1CHOI 1CGII 3SGQI 2ODDA 4UXJA 5J8CA 1XA6A 2OU2A 3OL0A 1OYVI 4OVOA 1MJAA 1SGNI 2ERWA 2L7XA 2NU4I 1LR8A 1SGYI 1WKXA 1XX6A 3R5DA 5E3QA 3TOAA 1IY5A 1V1HA 2OVOA 1HDLA 2W0TA 1FARA 1PTQA 2V53A 2K9HA 1UHAA 3TOBA 3VDUA 1M8CA 1XBTA 1ULNA 1CT4I 2NU1I 2BUSA 2P6AC 2JZMA 2JXDA 2NU0I 2UVOA 3GOXA 1H0ZA 1SGRI 1Z7KB 1PTRA 3OXFA 3UFFA 3UGDA 2VRWB 1TUSA 1UUCA 3D00A 3HH2C 3QTLD 1MJBA 2N1AB 3FSYA 1SGEI 2GVIA 2V1CC 2GKTI 1S20A 1Y8FA 2JA1A 1DS2I 1K7TA 2QQDA 9WGAA 2KMRA 4E1PA 1FYBA 1NUBA 1KBEA 1R0RI 1NXUA 1W4RA 2X52A 3SGBI 4E1RA 4A24A 5E3PA 1MJ9A 1YU6C 3PDNA 2E73A 2Y0MA 3TJQA 2LB7A 4DNCA 2ELIA 1YTPA 1TOTA 2ROWA 3VDPA 2SGQI 5FUXA 2OD1A 3QWPA 2GIVA 7WGAA 3B4VC 4HGUA 2N17A 4L9MA 1SGPI 5CCLA 3CXLA 5FUYA 4UXIA 1RFHA 1BUSA 1OMTA 2YQPA 4FKDA 2SGDI 2KCXA 5DAEA 3FC3A 1UVGA 1TBOA 2SGEI 4B6DA 5E3RA 1P9GA 1PCEA 1K7UA 3UEYA 3RU0A 1IW4A 1ULMA 1TBRR 1LR7A 1V1IA 2B0UC 1P9ZA 2V1CA 3QAHA 3R5AA 4SGBI 3TO6A 2OZUA 4JCVE 2RIJA 2M5XA 1BMOA 2RC4A 1PJUA 2QPOA 2J9RA 1KBFA 1X4SA 1R79A 5CCMA 4WP4A 2SGFI 5HQ8A 2GKRI 1SGQI 1Z2IA 3UGLA 1FAQA 1TURA 2WVJA 2A20A 3OVOA 1TBNA 5FUVA 3BJIA 2KMOA 1TBQR 2E5RA 2N52A 3E59A 1TIHA 2DB6A 2X3TA 2F3CI 3MEKA 2CWHA 3UOEA 1Q9BA 5FUWA 2YUUA 2CJSC 5EX3A 2DIPA 2LUYA 1K7VA 1LR9A 2QQ0A 1UVFA 5J8FA 1AN1I 2ARPF 1U5KA 2JW6A 2DKVA 2UZ3A 1M8BA 1HEVA 4UXHA 1W3SA 3FSXA 2J87A 1CSOI 1CT2I 2JYYA 5EX0A 3UGIA 3VE5A 2LEOA 1N13A 2B8TA 3OXLA 1SGDI 1HPTA 3OXGA 4AMLA 1Y1CA 1X74A 1WTJA 3TO9A 3UEJA 5JHWC 1IY6A 2ENNA 2FNFX 5HI7A 3SEKC 2NU3I 1OMUA 1FY7A 2GKVA 2XRCA 1ULKA 3TO7A 1WGTA 1KMAA 2L8EA 1MT1A 1CE3A 2NU2I 1WGCA 2SGPI 2WGCA 1DS3I 2PQ8A 3E2IA 1CGJI 1CT0I 2CWGA 2WCYA 3R5BA 4MPIA 4GI3C 2ORWA 1PPFI 2ORVA 3R5CA 1OVOA 2N71A
chains in the Genus database with same CATH topology
1TGSI 2ENZA 1HJAI 1Y1BA 3KY9A 2KMQA 1VDDA 2QQEA 2KMPA 2QQCA 1CHOI 1CGII 3SGQI 2ODDA 4UXJA 1XA6A 3OL0A 1OYVI 4OVOA 1SGNI 2ERWA 2L7XA 2NU4I 1LR8A 1SGYI 1XX6A 1IY5A 1V1HA 2OVOA 1HDLA 2W0TA 1FARA 1PTQA 2V53A 2K9HA 3VDUA 1M8CA 1XBTA 1CT4I 2NU1I 2BUSA 2P6AC 2JZMA 2JXDA 2NU0I 1H0ZA 3GOXA 1SGRI 1Z7KB 1PTRA 3OXFA 3UFFA 3UGDA 2VRWB 1TUSA 1UUCA 3D00A 3HH2C 3QTLD 2N1AB 1SGEI 2GVIA 2V1CC 2GKTI 1Y8FA 2JA1A 1DS2I 2QQDA 2KMRA 4E1PA 1FYBA 1NUBA 1KBEA 1R0RI 1W4RA 3SGBI 4E1RA 4A24A 1YU6C 3PDNA 2E73A 1OVOA 3TJQA 2ELIA 1YTPA 1TOTA 2ROWA 3VDPA 2SGQI 5FUXA 2OD1A 3QWPA 3B4VC 4HGUA 2N17A 4L9MA 1SGPI 5CCLA 3CXLA 5FUYA 4UXIA 1RFHA 1BUSA 1OMTA 2YQPA 4FKDA 2SGDI 2KCXA 5DAEA 3FC3A 1UVGA 1TBOA 2SGEI 4B6DA 1PCEA 3UEYA 3RU0A 1IW4A 1TBRR 1LR7A 1V1IA 2B0UC 2V1CA 4SGBI 4JCVE 2M5XA 1BMOA 1KBFA 1PJUA 2QPOA 2J9RA 1X4SA 1R79A 5CCMA 5HQ8A 2SGFI 2GKRI 1SGQI 3UGLA 1FAQA 1TURA 2WVJA 2A20A 3OVOA 1TBNA 5FUVA 3BJIA 2KMOA 1TBQR 2E5RA 2N52A 3E59A 1TIHA 2DB6A 3MEKA 2F3CI 5FUWA 2YUUA 2CJSC 5EX3A 2DIPA 2LUYA 1LR9A 2QQ0A 1UVFA 1AN1I 1U5KA 2JW6A 2UZ3A 1M8BA 4UXHA 1W3SA 2J87A 1CSOI 1CT2I 2JYYA 5EX0A 3UGIA 3VE5A 2LEOA 1N13A 2B8TA 3OXLA 1SGDI 1HPTA 3OXGA 1Y1CA 1X74A 3UEJA 5JHWC 1IY6A 2ENNA 2FNFX 5HI7A 3SEKC 2NU3I 1OMUA 2GKVA 2XRCA 1KMAA 2L8EA 1MT1A 1CE3A 2NU2I 2SGPI 1DS3I 3E2IA 1CGJI 1CT0I 2WCYA 4GI3C 2ORWA 1PPFI 2ORVA 2ARPF 2N71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TGS I;  1HJA I;  1Y1B A;  2KMQ A;  2KMP A;  2QQC A;  1CHO I;  1CGI I;  3SGQ I;  1OYV I;  4OVO A;  1SGN I;  2ERW A;  2NU4 I;  1LR8 A;  1SGY I;  1IY5 A;  2OVO A;  1HDL A;  2V53 A;  1M8C A;  1CT4 I;  2NU1 I;  2BUS A;  2P6A C;  2JZM A;  2JXD A;  2NU0 I;  1H0Z A;  1SGR I;  1Z7K B;  1TUS A;  1UUC A;  3HH2 C;  3QTL D;  1SGE I;  2GKT I;  1DS2 I;  2QQD A;  2KMR A;  1FYB A;  1NUB A;  1R0R I;  3SGB I;  1YU6 C;  1OVO A;  3TJQ A;  1YTP A;  2SGQ I;  3B4V C;  4HGU A;  2N17 A;  1SGP I;  1BUS A;  1OMT A;  2SGD I;  2KCX A;  5DAE A;  1UVG A;  2SGE I;  1PCE A;  1IW4 A;  1TBR R;  1LR7 A;  2B0U C;  4SGB I;  2M5X A;  1BMO A;  1PJU A;  2SGF I;  2GKR I;  1SGQ I;  1TUR A;  3OVO A;  2KMO A;  1TBQ R;  2N52 A;  1TIH A;  2F3C I;  1LR9 A;  1UVF A;  1AN1 I;  1M8B A;  1CSO I;  1CT2 I;  2JYY A;  2LEO A;  1N13 A;  1SGD I;  1HPT A;  1Y1C A;  5JHW C;  1IY6 A;  3SEK C;  2NU3 I;  1OMU A;  2GKV A;  2XRC A;  1KMA A;  1MT1 A;  1CE3 A;  2NU2 I;  2SGP I;  1DS3 I;  1CGJ I;  1CT0 I;  2WCY A;  4GI3 C;  1PPF I;  2ARP F;  2N71 A; 
#chains in the Genus database with same CATH topology
 1TGS I;  2ENZ A;  1HJA I;  1Y1B A;  3KY9 A;  2KMQ A;  1VDD A;  2CWF A;  2QQE A;  2KMP A;  2QQC A;  1CHO I;  1CGI I;  3SGQ I;  2ODD A;  4UXJ A;  5J8C A;  1XA6 A;  2OU2 A;  3OL0 A;  1OYV I;  4OVO A;  1MJA A;  1SGN I;  2ERW A;  2L7X A;  2NU4 I;  1LR8 A;  1SGY I;  1WKX A;  1XX6 A;  3R5D A;  5E3Q A;  3TOA A;  1IY5 A;  1V1H A;  2OVO A;  1HDL A;  2W0T A;  1FAR A;  1PTQ A;  2V53 A;  2K9H A;  1UHA A;  3TOB A;  3VDU A;  1M8C A;  1XBT A;  1ULN A;  1CT4 I;  2NU1 I;  2BUS A;  2P6A C;  2JZM A;  2JXD A;  2NU0 I;  2UVO A;  3GOX A;  1H0Z A;  1SGR I;  1Z7K B;  1PTR A;  3OXF A;  3UFF A;  3UGD A;  2VRW B;  1TUS A;  1UUC A;  3D00 A;  3HH2 C;  3QTL D;  1MJB A;  2N1A B;  3FSY A;  1SGE I;  2GVI A;  2V1C C;  2GKT I;  1S20 A;  1Y8F A;  2JA1 A;  1DS2 I;  1K7T A;  2QQD A;  9WGA A;  2KMR A;  4E1P A;  1FYB A;  1NUB A;  1KBE A;  1R0R I;  1NXU A;  1W4R A;  2X52 A;  3SGB I;  4E1R A;  4A24 A;  5E3P A;  1MJ9 A;  1YU6 C;  3PDN A;  2E73 A;  2Y0M A;  3TJQ A;  2LB7 A;  4DNC A;  2ELI A;  1YTP A;  1TOT A;  2ROW A;  3VDP A;  2SGQ I;  5FUX A;  2OD1 A;  3QWP A;  2GIV A;  7WGA A;  3B4V C;  4HGU A;  2N17 A;  4L9M A;  1SGP I;  5CCL A;  3CXL A;  5FUY A;  4UXI A;  1RFH A;  1BUS A;  1OMT A;  2YQP A;  4FKD A;  2SGD I;  2KCX A;  5DAE A;  3FC3 A;  1UVG A;  1TBO A;  2SGE I;  4B6D A;  5E3R A;  1P9G A;  1PCE A;  1K7U A;  3UEY A;  3RU0 A;  1IW4 A;  1ULM A;  1TBR R;  1LR7 A;  1V1I A;  2B0U C;  1P9Z A;  2V1C A;  3QAH A;  3R5A A;  4SGB I;  3TO6 A;  2OZU A;  4JCV E;  2RIJ A;  2M5X A;  1BMO A;  2RC4 A;  1PJU A;  2QPO A;  2J9R A;  1KBF A;  1X4S A;  1R79 A;  5CCM A;  4WP4 A;  2SGF I;  5HQ8 A;  2GKR I;  1SGQ I;  1Z2I A;  3UGL A;  1FAQ A;  1TUR A;  2WVJ A;  2A20 A;  3OVO A;  1TBN A;  5FUV A;  3BJI A;  2KMO A;  1TBQ R;  2E5R A;  2N52 A;  3E59 A;  1TIH A;  2DB6 A;  2X3T A;  2F3C I;  3MEK A;  2CWH A;  3UOE A;  1Q9B A;  5FUW A;  2YUU A;  2CJS C;  5EX3 A;  2DIP A;  2LUY A;  1K7V A;  1LR9 A;  2QQ0 A;  1UVF A;  5J8F A;  1AN1 I;  2ARP F;  1U5K A;  2JW6 A;  2DKV A;  2UZ3 A;  1M8B A;  1HEV A;  4UXH A;  1W3S A;  3FSX A;  2J87 A;  1CSO I;  1CT2 I;  2JYY A;  5EX0 A;  3UGI A;  3VE5 A;  2LEO A;  1N13 A;  2B8T A;  3OXL A;  1SGD I;  1HPT A;  3OXG A;  4AML A;  1Y1C A;  1X74 A;  1WTJ A;  3TO9 A;  3UEJ A;  5JHW C;  1IY6 A;  2ENN A;  2FNF X;  5HI7 A;  3SEK C;  2NU3 I;  1OMU A;  1FY7 A;  2GKV A;  2XRC A;  1ULK A;  3TO7 A;  1WGT A;  1KMA A;  2L8E A;  1MT1 A;  1CE3 A;  2NU2 I;  1WGC A;  2SGP I;  2WGC A;  1DS3 I;  2PQ8 A;  3E2I A;  1CGJ I;  1CT0 I;  2CWG A;  2WCY A;  3R5B A;  4MPI A;  4GI3 C;  2ORW A;  1PPF I;  2ORV A;  3R5C A;  1OVO A;  2N71 A; 
#chains in the Genus database with same CATH homology
 1TGS I;  2ENZ A;  1HJA I;  1Y1B A;  3KY9 A;  2KMQ A;  1VDD A;  2QQE A;  2KMP A;  2QQC A;  1CHO I;  1CGI I;  3SGQ I;  2ODD A;  4UXJ A;  1XA6 A;  3OL0 A;  1OYV I;  4OVO A;  1SGN I;  2ERW A;  2L7X A;  2NU4 I;  1LR8 A;  1SGY I;  1XX6 A;  1IY5 A;  1V1H A;  2OVO A;  1HDL A;  2W0T A;  1FAR A;  1PTQ A;  2V53 A;  2K9H A;  3VDU A;  1M8C A;  1XBT A;  1CT4 I;  2NU1 I;  2BUS A;  2P6A C;  2JZM A;  2JXD A;  2NU0 I;  1H0Z A;  3GOX A;  1SGR I;  1Z7K B;  1PTR A;  3OXF A;  3UFF A;  3UGD A;  2VRW B;  1TUS A;  1UUC A;  3D00 A;  3HH2 C;  3QTL D;  2N1A B;  1SGE I;  2GVI A;  2V1C C;  2GKT I;  1Y8F A;  2JA1 A;  1DS2 I;  2QQD A;  2KMR A;  4E1P A;  1FYB A;  1NUB A;  1KBE A;  1R0R I;  1W4R A;  3SGB I;  4E1R A;  4A24 A;  1YU6 C;  3PDN A;  2E73 A;  1OVO A;  3TJQ A;  2ELI A;  1YTP A;  1TOT A;  2ROW A;  3VDP A;  2SGQ I;  5FUX A;  2OD1 A;  3QWP A;  3B4V C;  4HGU A;  2N17 A;  4L9M A;  1SGP I;  5CCL A;  3CXL A;  5FUY A;  4UXI A;  1RFH A;  1BUS A;  1OMT A;  2YQP A;  4FKD A;  2SGD I;  2KCX A;  5DAE A;  3FC3 A;  1UVG A;  1TBO A;  2SGE I;  4B6D A;  1PCE A;  3UEY A;  3RU0 A;  1IW4 A;  1TBR R;  1LR7 A;  1V1I A;  2B0U C;  2V1C A;  4SGB I;  4JCV E;  2M5X A;  1BMO A;  1KBF A;  1PJU A;  2QPO A;  2J9R A;  1X4S A;  1R79 A;  5CCM A;  5HQ8 A;  2SGF I;  2GKR I;  1SGQ I;  3UGL A;  1FAQ A;  1TUR A;  2WVJ A;  2A20 A;  3OVO A;  1TBN A;  5FUV A;  3BJI A;  2KMO A;  1TBQ R;  2E5R A;  2N52 A;  3E59 A;  1TIH A;  2DB6 A;  3MEK A;  2F3C I;  5FUW A;  2YUU A;  2CJS C;  5EX3 A;  2DIP A;  2LUY A;  1LR9 A;  2QQ0 A;  1UVF A;  1AN1 I;  1U5K A;  2JW6 A;  2UZ3 A;  1M8B A;  4UXH A;  1W3S A;  2J87 A;  1CSO I;  1CT2 I;  2JYY A;  5EX0 A;  3UGI A;  3VE5 A;  2LEO A;  1N13 A;  2B8T A;  3OXL A;  1SGD I;  1HPT A;  3OXG A;  1Y1C A;  1X74 A;  3UEJ A;  5JHW C;  1IY6 A;  2ENN A;  2FNF X;  5HI7 A;  3SEK C;  2NU3 I;  1OMU A;  2GKV A;  2XRC A;  1KMA A;  2L8E A;  1MT1 A;  1CE3 A;  2NU2 I;  2SGP I;  1DS3 I;  3E2I A;  1CGJ I;  1CT0 I;  2WCY A;  4GI3 C;  2ORW A;  1PPF I;  2ORV A;  2ARP F;  2N71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...