2ENNA

Solution structure of the first c1 domain from human protein kinase c theta
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
77
structure length
77
Chain Sequence
b'GSSGSSGQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C theta type
publication title Solution structure of the first C1 domain from human protein kinase C theta
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 5
structure length 77
sequence length 77
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2ennA01
3UEJA 3E2IA 2ROWA 2YUUA 1KBFA 1FARA 3CXLA 5FUXA 4UXJA 2FNFX 5FUYA 3BJIA 3KY9A 3UGLA 3UEYA 1TBNA 1W4RA 1XX6A 2WVJA 2JA1A 3UGDA 3UGIA 2J9RA 2ORWA 1PTQA 1PTRA 1XA6A 2ELIA 1XBTA 2QPOA 1TBOA 2ENZA 2ORVA 2QQEA 3UFFA 4FKDA 2J87A 2B8TA 4UXIA 2ENNA 4UXHA 4B6DA 4L9MA 5FUVA 2VRWB 2DB6A 5FUWA 1RFHA 1R79A 1KBEA 2GVIA 2QQ0A 2UZ3A 1FAQA 2E73A 1Y8FA
chains in the Genus database with same CATH superfamily
1SGEI 2NU3I 1M8BA 2E5RA 2W0TA 1K7VA 3R5CA 1TOTA 3SGBI 7WGAA 4WP4A 4MPIA 1CSOI 1MJBA 1WGTA 2XRCA 3BJIA 1U5KA 2P6AC 3PDNA 4HGUA 3UGLA 1UHAA 5E3PA 3UGDA 4E1RA 3OVOA 1K7UA 2NU2I 1ULNA 4A24A 2N52A 2QQEA 3UFFA 2LB7A 5HQ8A 1CHOI 2J87A 4UXIA 4UXHA 1PPFI 1BUSA 4L9MA 4E1PA 3TO7A 5FUWA 2JZMA 5JHWC 1KBEA 1OMUA 2KMOA 1SGNI 2QQ0A 2Y0MA 1CE3A 1CT2I 2WCYA 2E73A 1UVGA 1Y8FA 1X74A 3E2IA 1HJAI 2V1CA 2CJSC 3CXLA 2CWHA 1ULMA 4UXJA 3OXLA 2FNFX 2ODDA 5FUYA 5E3RA 3KY9A 3TOBA 1MT1A 2SGPI 1MJAA 1TBNA 2CWGA 1YU6C 1HEVA 3B4VC 4SGBI 2JYYA 1SGRI 2ORWA 1PTRA 1AN1I 1NUBA 3TO6A 3RU0A 4AMLA 5J8CA 1Y1CA 2ORVA 2QQCA 9WGAA 2NU0I 1HPTA 1SGPI 3R5BA 2B8TA 4FKDA 2ENNA 2N71A 2NU4I 2L8EA 3VDUA 3OXGA 3VDPA 1OVOA 3UOEA 4B6DA 5CCLA 2RIJA 1SGDI 2M5XA 2YQPA 3GOXA 2CWFA 1RFHA 5EX0A 2X3TA 2GVIA 2L7XA 1IY6A 2QQDA 1UUCA 1H0ZA 1LR9A 2PQ8A 2NU1I 3UEJA 2YUUA 1CGII 2K9HA 1CT0I 1FARA 1KMAA 1TBQR 3D00A 1FY7A 1NXUA 4OVOA 5FUXA 1CGJI 2JXDA 2N17A 3UEYA 2GIVA 2WVJA 1X4SA 5E3QA 2JA1A 1PCEA 1LR8A 1TUSA 2GKRI 1DS2I 2J9RA 2KMRA 2JW6A 2SGEI 3OL0A 1XBTA 5HI7A 2KCXA 2ENZA 1WGCA 2OD1A 2V53A 2OU2A 3R5DA 3TO9A 1W3SA 2SGQI 2GKVA 2OZUA 2X52A 2V1CC 3HH2C 3MEKA 2BUSA 2OVOA 1PJUA 2VRWB 2DB6A 1TBRR 3FSXA 5CCMA 1DS3I 1FYBA 2ARPF 2UZ3A 3R5AA 3QAHA 3SGQI 5DAEA 3SEKC 1XA6A 4DNCA 1V1IA 1SGQI 1Q9BA 1M8CA 1MJ9A 2GKTI 2ROWA 3FC3A 1KBFA 1VDDA 3OXFA 2RC4A 1S20A 2B0UC 1IY5A 1HDLA 1UVFA 3QWPA 1R0RI 1Y1BA 4GI3C 1WTJA 2LUYA 1TURA 1K7TA 2WGCA 2UVOA 1TIHA 3TJQA 1CT4I 1W4RA 1XX6A 2N1AB 3E59A 3UGIA 1OMTA 1Z7KB 1PTQA 3FSYA 2ELIA 1P9GA 1N13A 2QPOA 5J8FA 1TBOA 1OYVI 1P9ZA 1SGYI 1TGSI 1IW4A 2DIPA 2SGFI 5FUVA 3TOAA 1BMOA 5EX3A 1Z2IA 1WKXA 1V1HA 2A20A 2LEOA 1R79A 1LR7A 2SGDI 4JCVE 2F3CI 3VE5A 1ULKA 2KMQA 2DKVA 2ERWA 2KMPA 1FAQA 3QTLD 1YTPA
chains in the Genus database with same CATH topology
1SGEI 2NU3I 1M8BA 2E5RA 2W0TA 1TOTA 3SGBI 1CSOI 2XRCA 3BJIA 3PDNA 3UGLA 1U5KA 2P6AC 4HGUA 4E1RA 3UGDA 3OVOA 2NU2I 4A24A 2N52A 2QQEA 3UFFA 5HQ8A 1CHOI 2J87A 4UXIA 4UXHA 1PPFI 1BUSA 4L9MA 4E1PA 5FUWA 2JZMA 5JHWC 1KBEA 1OMUA 2KMOA 1SGNI 2QQ0A 1CE3A 1CT2I 2WCYA 2E73A 1Y8FA 1UVGA 1X74A 3E2IA 1HJAI 2V1CA 2CJSC 3CXLA 4UXJA 3OXLA 2FNFX 2ODDA 5FUYA 3KY9A 1MT1A 2SGPI 1TBNA 1YU6C 3B4VC 4SGBI 2JYYA 1SGRI 2ORWA 1PTRA 1AN1I 1NUBA 3RU0A 1Y1CA 2ORVA 2QQCA 2NU0I 1HPTA 1SGPI 4FKDA 2B8TA 3VDUA 2ENNA 2N71A 2NU4I 2L8EA 3VDPA 3OXGA 4B6DA 1OVOA 5CCLA 3GOXA 1SGDI 2M5XA 2YQPA 1RFHA 5EX0A 2GVIA 2L7XA 1IY6A 2QQDA 1UUCA 1H0ZA 1LR9A 2NU1I 3UEJA 2YUUA 1CGII 2K9HA 1CT0I 1FARA 1KMAA 1TBQR 3D00A 4OVOA 5FUXA 1CGJI 2JXDA 2N17A 3UEYA 2WVJA 1X4SA 2JA1A 1PCEA 1LR8A 1TUSA 2GKRI 1DS2I 2J9RA 2KMRA 2JW6A 2SGEI 3OL0A 1XBTA 5HI7A 2KCXA 2ENZA 2OD1A 2V53A 1W3SA 2SGQI 2GKVA 2V1CC 3HH2C 3MEKA 2BUSA 2OVOA 1PJUA 2VRWB 2DB6A 1TBRR 5CCMA 1DS3I 1FYBA 2ARPF 2UZ3A 3SGQI 5DAEA 3SEKC 1XA6A 1V1IA 1SGQI 1M8CA 2GKTI 2ROWA 1KBFA 3FC3A 1VDDA 3OXFA 2B0UC 1IY5A 1HDLA 1UVFA 3QWPA 1R0RI 1Y1BA 4GI3C 2LUYA 1TURA 1TIHA 3TJQA 1CT4I 1W4RA 1XX6A 2N1AB 3E59A 3UGIA 1OMTA 1Z7KB 1PTQA 2ELIA 2QPOA 1N13A 1TBOA 1OYVI 1SGYI 1TGSI 1IW4A 2DIPA 2SGFI 5FUVA 1BMOA 5EX3A 1V1HA 2A20A 2LEOA 1R79A 1LR7A 2SGDI 4JCVE 2F3CI 3VE5A 2KMQA 2ERWA 2KMPA 1FAQA 3QTLD 1YTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UEJ A;  3E2I A;  2ROW A;  2YUU A;  1KBF A;  1FAR A;  3CXL A;  5FUX A;  4UXJ A;  2FNF X;  5FUY A;  3BJI A;  3KY9 A;  3UGL A;  3UEY A;  1TBN A;  1W4R A;  1XX6 A;  2WVJ A;  2JA1 A;  3UGD A;  3UGI A;  2J9R A;  2ORW A;  1PTQ A;  1PTR A;  1XA6 A;  2ELI A;  1XBT A;  2QPO A;  1TBO A;  2ENZ A;  2ORV A;  2QQE A;  3UFF A;  4FKD A;  2J87 A;  2B8T A;  4UXI A;  2ENN A;  4UXH A;  4B6D A;  4L9M A;  5FUV A;  2VRW B;  2DB6 A;  5FUW A;  1RFH A;  1R79 A;  1KBE A;  2GVI A;  2QQ0 A;  2UZ3 A;  1FAQ A;  2E73 A;  1Y8F A; 
#chains in the Genus database with same CATH topology
 1SGE I;  2NU3 I;  1M8B A;  2E5R A;  2W0T A;  1K7V A;  3R5C A;  1TOT A;  3SGB I;  7WGA A;  4WP4 A;  4MPI A;  1CSO I;  1MJB A;  1WGT A;  2XRC A;  3BJI A;  1U5K A;  2P6A C;  3PDN A;  4HGU A;  3UGL A;  1UHA A;  5E3P A;  3UGD A;  4E1R A;  3OVO A;  1K7U A;  2NU2 I;  1ULN A;  4A24 A;  2N52 A;  2QQE A;  3UFF A;  2LB7 A;  5HQ8 A;  1CHO I;  2J87 A;  4UXI A;  4UXH A;  1PPF I;  1BUS A;  4L9M A;  4E1P A;  3TO7 A;  5FUW A;  2JZM A;  5JHW C;  1KBE A;  1OMU A;  2KMO A;  1SGN I;  2QQ0 A;  2Y0M A;  1CE3 A;  1CT2 I;  2WCY A;  2E73 A;  1UVG A;  1Y8F A;  1X74 A;  3E2I A;  1HJA I;  2V1C A;  2CJS C;  3CXL A;  2CWH A;  1ULM A;  4UXJ A;  3OXL A;  2FNF X;  2ODD A;  5FUY A;  5E3R A;  3KY9 A;  3TOB A;  1MT1 A;  2SGP I;  1MJA A;  1TBN A;  2CWG A;  1YU6 C;  1HEV A;  3B4V C;  4SGB I;  2JYY A;  1SGR I;  2ORW A;  1PTR A;  1AN1 I;  1NUB A;  3TO6 A;  3RU0 A;  4AML A;  5J8C A;  1Y1C A;  2ORV A;  2QQC A;  9WGA A;  2NU0 I;  1HPT A;  1SGP I;  3R5B A;  2B8T A;  4FKD A;  2ENN A;  2N71 A;  2NU4 I;  2L8E A;  3VDU A;  3OXG A;  3VDP A;  1OVO A;  3UOE A;  4B6D A;  5CCL A;  2RIJ A;  1SGD I;  2M5X A;  2YQP A;  3GOX A;  2CWF A;  1RFH A;  5EX0 A;  2X3T A;  2GVI A;  2L7X A;  1IY6 A;  2QQD A;  1UUC A;  1H0Z A;  1LR9 A;  2PQ8 A;  2NU1 I;  3UEJ A;  2YUU A;  1CGI I;  2K9H A;  1CT0 I;  1FAR A;  1KMA A;  1TBQ R;  3D00 A;  1FY7 A;  1NXU A;  4OVO A;  5FUX A;  1CGJ I;  2JXD A;  2N17 A;  3UEY A;  2GIV A;  2WVJ A;  1X4S A;  5E3Q A;  2JA1 A;  1PCE A;  1LR8 A;  1TUS A;  2GKR I;  1DS2 I;  2J9R A;  2KMR A;  2JW6 A;  2SGE I;  3OL0 A;  1XBT A;  5HI7 A;  2KCX A;  2ENZ A;  1WGC A;  2OD1 A;  2V53 A;  2OU2 A;  3R5D A;  3TO9 A;  1W3S A;  2SGQ I;  2GKV A;  2OZU A;  2X52 A;  2V1C C;  3HH2 C;  3MEK A;  2BUS A;  2OVO A;  1PJU A;  2VRW B;  2DB6 A;  1TBR R;  3FSX A;  5CCM A;  1DS3 I;  1FYB A;  2ARP F;  2UZ3 A;  3R5A A;  3QAH A;  3SGQ I;  5DAE A;  3SEK C;  1XA6 A;  4DNC A;  1V1I A;  1SGQ I;  1Q9B A;  1M8C A;  1MJ9 A;  2GKT I;  2ROW A;  3FC3 A;  1KBF A;  1VDD A;  3OXF A;  2RC4 A;  1S20 A;  2B0U C;  1IY5 A;  1HDL A;  1UVF A;  3QWP A;  1R0R I;  1Y1B A;  4GI3 C;  1WTJ A;  2LUY A;  1TUR A;  1K7T A;  2WGC A;  2UVO A;  1TIH A;  3TJQ A;  1CT4 I;  1W4R A;  1XX6 A;  2N1A B;  3E59 A;  3UGI A;  1OMT A;  1Z7K B;  1PTQ A;  3FSY A;  2ELI A;  1P9G A;  1N13 A;  2QPO A;  5J8F A;  1TBO A;  1OYV I;  1P9Z A;  1SGY I;  1TGS I;  1IW4 A;  2DIP A;  2SGF I;  5FUV A;  3TOA A;  1BMO A;  5EX3 A;  1Z2I A;  1WKX A;  1V1H A;  2A20 A;  2LEO A;  1R79 A;  1LR7 A;  2SGD I;  4JCV E;  2F3C I;  3VE5 A;  1ULK A;  2KMQ A;  2DKV A;  2ERW A;  2KMP A;  1FAQ A;  3QTL D;  1YTP A; 
#chains in the Genus database with same CATH homology
 1SGE I;  2NU3 I;  1M8B A;  2E5R A;  2W0T A;  1TOT A;  3SGB I;  1CSO I;  2XRC A;  3BJI A;  3PDN A;  3UGL A;  1U5K A;  2P6A C;  4HGU A;  4E1R A;  3UGD A;  3OVO A;  2NU2 I;  4A24 A;  2N52 A;  2QQE A;  3UFF A;  5HQ8 A;  1CHO I;  2J87 A;  4UXI A;  4UXH A;  1PPF I;  1BUS A;  4L9M A;  4E1P A;  5FUW A;  2JZM A;  5JHW C;  1KBE A;  1OMU A;  2KMO A;  1SGN I;  2QQ0 A;  1CE3 A;  1CT2 I;  2WCY A;  2E73 A;  1Y8F A;  1UVG A;  1X74 A;  3E2I A;  1HJA I;  2V1C A;  2CJS C;  3CXL A;  4UXJ A;  3OXL A;  2FNF X;  2ODD A;  5FUY A;  3KY9 A;  1MT1 A;  2SGP I;  1TBN A;  1YU6 C;  3B4V C;  4SGB I;  2JYY A;  1SGR I;  2ORW A;  1PTR A;  1AN1 I;  1NUB A;  3RU0 A;  1Y1C A;  2ORV A;  2QQC A;  2NU0 I;  1HPT A;  1SGP I;  4FKD A;  2B8T A;  3VDU A;  2ENN A;  2N71 A;  2NU4 I;  2L8E A;  3VDP A;  3OXG A;  4B6D A;  1OVO A;  5CCL A;  3GOX A;  1SGD I;  2M5X A;  2YQP A;  1RFH A;  5EX0 A;  2GVI A;  2L7X A;  1IY6 A;  2QQD A;  1UUC A;  1H0Z A;  1LR9 A;  2NU1 I;  3UEJ A;  2YUU A;  1CGI I;  2K9H A;  1CT0 I;  1FAR A;  1KMA A;  1TBQ R;  3D00 A;  4OVO A;  5FUX A;  1CGJ I;  2JXD A;  2N17 A;  3UEY A;  2WVJ A;  1X4S A;  2JA1 A;  1PCE A;  1LR8 A;  1TUS A;  2GKR I;  1DS2 I;  2J9R A;  2KMR A;  2JW6 A;  2SGE I;  3OL0 A;  1XBT A;  5HI7 A;  2KCX A;  2ENZ A;  2OD1 A;  2V53 A;  1W3S A;  2SGQ I;  2GKV A;  2V1C C;  3HH2 C;  3MEK A;  2BUS A;  2OVO A;  1PJU A;  2VRW B;  2DB6 A;  1TBR R;  5CCM A;  1DS3 I;  1FYB A;  2ARP F;  2UZ3 A;  3SGQ I;  5DAE A;  3SEK C;  1XA6 A;  1V1I A;  1SGQ I;  1M8C A;  2GKT I;  2ROW A;  1KBF A;  3FC3 A;  1VDD A;  3OXF A;  2B0U C;  1IY5 A;  1HDL A;  1UVF A;  3QWP A;  1R0R I;  1Y1B A;  4GI3 C;  2LUY A;  1TUR A;  1TIH A;  3TJQ A;  1CT4 I;  1W4R A;  1XX6 A;  2N1A B;  3E59 A;  3UGI A;  1OMT A;  1Z7K B;  1PTQ A;  2ELI A;  2QPO A;  1N13 A;  1TBO A;  1OYV I;  1SGY I;  1TGS I;  1IW4 A;  2DIP A;  2SGF I;  5FUV A;  1BMO A;  5EX3 A;  1V1H A;  2A20 A;  2LEO A;  1R79 A;  1LR7 A;  2SGD I;  4JCV E;  2F3C I;  3VE5 A;  2KMQ A;  2ERW A;  2KMP A;  1FAQ A;  3QTL D;  1YTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...