9WGAA

2.2 angstroms resolution structure analysis of two refined n-acetylneuraminyllactose-wheat germ agglutinin isolectin complexes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin (agglutinin)
molecule keywords WHEAT GERM LECTIN
publication title 2.2 A resolution structure analysis of two refined N-acetylneuraminyl-lactose--wheat germ agglutinin isolectin complexes.
pubmed doi rcsb
source organism Triticum aestivum
total genus 47
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA04
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA01
1ULKA 4AMLA 1K7VA 1Q9BA 1UHAA 7WGAA 1WGCA 1WKXA 4WP4A 2DKVA 1ULMA 1P9GA 1K7TA 1WGTA 1P9ZA 2UVOA 1ULNA 4MPIA 2X52A 2X3TA 1K7UA 2LB7A 9WGAA 1HEVA 2WGCA 2CWGA
chains in the Genus database with same CATH superfamily
1AN1I 3TO9A 1Z7KB 1W4RA 3QAHA 3FC3A 5JHWC 2KMOA 1MJBA 3SGBI 2XRCA 1YTPA 2LEOA 2WVJA 3SGQI 2WCYA 1BUSA 2GIVA 1Q9BA 3OVOA 1LR8A 2NU3I 1CSOI 1LR7A 1MJ9A 1CE3A 1DS3I 2SGPI 1V1HA 1UVGA 3SEKC 5HQ8A 2DKVA 1FARA 5J8CA 3MEKA 1CGII 2NU4I 1KBEA 1TUSA 2V53A 4E1PA 1FY7A 1PTRA 1YU6C 1W3SA 2X52A 3TO7A 2ORVA 3R5AA 1TGSI 2NU0I 1IY5A 2E5RA 2FNFX 2ODDA 2NU2I 2ORWA 1CT4I 3KY9A 4UXHA 5E3QA 2WGCA 1OVOA 2NU1I 3VE5A 2ELIA 5CCLA 2K9HA 1FAQA 2DB6A 3OXLA 3QWPA 2F3CI 2B0UC 3R5CA 2CWGA 5FUYA 2J87A 1SGEI 1V1IA 2DIPA 1TOTA 2SGEI 2L7XA 5EX3A 2P6AC 1TBOA 1OYVI 1CT0I 3OXGA 1N13A 4SGBI 5E3PA 1HPTA 2VRWB 1WGCA 1KBFA 3FSYA 1CT2I 3R5DA 5EX0A 2JXDA 2OU2A 1H0ZA 1WKXA 2QPOA 2UZ3A 1TBRR 4OVOA 5DAEA 1ULMA 1SGQI 3UEYA 4A24A 2UVOA 1IW4A 1K7UA 2KMQA 2ENNA 1TBNA 2ROWA 2BUSA 1BMOA 1Z2IA 1IY6A 2N17A 3CXLA 1XA6A 2E73A 2JA1A 2GVIA 3UGLA 2J9RA 1KMAA 2GKRI 2KCXA 2PQ8A 3UFFA 1NXUA 2V1CC 4AMLA 1DS2I 3GOXA 4L9MA 1PCEA 1SGYI 3B4VC 2N1AB 1U5KA 1R0RI 1M8CA 2SGFI 2OD1A 1OMUA 2JZMA 1CGJI 2RIJA 2SGQI 4UXJA 2OZUA 4WP4A 4JCVE 1P9GA 2JW6A 1WTJA 1K7TA 2N71A 3RU0A 1WGTA 1HJAI 2B8TA 4DNCA 1UVFA 1P9ZA 1SGRI 1ULNA 2X3TA 2ERWA 9WGAA 1Y1BA 1R79A 5HI7A 2CJSC 1X4SA 1PJUA 3UOEA 1S20A 2GKTI 3R5BA 1PTQA 2A20A 3TOBA 5J8FA 2JYYA 2ARPF 3UGIA 1TURA 2QQEA 3D00A 3TJQA 4E1RA 5FUVA 2LUYA 2M5XA 2N52A 1X74A 2CWHA 5CCMA 5E3RA 1ULKA 2V1CA 1TIHA 2L8EA 2QQ0A 2QQDA 1K7VA 1VDDA 4B6DA 3E2IA 1CHOI 1SGNI 4FKDA 3TO6A 2QQCA 1TBQR 3UGDA 1UHAA 3VDUA 7WGAA 1NUBA 5FUXA 1LR9A 2W0TA 1XX6A 3PDNA 3OXFA 1M8BA 2ENZA 4GI3C 1Y1CA 3E59A 3VDPA 3BJIA 2YUUA 3OL0A 2KMPA 2OVOA 1SGPI 1HDLA 2KMRA 4MPIA 1RFHA 2YQPA 1HEVA 2LB7A 2CWFA 2GKVA 1OMTA 3QTLD 1FYBA 1SGDI 1PPFI 2RC4A 1XBTA 3FSXA 4UXIA 2Y0MA 3TOAA 3UEJA 1Y8FA 3HH2C 2SGDI 5FUWA 4HGUA 1MJAA 1UUCA 1MT1A
chains in the Genus database with same CATH topology
1ULKA 4AMLA 1K7VA 1Q9BA 1UHAA 7WGAA 1WGCA 1WKXA 4WP4A 2DKVA 1ULMA 1P9GA 1K7TA 1WGTA 1P9ZA 2UVOA 1ULNA 4MPIA 2X52A 2X3TA 1K7UA 2LB7A 9WGAA 1HEVA 2WGCA 2CWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULK A;  4AML A;  1K7V A;  1Q9B A;  1UHA A;  7WGA A;  1WGC A;  1WKX A;  4WP4 A;  2DKV A;  1ULM A;  1P9G A;  1K7T A;  1WGT A;  1P9Z A;  2UVO A;  1ULN A;  4MPI A;  2X52 A;  2X3T A;  1K7U A;  2LB7 A;  9WGA A;  1HEV A;  2WGC A;  2CWG A; 
#chains in the Genus database with same CATH topology
 1AN1 I;  3TO9 A;  1Z7K B;  1W4R A;  3QAH A;  3FC3 A;  5JHW C;  2KMO A;  1MJB A;  3SGB I;  2XRC A;  1YTP A;  2LEO A;  2WVJ A;  3SGQ I;  2WCY A;  1BUS A;  2GIV A;  1Q9B A;  3OVO A;  1LR8 A;  2NU3 I;  1CSO I;  1LR7 A;  1MJ9 A;  1CE3 A;  1DS3 I;  2SGP I;  1V1H A;  1UVG A;  3SEK C;  5HQ8 A;  2DKV A;  1FAR A;  5J8C A;  3MEK A;  1CGI I;  2NU4 I;  1KBE A;  1TUS A;  2V53 A;  4E1P A;  1FY7 A;  1PTR A;  1YU6 C;  1W3S A;  2X52 A;  3TO7 A;  2ORV A;  3R5A A;  1TGS I;  2NU0 I;  1IY5 A;  2E5R A;  2FNF X;  2ODD A;  2NU2 I;  2ORW A;  1CT4 I;  3KY9 A;  4UXH A;  5E3Q A;  2WGC A;  1OVO A;  2NU1 I;  3VE5 A;  2ELI A;  5CCL A;  2K9H A;  1FAQ A;  2DB6 A;  3OXL A;  3QWP A;  2F3C I;  2B0U C;  3R5C A;  2CWG A;  5FUY A;  2J87 A;  1SGE I;  1V1I A;  2DIP A;  1TOT A;  2SGE I;  2L7X A;  5EX3 A;  2P6A C;  1TBO A;  1OYV I;  1CT0 I;  3OXG A;  1N13 A;  4SGB I;  5E3P A;  1HPT A;  2VRW B;  1WGC A;  1KBF A;  3FSY A;  1CT2 I;  3R5D A;  5EX0 A;  2JXD A;  2OU2 A;  1H0Z A;  1WKX A;  2QPO A;  2UZ3 A;  1TBR R;  4OVO A;  5DAE A;  1ULM A;  1SGQ I;  3UEY A;  4A24 A;  2UVO A;  1IW4 A;  1K7U A;  2KMQ A;  2ENN A;  1TBN A;  2ROW A;  2BUS A;  1BMO A;  1Z2I A;  1IY6 A;  2N17 A;  3CXL A;  1XA6 A;  2E73 A;  2JA1 A;  2GVI A;  3UGL A;  2J9R A;  1KMA A;  2GKR I;  2KCX A;  2PQ8 A;  3UFF A;  1NXU A;  2V1C C;  4AML A;  1DS2 I;  3GOX A;  4L9M A;  1PCE A;  1SGY I;  3B4V C;  2N1A B;  1U5K A;  1R0R I;  1M8C A;  2SGF I;  2OD1 A;  1OMU A;  2JZM A;  1CGJ I;  2RIJ A;  2SGQ I;  4UXJ A;  2OZU A;  4WP4 A;  4JCV E;  1P9G A;  2JW6 A;  1WTJ A;  1K7T A;  2N71 A;  3RU0 A;  1WGT A;  1HJA I;  2B8T A;  4DNC A;  1UVF A;  1P9Z A;  1SGR I;  1ULN A;  2X3T A;  2ERW A;  9WGA A;  1Y1B A;  1R79 A;  5HI7 A;  2CJS C;  1X4S A;  1PJU A;  3UOE A;  1S20 A;  2GKT I;  3R5B A;  1PTQ A;  2A20 A;  3TOB A;  5J8F A;  2JYY A;  2ARP F;  3UGI A;  1TUR A;  2QQE A;  3D00 A;  3TJQ A;  4E1R A;  5FUV A;  2LUY A;  2M5X A;  2N52 A;  1X74 A;  2CWH A;  5CCM A;  5E3R A;  1ULK A;  2V1C A;  1TIH A;  2L8E A;  2QQ0 A;  2QQD A;  1K7V A;  1VDD A;  4B6D A;  3E2I A;  1CHO I;  1SGN I;  4FKD A;  3TO6 A;  2QQC A;  1TBQ R;  3UGD A;  1UHA A;  3VDU A;  7WGA A;  1NUB A;  5FUX A;  1LR9 A;  2W0T A;  1XX6 A;  3PDN A;  3OXF A;  1M8B A;  2ENZ A;  4GI3 C;  1Y1C A;  3E59 A;  3VDP A;  3BJI A;  2YUU A;  3OL0 A;  2KMP A;  2OVO A;  1SGP I;  1HDL A;  2KMR A;  4MPI A;  1RFH A;  2YQP A;  1HEV A;  2LB7 A;  2CWF A;  2GKV A;  1OMT A;  3QTL D;  1FYB A;  1SGD I;  1PPF I;  2RC4 A;  1XBT A;  3FSX A;  4UXI A;  2Y0M A;  3TOA A;  3UEJ A;  1Y8F A;  3HH2 C;  2SGD I;  5FUW A;  4HGU A;  1MJA A;  1UUC A;  1MT1 A; 
#chains in the Genus database with same CATH homology
 1ULK A;  4AML A;  1K7V A;  1Q9B A;  1UHA A;  7WGA A;  1WGC A;  1WKX A;  4WP4 A;  2DKV A;  1ULM A;  1P9G A;  1K7T A;  1WGT A;  1P9Z A;  2UVO A;  1ULN A;  4MPI A;  2X52 A;  2X3T A;  1K7U A;  2LB7 A;  9WGA A;  1HEV A;  2WGC A;  2CWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...