2ENNA

Solution structure of the first c1 domain from human protein kinase c theta
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
77
structure length
77
Chain Sequence
GSSGSSGQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the first C1 domain from human protein kinase C theta
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein kinase C theta type
total genus 5
structure length 77
sequence length 77
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2ennA01
2QQ0A 2ORWA 2QQEA 2VRWB 5FUYA 2ELIA 2YUUA 1PTRA 1RFHA 2JA1A 2QPOA 5FUWA 1W4RA 1FAQA 2J87A 1TBOA 1XBTA 2ROWA 3UEJA 4L9MA 4UXIA 2UZ3A 1XX6A 3BJIA 1KBFA 3UGDA 2B8TA 2WVJA 4UXJA 3UFFA 2ORVA 3CXLA 2ENNA 1Y8FA 1XA6A 3KY9A 5FUVA 3UEYA 3UGIA 2GVIA 2E73A 1FARA 1PTQA 4B6DA 2ENZA 2DB6A 5FUXA 3UGLA 1KBEA 4FKDA 1TBNA 4UXHA 2FNFX 1R79A 3E2IA 2J9RA
chains in the Genus database with same CATH superfamily
2NU4I 1OMUA 2GKTI 1CT0I 3FSYA 1HDLA 1NXUA 1Z7KB 4WP4A 3OXGA 1CSOI 1W4RA 1X4SA 2OZUA 2N52A 4HGUA 2X52A 3GOXA 1PPFI 3D00A 3TO9A 1WGCA 2B8TA 2WVJA 4UXJA 2ORVA 2NU2I 2ENNA 1S20A 1Y8FA 2L8EA 1AN1I 1XA6A 2BUSA 2SGDI 2PQ8A 3OVOA 5FUVA 3UEYA 3TOBA 3UGIA 5CCMA 1HEVA 2GVIA 5DAEA 1FARA 1Q9BA 1TOTA 1U5KA 2YQPA 2N1AB 2ODDA 3TJQA 3UGLA 2UVOA 1KBEA 2KMPA 5JHWC 2LB7A 1IY5A 2W0TA 3UEJA 1R79A 3QTLD 1MJBA 2B0UC 3SEKC 2QQEA 3R5CA 4OVOA 1CHOI 2ELIA 1K7UA 2ERWA 2M5XA 1SGQI 2SGQI 1CT2I 1M8CA 1RFHA 2JA1A 3UOEA 2JYYA 2V1CC 7WGAA 3PDNA 1ULKA 2CWFA 1TURA 1XX6A 2X3TA 5HQ8A 1K7TA 1KBFA 2RC4A 1FY7A 3VDUA 2GKRI 2KMQA 5J8FA 1TBQR 2KMRA 2NU3I 4DNCA 3QWPA 2L7XA 1HJAI 1TGSI 3R5AA 2SGEI 1P9ZA 9WGAA 1LR9A 1FYBA 1W3SA 1OVOA 1MJ9A 1MJAA 1PTQA 2JZMA 3OL0A 1H0ZA 3FC3A 2DB6A 2OVOA 1CE3A 2WCYA 3FSXA 2E5RA 3SGQI 4UXHA 2LUYA 1BMOA 1VDDA 3MEKA 1LR7A 3TO6A 2WGCA 3CXLA 1PCEA 2QQDA 1HPTA 2LEOA 2SGPI 2F3CI 1X74A 1OYVI 1YU6C 1V1IA 3R5BA 5EX3A 5CCLA 1KMAA 2KMOA 2RIJA 1FAQA 1SGEI 1XBTA 2ROWA 3VE5A 1SGRI 2N17A 2OD1A 2UZ3A 3BJIA 1SGYI 2KCXA 1UUCA 2NU1I 1UHAA 2V1CA 2JW6A 2P6AC 2CJSC 1ULMA 1SGDI 3B4VC 1Z2IA 2XRCA 4E1PA 4B6DA 3HH2C 4JCVE 1V1HA 2ENZA 1P9GA 1R0RI 1UVFA 1CT4I 4E1RA 4GI3C 1IY6A 1TUSA 2DIPA 2NU0I 1ULNA 1K7VA 1WKXA 2FNFX 4A24A 3E2IA 2J9RA 2ORWA 3OXFA 2CWGA 2QQ0A 5FUYA 2VRWB 1TIHA 1MT1A 2N71A 2YUUA 3TOAA 1WTJA 1DS3I 3SGBI 3E59A 1PTRA 4MPIA 5FUWA 2QPOA 1SGPI 1BUSA 2J87A 1TBOA 1M8BA 3R5DA 1DS2I 4L9MA 1CGII 1Y1BA 2DKVA 4UXIA 1Y1CA 1N13A 2A20A 5E3RA 5E3QA 4AMLA 2SGFI 1IW4A 3QAHA 3UGDA 1TBRR 3UFFA 1LR8A 1SGNI 2JXDA 3KY9A 1NUBA 2GIVA 2Y0MA 5EX0A 5E3PA 1UVGA 1YTPA 5HI7A 3RU0A 1CGJI 2E73A 1WGTA 1OMTA 3TO7A 2OU2A 3OXLA 3VDPA 5FUXA 2GKVA 2ARPF 2QQCA 4FKDA 4SGBI 1TBNA 2CWHA 2V53A 5J8CA 1PJUA 2K9HA
chains in the Genus database with same CATH topology
2NU4I 1OMUA 2GKTI 1CT0I 1Z7KB 3OXGA 1CSOI 1W4RA 1X4SA 2N52A 4HGUA 3GOXA 1PPFI 3D00A 2B8TA 2WVJA 4UXJA 2ORVA 2NU2I 2ENNA 1Y8FA 2L8EA 1AN1I 1XA6A 2BUSA 2SGDI 3OVOA 5FUVA 3UEYA 3UGIA 5CCMA 2GVIA 5DAEA 1FARA 1TOTA 1U5KA 2YQPA 2N1AB 2ODDA 3TJQA 3UGLA 1KBEA 2KMPA 5JHWC 1IY5A 2W0TA 3UEJA 1R79A 3QTLD 2B0UC 3SEKC 2QQEA 4OVOA 1CHOI 2ELIA 2ERWA 2M5XA 1SGQI 2SGQI 1CT2I 1M8CA 1RFHA 2JA1A 2JYYA 2V1CC 3PDNA 1TURA 1XX6A 5HQ8A 1KBFA 3VDUA 2GKRI 2KMQA 1TBQR 2KMRA 2NU3I 3QWPA 2L7XA 1HJAI 1TGSI 2SGEI 1LR9A 1FYBA 1W3SA 1OVOA 1PTQA 2JZMA 3OL0A 1H0ZA 3FC3A 2DB6A 2OVOA 1CE3A 2WCYA 2E5RA 3SGQI 4UXHA 2LUYA 1BMOA 1VDDA 3MEKA 1LR7A 3CXLA 1PCEA 2QQDA 1HPTA 2LEOA 2SGPI 2F3CI 1X74A 1OYVI 1YU6C 1V1IA 5EX3A 5CCLA 1KMAA 2KMOA 1FAQA 1SGEI 1XBTA 2ROWA 3VE5A 1SGRI 2N17A 2OD1A 2UZ3A 3BJIA 1SGYI 2KCXA 1UUCA 2NU1I 2V1CA 2JW6A 2P6AC 2CJSC 1SGDI 3B4VC 2XRCA 4E1PA 4B6DA 3HH2C 4JCVE 1V1HA 2ENZA 1R0RI 1UVFA 1CT4I 4E1RA 4GI3C 1IY6A 1TUSA 2DIPA 2NU0I 2FNFX 4A24A 3E2IA 2J9RA 2ORWA 3OXFA 2QQ0A 5FUYA 2VRWB 1TIHA 1MT1A 2N71A 2YUUA 1DS3I 3SGBI 3E59A 1PTRA 5FUWA 2QPOA 1SGPI 1BUSA 2J87A 1TBOA 1M8BA 1DS2I 4L9MA 1CGII 1Y1BA 4UXIA 1Y1CA 1N13A 2A20A 1IW4A 2SGFI 3UGDA 1TBRR 3UFFA 1LR8A 1SGNI 2JXDA 3KY9A 1NUBA 5EX0A 1HDLA 5HI7A 3RU0A 1UVGA 1YTPA 1CGJI 2E73A 1OMTA 3OXLA 3VDPA 5FUXA 2GKVA 2ARPF 2QQCA 4FKDA 4SGBI 1TBNA 2V53A 1PJUA 2K9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQ0 A;  2ORW A;  2QQE A;  2VRW B;  5FUY A;  2ELI A;  2YUU A;  1PTR A;  1RFH A;  2JA1 A;  2QPO A;  5FUW A;  1W4R A;  1FAQ A;  2J87 A;  1TBO A;  1XBT A;  2ROW A;  3UEJ A;  4L9M A;  4UXI A;  2UZ3 A;  1XX6 A;  3BJI A;  1KBF A;  3UGD A;  2B8T A;  2WVJ A;  4UXJ A;  3UFF A;  2ORV A;  3CXL A;  2ENN A;  1Y8F A;  1XA6 A;  3KY9 A;  5FUV A;  3UEY A;  3UGI A;  2GVI A;  2E73 A;  1FAR A;  1PTQ A;  4B6D A;  2ENZ A;  2DB6 A;  5FUX A;  3UGL A;  1KBE A;  4FKD A;  1TBN A;  4UXH A;  2FNF X;  1R79 A;  3E2I A;  2J9R A; 
#chains in the Genus database with same CATH topology
 2NU4 I;  1OMU A;  2GKT I;  1CT0 I;  3FSY A;  1HDL A;  1NXU A;  1Z7K B;  4WP4 A;  3OXG A;  1CSO I;  1W4R A;  1X4S A;  2OZU A;  2N52 A;  4HGU A;  2X52 A;  3GOX A;  1PPF I;  3D00 A;  3TO9 A;  1WGC A;  2B8T A;  2WVJ A;  4UXJ A;  2ORV A;  2NU2 I;  2ENN A;  1S20 A;  1Y8F A;  2L8E A;  1AN1 I;  1XA6 A;  2BUS A;  2SGD I;  2PQ8 A;  3OVO A;  5FUV A;  3UEY A;  3TOB A;  3UGI A;  5CCM A;  1HEV A;  2GVI A;  5DAE A;  1FAR A;  1Q9B A;  1TOT A;  1U5K A;  2YQP A;  2N1A B;  2ODD A;  3TJQ A;  3UGL A;  2UVO A;  1KBE A;  2KMP A;  5JHW C;  2LB7 A;  1IY5 A;  2W0T A;  3UEJ A;  1R79 A;  3QTL D;  1MJB A;  2B0U C;  3SEK C;  2QQE A;  3R5C A;  4OVO A;  1CHO I;  2ELI A;  1K7U A;  2ERW A;  2M5X A;  1SGQ I;  2SGQ I;  1CT2 I;  1M8C A;  1RFH A;  2JA1 A;  3UOE A;  2JYY A;  2V1C C;  7WGA A;  3PDN A;  1ULK A;  2CWF A;  1TUR A;  1XX6 A;  2X3T A;  5HQ8 A;  1K7T A;  1KBF A;  2RC4 A;  1FY7 A;  3VDU A;  2GKR I;  2KMQ A;  5J8F A;  1TBQ R;  2KMR A;  2NU3 I;  4DNC A;  3QWP A;  2L7X A;  1HJA I;  1TGS I;  3R5A A;  2SGE I;  1P9Z A;  9WGA A;  1LR9 A;  1FYB A;  1W3S A;  1OVO A;  1MJ9 A;  1MJA A;  1PTQ A;  2JZM A;  3OL0 A;  1H0Z A;  3FC3 A;  2DB6 A;  2OVO A;  1CE3 A;  2WCY A;  3FSX A;  2E5R A;  3SGQ I;  4UXH A;  2LUY A;  1BMO A;  1VDD A;  3MEK A;  1LR7 A;  3TO6 A;  2WGC A;  3CXL A;  1PCE A;  2QQD A;  1HPT A;  2LEO A;  2SGP I;  2F3C I;  1X74 A;  1OYV I;  1YU6 C;  1V1I A;  3R5B A;  5EX3 A;  5CCL A;  1KMA A;  2KMO A;  2RIJ A;  1FAQ A;  1SGE I;  1XBT A;  2ROW A;  3VE5 A;  1SGR I;  2N17 A;  2OD1 A;  2UZ3 A;  3BJI A;  1SGY I;  2KCX A;  1UUC A;  2NU1 I;  1UHA A;  2V1C A;  2JW6 A;  2P6A C;  2CJS C;  1ULM A;  1SGD I;  3B4V C;  1Z2I A;  2XRC A;  4E1P A;  4B6D A;  3HH2 C;  4JCV E;  1V1H A;  2ENZ A;  1P9G A;  1R0R I;  1UVF A;  1CT4 I;  4E1R A;  4GI3 C;  1IY6 A;  1TUS A;  2DIP A;  2NU0 I;  1ULN A;  1K7V A;  1WKX A;  2FNF X;  4A24 A;  3E2I A;  2J9R A;  2ORW A;  3OXF A;  2CWG A;  2QQ0 A;  5FUY A;  2VRW B;  1TIH A;  1MT1 A;  2N71 A;  2YUU A;  3TOA A;  1WTJ A;  1DS3 I;  3SGB I;  3E59 A;  1PTR A;  4MPI A;  5FUW A;  2QPO A;  1SGP I;  1BUS A;  2J87 A;  1TBO A;  1M8B A;  3R5D A;  1DS2 I;  4L9M A;  1CGI I;  1Y1B A;  2DKV A;  4UXI A;  1Y1C A;  1N13 A;  2A20 A;  5E3R A;  5E3Q A;  4AML A;  2SGF I;  1IW4 A;  3QAH A;  3UGD A;  1TBR R;  3UFF A;  1LR8 A;  1SGN I;  2JXD A;  3KY9 A;  1NUB A;  2GIV A;  2Y0M A;  5EX0 A;  5E3P A;  1UVG A;  1YTP A;  5HI7 A;  3RU0 A;  1CGJ I;  2E73 A;  1WGT A;  1OMT A;  3TO7 A;  2OU2 A;  3OXL A;  3VDP A;  5FUX A;  2GKV A;  2ARP F;  2QQC A;  4FKD A;  4SGB I;  1TBN A;  2CWH A;  2V53 A;  5J8C A;  1PJU A;  2K9H A; 
#chains in the Genus database with same CATH homology
 2NU4 I;  1OMU A;  2GKT I;  1CT0 I;  1Z7K B;  3OXG A;  1CSO I;  1W4R A;  1X4S A;  2N52 A;  4HGU A;  3GOX A;  1PPF I;  3D00 A;  2B8T A;  2WVJ A;  4UXJ A;  2ORV A;  2NU2 I;  2ENN A;  1Y8F A;  2L8E A;  1AN1 I;  1XA6 A;  2BUS A;  2SGD I;  3OVO A;  5FUV A;  3UEY A;  3UGI A;  5CCM A;  2GVI A;  5DAE A;  1FAR A;  1TOT A;  1U5K A;  2YQP A;  2N1A B;  2ODD A;  3TJQ A;  3UGL A;  1KBE A;  2KMP A;  5JHW C;  1IY5 A;  2W0T A;  3UEJ A;  1R79 A;  3QTL D;  2B0U C;  3SEK C;  2QQE A;  4OVO A;  1CHO I;  2ELI A;  2ERW A;  2M5X A;  1SGQ I;  2SGQ I;  1CT2 I;  1M8C A;  1RFH A;  2JA1 A;  2JYY A;  2V1C C;  3PDN A;  1TUR A;  1XX6 A;  5HQ8 A;  1KBF A;  3VDU A;  2GKR I;  2KMQ A;  1TBQ R;  2KMR A;  2NU3 I;  3QWP A;  2L7X A;  1HJA I;  1TGS I;  2SGE I;  1LR9 A;  1FYB A;  1W3S A;  1OVO A;  1PTQ A;  2JZM A;  3OL0 A;  1H0Z A;  3FC3 A;  2DB6 A;  2OVO A;  1CE3 A;  2WCY A;  2E5R A;  3SGQ I;  4UXH A;  2LUY A;  1BMO A;  1VDD A;  3MEK A;  1LR7 A;  3CXL A;  1PCE A;  2QQD A;  1HPT A;  2LEO A;  2SGP I;  2F3C I;  1X74 A;  1OYV I;  1YU6 C;  1V1I A;  5EX3 A;  5CCL A;  1KMA A;  2KMO A;  1FAQ A;  1SGE I;  1XBT A;  2ROW A;  3VE5 A;  1SGR I;  2N17 A;  2OD1 A;  2UZ3 A;  3BJI A;  1SGY I;  2KCX A;  1UUC A;  2NU1 I;  2V1C A;  2JW6 A;  2P6A C;  2CJS C;  1SGD I;  3B4V C;  2XRC A;  4E1P A;  4B6D A;  3HH2 C;  4JCV E;  1V1H A;  2ENZ A;  1R0R I;  1UVF A;  1CT4 I;  4E1R A;  4GI3 C;  1IY6 A;  1TUS A;  2DIP A;  2NU0 I;  2FNF X;  4A24 A;  3E2I A;  2J9R A;  2ORW A;  3OXF A;  2QQ0 A;  5FUY A;  2VRW B;  1TIH A;  1MT1 A;  2N71 A;  2YUU A;  1DS3 I;  3SGB I;  3E59 A;  1PTR A;  5FUW A;  2QPO A;  1SGP I;  1BUS A;  2J87 A;  1TBO A;  1M8B A;  1DS2 I;  4L9M A;  1CGI I;  1Y1B A;  4UXI A;  1Y1C A;  1N13 A;  2A20 A;  1IW4 A;  2SGF I;  3UGD A;  1TBR R;  3UFF A;  1LR8 A;  1SGN I;  2JXD A;  3KY9 A;  1NUB A;  5EX0 A;  1HDL A;  5HI7 A;  3RU0 A;  1UVG A;  1YTP A;  1CGJ I;  2E73 A;  1OMT A;  3OXL A;  3VDP A;  5FUX A;  2GKV A;  2ARP F;  2QQC A;  4FKD A;  4SGB I;  1TBN A;  2V53 A;  1PJU A;  2K9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...