2ENNA

Solution structure of the first c1 domain from human protein kinase c theta
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
77
structure length
77
Chain Sequence
GSSGSSGQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the first C1 domain from human protein kinase C theta
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein kinase C theta type
total genus 5
structure length 77
sequence length 77
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2ennA01
2ENNA 5FUVA 4B6DA 1PTRA 2B8TA 2J9RA 2UZ3A 1TBOA 5FUWA 3UGDA 5FUXA 2YUUA 4L9MA 1XBTA 4FKDA 2QQ0A 2GVIA 2ENZA 3CXLA 1FARA 2DB6A 2QPOA 3UEJA 3KY9A 3UEYA 2WVJA 2E73A 2ORWA 2ROWA 1W4RA 4UXIA 1XX6A 1RFHA 2ELIA 2QQEA 1TBNA 2JA1A 1Y8FA 4UXHA 3UGIA 3UFFA 1XA6A 5FUYA 2ORVA 1FAQA 2J87A 1PTQA 3BJIA 3UGLA 1R79A 1KBFA 4UXJA 3E2IA 2VRWB 1KBEA 2FNFX
chains in the Genus database with same CATH superfamily
2V1CA 5EX3A 1SGQI 1V1HA 2OD1A 2B8TA 2YQPA 3OXLA 1K7VA 2N52A 2NU3I 1NXUA 1M8CA 2JZMA 2YUUA 5EX0A 1DS2I 1WKXA 1IY5A 4MPIA 2JXDA 2GKRI 1TBRR 2NU1I 2DB6A 2V1CC 2XRCA 1ULKA 3KY9A 1WTJA 1PPFI 1PCEA 2SGQI 1W4RA 1V1IA 2GIVA 4SGBI 2P6AC 3R5BA 3QWPA 1P9ZA 1R0RI 1SGRI 1LR9A 2JA1A 2N17A 1CT0I 4OVOA 4JCVE 2ARPF 1HDLA 1ULMA 1Z2IA 1U5KA 3TO9A 1FYBA 1CSOI 1SGPI 1CT2I 2Y0MA 2VRWB 1KBEA 1K7UA 3E2IA 1KBFA 1PJUA 5HI7A 1AN1I 2ENNA 5FUVA 5E3RA 5DAEA 1K7TA 1SGNI 1WGTA 1WGCA 2UZ3A 5FUWA 4GI3C 3VDPA 5FUXA 2KMRA 2QQ0A 2ENZA 2OVOA 3VDUA 1Y1CA 2DKVA 5J8CA 1SGYI 2UVOA 1FARA 3SGBI 2RIJA 1BMOA 1TGSI 1W3SA 5E3QA 2SGFI 1N13A 2E73A 2N1AB 2LUYA 1MJAA 2F3CI 2ORWA 4E1PA 2DIPA 1Y1BA 2KMPA 2K9HA 2ODDA 2QQCA 1YTPA 2QQEA 1Y8FA 4UXHA 2BUSA 9WGAA 3OXFA 3FC3A 1TOTA 2QQDA 4HGUA 3PDNA 5FUYA 2ORVA 5CCLA 2J87A 3UGLA 1OYVI 1R79A 1OMTA 2LB7A 2V53A 3VE5A 3FSXA 3QTLD 4AMLA 1CHOI 1HEVA 1PTRA 2CJSC 1H0ZA 4E1RA 1UVGA 1CT4I 3R5DA 3SEKC 2RC4A 2OU2A 1XBTA 4FKDA 2GVIA 2PQ8A 1SGDI 3B4VC 2KCXA 1IW4A 4A24A 2KMOA 2L8EA 2JYYA 2X52A 3CXLA 1VDDA 2QPOA 3OVOA 3TO6A 1LR8A 1UUCA 1CGJI 2ROWA 3SGQI 5E3PA 2GKVA 3E59A 1S20A 3QAHA 4UXJA 7WGAA 1NUBA 1XX6A 1HPTA 1RFHA 2ELIA 5J8FA 1YU6C 1MT1A 1TBNA 2CWGA 4WP4A 1XA6A 1IY6A 1FAQA 2SGDI 1PTQA 4DNCA 2ERWA 1FY7A 1BUSA 1CE3A 1CGII 2W0TA 5JHWC 2L7XA 1TIHA 2A20A 1M8BA 3RU0A 4B6DA 1KMAA 2J9RA 1HJAI 1TBQR 1TBOA 2B0UC 3UGDA 3D00A 3R5AA 2CWHA 1Q9BA 4L9MA 2WCYA 1MJBA 2SGPI 3FSYA 1DS3I 1ULNA 2LEOA 2NU2I 1UVFA 2X3TA 3TOAA 2KMQA 2GKTI 2JW6A 2NU0I 5HQ8A 1LR7A 1TURA 1OMUA 3UEJA 1MJ9A 2OZUA 2WVJA 3UEYA 1P9GA 1UHAA 2CWFA 1TUSA 1Z7KB 4UXIA 2M5XA 3TOBA 3GOXA 1X4SA 3UOEA 5CCMA 3OXGA 1OVOA 2WGCA 1SGEI 3R5CA 2N71A 3UGIA 2E5RA 3UFFA 3TJQA 3HH2C 3BJIA 3TO7A 3OL0A 2SGEI 1X74A 3MEKA 2NU4I 2FNFX
chains in the Genus database with same CATH topology
2V1CA 5EX3A 1SGQI 1V1HA 2OD1A 2B8TA 2YQPA 3OXLA 2N52A 2NU3I 1M8CA 2JZMA 2YUUA 5EX0A 1DS2I 1IY5A 2JXDA 2GKRI 1TBRR 2NU1I 2DB6A 2V1CC 2XRCA 3KY9A 1PPFI 1PCEA 2SGQI 1W4RA 1V1IA 4SGBI 2P6AC 3QWPA 1R0RI 1SGRI 1LR9A 2JA1A 2N17A 1CT0I 4OVOA 4JCVE 2ARPF 1HDLA 1U5KA 1FYBA 1CSOI 1SGPI 1CT2I 3E2IA 2VRWB 1KBEA 1KBFA 1PJUA 5HI7A 1AN1I 2ENNA 5FUVA 5DAEA 1SGNI 5FUWA 2UZ3A 4GI3C 3VDPA 5FUXA 2KMRA 2QQ0A 2ENZA 2OVOA 3VDUA 1Y1CA 1SGYI 1FARA 1BMOA 1TGSI 1W3SA 3SGBI 2SGFI 1N13A 2E73A 2N1AB 2LUYA 2F3CI 2ORWA 4E1PA 2DIPA 1Y1BA 2KMPA 2K9HA 2ODDA 2QQCA 1YTPA 2QQEA 1Y8FA 4UXHA 2BUSA 3FC3A 3OXFA 1TOTA 2QQDA 4HGUA 3PDNA 5FUYA 2ORVA 5CCLA 2J87A 3UGLA 1OYVI 1R79A 1OMTA 2V53A 3QTLD 1CHOI 1PTRA 2CJSC 1H0ZA 4E1RA 1UVGA 1CT4I 3SEKC 1XBTA 4FKDA 2GVIA 1SGDI 3B4VC 2KCXA 1IW4A 4A24A 2KMOA 2L8EA 2JYYA 3CXLA 3OVOA 1VDDA 2QPOA 3VE5A 1LR8A 1UUCA 1CGJI 2ROWA 3SGQI 2GKVA 3E59A 4UXJA 1NUBA 1XX6A 1HPTA 1RFHA 2ELIA 1YU6C 1MT1A 1TBNA 1XA6A 1IY6A 1FAQA 2SGDI 1PTQA 2ERWA 1BUSA 1CE3A 1CGII 2W0TA 5JHWC 2L7XA 1TIHA 2A20A 1M8BA 3RU0A 4B6DA 1KMAA 2J9RA 1HJAI 1TBQR 1TBOA 2B0UC 3UGDA 3D00A 4L9MA 2WCYA 2SGPI 1DS3I 2LEOA 2NU2I 1UVFA 2KMQA 2GKTI 2JW6A 2NU0I 5HQ8A 1LR7A 1TURA 1OMUA 3UEJA 3UEYA 2WVJA 4UXIA 1TUSA 1Z7KB 2M5XA 3GOXA 1X4SA 5CCMA 3OXGA 1OVOA 1SGEI 2N71A 3UGIA 2E5RA 3UFFA 3TJQA 3HH2C 3BJIA 3OL0A 2SGEI 1X74A 3MEKA 2NU4I 2FNFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENN A;  5FUV A;  4B6D A;  1PTR A;  2B8T A;  2J9R A;  2UZ3 A;  1TBO A;  5FUW A;  3UGD A;  5FUX A;  2YUU A;  4L9M A;  1XBT A;  4FKD A;  2QQ0 A;  2GVI A;  2ENZ A;  3CXL A;  1FAR A;  2DB6 A;  2QPO A;  3UEJ A;  3KY9 A;  3UEY A;  2WVJ A;  2E73 A;  2ORW A;  2ROW A;  1W4R A;  4UXI A;  1XX6 A;  1RFH A;  2ELI A;  2QQE A;  1TBN A;  2JA1 A;  1Y8F A;  4UXH A;  3UGI A;  3UFF A;  1XA6 A;  5FUY A;  2ORV A;  1FAQ A;  2J87 A;  1PTQ A;  3BJI A;  3UGL A;  1R79 A;  1KBF A;  4UXJ A;  3E2I A;  2VRW B;  1KBE A;  2FNF X; 
#chains in the Genus database with same CATH topology
 2V1C A;  5EX3 A;  1SGQ I;  1V1H A;  2OD1 A;  2B8T A;  2YQP A;  3OXL A;  1K7V A;  2N52 A;  2NU3 I;  1NXU A;  1M8C A;  2JZM A;  2YUU A;  5EX0 A;  1DS2 I;  1WKX A;  1IY5 A;  4MPI A;  2JXD A;  2GKR I;  1TBR R;  2NU1 I;  2DB6 A;  2V1C C;  2XRC A;  1ULK A;  3KY9 A;  1WTJ A;  1PPF I;  1PCE A;  2SGQ I;  1W4R A;  1V1I A;  2GIV A;  4SGB I;  2P6A C;  3R5B A;  3QWP A;  1P9Z A;  1R0R I;  1SGR I;  1LR9 A;  2JA1 A;  2N17 A;  1CT0 I;  4OVO A;  4JCV E;  2ARP F;  1HDL A;  1ULM A;  1Z2I A;  1U5K A;  3TO9 A;  1FYB A;  1CSO I;  1SGP I;  1CT2 I;  2Y0M A;  2VRW B;  1KBE A;  1K7U A;  3E2I A;  1KBF A;  1PJU A;  5HI7 A;  1AN1 I;  2ENN A;  5FUV A;  5E3R A;  5DAE A;  1K7T A;  1SGN I;  1WGT A;  1WGC A;  2UZ3 A;  5FUW A;  4GI3 C;  3VDP A;  5FUX A;  2KMR A;  2QQ0 A;  2ENZ A;  2OVO A;  3VDU A;  1Y1C A;  2DKV A;  5J8C A;  1SGY I;  2UVO A;  1FAR A;  3SGB I;  2RIJ A;  1BMO A;  1TGS I;  1W3S A;  5E3Q A;  2SGF I;  1N13 A;  2E73 A;  2N1A B;  2LUY A;  1MJA A;  2F3C I;  2ORW A;  4E1P A;  2DIP A;  1Y1B A;  2KMP A;  2K9H A;  2ODD A;  2QQC A;  1YTP A;  2QQE A;  1Y8F A;  4UXH A;  2BUS A;  9WGA A;  3OXF A;  3FC3 A;  1TOT A;  2QQD A;  4HGU A;  3PDN A;  5FUY A;  2ORV A;  5CCL A;  2J87 A;  3UGL A;  1OYV I;  1R79 A;  1OMT A;  2LB7 A;  2V53 A;  3VE5 A;  3FSX A;  3QTL D;  4AML A;  1CHO I;  1HEV A;  1PTR A;  2CJS C;  1H0Z A;  4E1R A;  1UVG A;  1CT4 I;  3R5D A;  3SEK C;  2RC4 A;  2OU2 A;  1XBT A;  4FKD A;  2GVI A;  2PQ8 A;  1SGD I;  3B4V C;  2KCX A;  1IW4 A;  4A24 A;  2KMO A;  2L8E A;  2JYY A;  2X52 A;  3CXL A;  1VDD A;  2QPO A;  3OVO A;  3TO6 A;  1LR8 A;  1UUC A;  1CGJ I;  2ROW A;  3SGQ I;  5E3P A;  2GKV A;  3E59 A;  1S20 A;  3QAH A;  4UXJ A;  7WGA A;  1NUB A;  1XX6 A;  1HPT A;  1RFH A;  2ELI A;  5J8F A;  1YU6 C;  1MT1 A;  1TBN A;  2CWG A;  4WP4 A;  1XA6 A;  1IY6 A;  1FAQ A;  2SGD I;  1PTQ A;  4DNC A;  2ERW A;  1FY7 A;  1BUS A;  1CE3 A;  1CGI I;  2W0T A;  5JHW C;  2L7X A;  1TIH A;  2A20 A;  1M8B A;  3RU0 A;  4B6D A;  1KMA A;  2J9R A;  1HJA I;  1TBQ R;  1TBO A;  2B0U C;  3UGD A;  3D00 A;  3R5A A;  2CWH A;  1Q9B A;  4L9M A;  2WCY A;  1MJB A;  2SGP I;  3FSY A;  1DS3 I;  1ULN A;  2LEO A;  2NU2 I;  1UVF A;  2X3T A;  3TOA A;  2KMQ A;  2GKT I;  2JW6 A;  2NU0 I;  5HQ8 A;  1LR7 A;  1TUR A;  1OMU A;  3UEJ A;  1MJ9 A;  2OZU A;  2WVJ A;  3UEY A;  1P9G A;  1UHA A;  2CWF A;  1TUS A;  1Z7K B;  4UXI A;  2M5X A;  3TOB A;  3GOX A;  1X4S A;  3UOE A;  5CCM A;  3OXG A;  1OVO A;  2WGC A;  1SGE I;  3R5C A;  2N71 A;  3UGI A;  2E5R A;  3UFF A;  3TJQ A;  3HH2 C;  3BJI A;  3TO7 A;  3OL0 A;  2SGE I;  1X74 A;  3MEK A;  2NU4 I;  2FNF X; 
#chains in the Genus database with same CATH homology
 2V1C A;  5EX3 A;  1SGQ I;  1V1H A;  2OD1 A;  2B8T A;  2YQP A;  3OXL A;  2N52 A;  2NU3 I;  1M8C A;  2JZM A;  2YUU A;  5EX0 A;  1DS2 I;  1IY5 A;  2JXD A;  2GKR I;  1TBR R;  2NU1 I;  2DB6 A;  2V1C C;  2XRC A;  3KY9 A;  1PPF I;  1PCE A;  2SGQ I;  1W4R A;  1V1I A;  4SGB I;  2P6A C;  3QWP A;  1R0R I;  1SGR I;  1LR9 A;  2JA1 A;  2N17 A;  1CT0 I;  4OVO A;  4JCV E;  2ARP F;  1HDL A;  1U5K A;  1FYB A;  1CSO I;  1SGP I;  1CT2 I;  3E2I A;  2VRW B;  1KBE A;  1KBF A;  1PJU A;  5HI7 A;  1AN1 I;  2ENN A;  5FUV A;  5DAE A;  1SGN I;  5FUW A;  2UZ3 A;  4GI3 C;  3VDP A;  5FUX A;  2KMR A;  2QQ0 A;  2ENZ A;  2OVO A;  3VDU A;  1Y1C A;  1SGY I;  1FAR A;  1BMO A;  1TGS I;  1W3S A;  3SGB I;  2SGF I;  1N13 A;  2E73 A;  2N1A B;  2LUY A;  2F3C I;  2ORW A;  4E1P A;  2DIP A;  1Y1B A;  2KMP A;  2K9H A;  2ODD A;  2QQC A;  1YTP A;  2QQE A;  1Y8F A;  4UXH A;  2BUS A;  3FC3 A;  3OXF A;  1TOT A;  2QQD A;  4HGU A;  3PDN A;  5FUY A;  2ORV A;  5CCL A;  2J87 A;  3UGL A;  1OYV I;  1R79 A;  1OMT A;  2V53 A;  3QTL D;  1CHO I;  1PTR A;  2CJS C;  1H0Z A;  4E1R A;  1UVG A;  1CT4 I;  3SEK C;  1XBT A;  4FKD A;  2GVI A;  1SGD I;  3B4V C;  2KCX A;  1IW4 A;  4A24 A;  2KMO A;  2L8E A;  2JYY A;  3CXL A;  3OVO A;  1VDD A;  2QPO A;  3VE5 A;  1LR8 A;  1UUC A;  1CGJ I;  2ROW A;  3SGQ I;  2GKV A;  3E59 A;  4UXJ A;  1NUB A;  1XX6 A;  1HPT A;  1RFH A;  2ELI A;  1YU6 C;  1MT1 A;  1TBN A;  1XA6 A;  1IY6 A;  1FAQ A;  2SGD I;  1PTQ A;  2ERW A;  1BUS A;  1CE3 A;  1CGI I;  2W0T A;  5JHW C;  2L7X A;  1TIH A;  2A20 A;  1M8B A;  3RU0 A;  4B6D A;  1KMA A;  2J9R A;  1HJA I;  1TBQ R;  1TBO A;  2B0U C;  3UGD A;  3D00 A;  4L9M A;  2WCY A;  2SGP I;  1DS3 I;  2LEO A;  2NU2 I;  1UVF A;  2KMQ A;  2GKT I;  2JW6 A;  2NU0 I;  5HQ8 A;  1LR7 A;  1TUR A;  1OMU A;  3UEJ A;  3UEY A;  2WVJ A;  4UXI A;  1TUS A;  1Z7K B;  2M5X A;  3GOX A;  1X4S A;  5CCM A;  3OXG A;  1OVO A;  1SGE I;  2N71 A;  3UGI A;  2E5R A;  3UFF A;  3TJQ A;  3HH2 C;  3BJI A;  3OL0 A;  2SGE I;  1X74 A;  3MEK A;  2NU4 I;  2FNF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...