9WGAA

2.2 angstroms resolution structure analysis of two refined n-acetylneuraminyllactose-wheat germ agglutinin isolectin complexes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WHEAT GERM LECTIN
publication title 2.2 A resolution structure analysis of two refined N-acetylneuraminyl-lactose--wheat germ agglutinin isolectin complexes.
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Lectin (agglutinin)
total genus 47
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA04
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA01
2WGCA 1WGCA 4MPIA 2CWGA 2LB7A 1K7UA 1ULMA 2DKVA 1P9GA 4AMLA 1HEVA 1K7TA 1WKXA 2X3TA 1P9ZA 4WP4A 2X52A 1ULNA 7WGAA 1UHAA 1WGTA 2UVOA 9WGAA 1ULKA 1K7VA 1Q9BA
chains in the Genus database with same CATH superfamily
2FNFX 5HI7A 1TBNA 2GKVA 3KY9A 2M5XA 3CXLA 2QQCA 3VDUA 1WGCA 4E1RA 2KMQA 4A24A 1PTQA 2PQ8A 2Y0MA 3QTLD 2SGQI 1X74A 1DS3I 2N71A 1NXUA 1LR8A 1R79A 1SGQI 2J9RA 1K7UA 1ULMA 1YTPA 2DKVA 1NUBA 1CT4I 4AMLA 2W0TA 1HJAI 1HEVA 1TUSA 2L8EA 2RC4A 1CHOI 1SGRI 1IY6A 2BUSA 1M8BA 3UEJA 3TO6A 2KMPA 2NU3I 1SGNI 2DB6A 2GKRI 1MT1A 2J87A 2ORVA 2QQ0A 2V1CC 1FY7A 1BMOA 1U5KA 1SGPI 2LUYA 2ROWA 1OYVI 1Y1BA 2ENNA 3OXLA 1RFHA 4DNCA 3FC3A 1UHAA 5JHWC 3SGQI 1Y1CA 2UVOA 5E3QA 9WGAA 1MJAA 1ULKA 1K7VA 1Q9BA 2JA1A 3OXGA 3VDPA 1BUSA 5HQ8A 4JCVE 1FARA 2ENZA 2JZMA 3R5BA 2E73A 3TO9A 4FKDA 3MEKA 4L9MA 1X4SA 2V1CA 1LR9A 2NU2I 1M8CA 3UGDA 5EX3A 2OVOA 1N13A 3B4VC 4UXIA 1PJUA 4OVOA 2JYYA 2OD1A 1TIHA 2SGDI 1WKXA 1IW4A 2JW6A 2ERWA 2NU4I 5J8CA 4B6DA 4HGUA 1CGJI 3OXFA 2ELIA 4E1PA 1WTJA 1OMTA 1TBQR 3E2IA 7WGAA 5FUXA 1CE3A 2NU0I 2B0UC 1UUCA 1UVFA 2LEOA 5FUYA 1UVGA 1FYBA 1SGEI 2ARPF 2ORWA 2OZUA 1CT2I 2QQEA 2B8TA 1Z7KB 1R0RI 1V1IA 2KMRA 2N1AB 3QWPA 4MPIA 2CWGA 1PTRA 2F3CI 3UEYA 5J8FA 2LB7A 2P6AC 2SGEI 1CSOI 1KBEA 2WVJA 1FAQA 1MJBA 2L7XA 2GIVA 2OU2A 2WCYA 2YUUA 1K7TA 4UXJA 3R5AA 3R5DA 1CT0I 3TJQA 1MJ9A 1DS2I 1AN1I 3UGLA 2JXDA 1XA6A 2X3TA 4SGBI 5FUVA 3E59A 3UFFA 2KMOA 2CWFA 1OMUA 1IY5A 4WP4A 2CWHA 1ULNA 1SGDI 3D00A 2UZ3A 1PPFI 3OL0A 5DAEA 2QQDA 2A20A 2DIPA 1TBOA 1HPTA 3VE5A 5CCMA 2XRCA 2E5RA 2RIJA 2WGCA 1XBTA 2GVIA 2V53A 3FSXA 1LR7A 1V1HA 1Y8FA 2KCXA 1SGYI 2NU1I 3GOXA 1TBRR 1W3SA 2VRWB 2N17A 2SGPI 1TURA 1KMAA 1HDLA 1TOTA 2YQPA 1KBFA 3TO7A 3UGIA 2N52A 1P9GA 3TOBA 2QPOA 5FUWA 3QAHA 1TGSI 4GI3C 1XX6A 3TOAA 1H0ZA 5CCLA 1OVOA 5EX0A 3HH2C 2ODDA 2CJSC 1YU6C 3RU0A 1VDDA 1Z2IA 2GKTI 2K9HA 2SGFI 3R5CA 3SGBI 1P9ZA 3FSYA 3SEKC 1W4RA 2X52A 3BJIA 3PDNA 5E3RA 1PCEA 3OVOA 4UXHA 1CGII 1WGTA 1S20A 3UOEA 5E3PA
chains in the Genus database with same CATH topology
2WGCA 1WGCA 4MPIA 2CWGA 2LB7A 1K7UA 1ULMA 2DKVA 1P9GA 4AMLA 1HEVA 1K7TA 1WKXA 2X3TA 1P9ZA 4WP4A 2X52A 1ULNA 7WGAA 1UHAA 1WGTA 2UVOA 9WGAA 1ULKA 1K7VA 1Q9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGC A;  1WGC A;  4MPI A;  2CWG A;  2LB7 A;  1K7U A;  1ULM A;  2DKV A;  1P9G A;  4AML A;  1HEV A;  1K7T A;  1WKX A;  2X3T A;  1P9Z A;  4WP4 A;  2X52 A;  1ULN A;  7WGA A;  1UHA A;  1WGT A;  2UVO A;  9WGA A;  1ULK A;  1K7V A;  1Q9B A; 
#chains in the Genus database with same CATH topology
 2FNF X;  5HI7 A;  1TBN A;  2GKV A;  3KY9 A;  2M5X A;  3CXL A;  2QQC A;  3VDU A;  1WGC A;  4E1R A;  2KMQ A;  4A24 A;  1PTQ A;  2PQ8 A;  2Y0M A;  3QTL D;  2SGQ I;  1X74 A;  1DS3 I;  2N71 A;  1NXU A;  1LR8 A;  1R79 A;  1SGQ I;  2J9R A;  1K7U A;  1ULM A;  1YTP A;  2DKV A;  1NUB A;  1CT4 I;  4AML A;  2W0T A;  1HJA I;  1HEV A;  1TUS A;  2L8E A;  2RC4 A;  1CHO I;  1SGR I;  1IY6 A;  2BUS A;  1M8B A;  3UEJ A;  3TO6 A;  2KMP A;  2NU3 I;  1SGN I;  2DB6 A;  2GKR I;  1MT1 A;  2J87 A;  2ORV A;  2QQ0 A;  2V1C C;  1FY7 A;  1BMO A;  1U5K A;  1SGP I;  2LUY A;  2ROW A;  1OYV I;  1Y1B A;  2ENN A;  3OXL A;  1RFH A;  4DNC A;  3FC3 A;  1UHA A;  5JHW C;  3SGQ I;  1Y1C A;  2UVO A;  5E3Q A;  9WGA A;  1MJA A;  1ULK A;  1K7V A;  1Q9B A;  2JA1 A;  3OXG A;  3VDP A;  1BUS A;  5HQ8 A;  4JCV E;  1FAR A;  2ENZ A;  2JZM A;  3R5B A;  2E73 A;  3TO9 A;  4FKD A;  3MEK A;  4L9M A;  1X4S A;  2V1C A;  1LR9 A;  2NU2 I;  1M8C A;  3UGD A;  5EX3 A;  2OVO A;  1N13 A;  3B4V C;  4UXI A;  1PJU A;  4OVO A;  2JYY A;  2OD1 A;  1TIH A;  2SGD I;  1WKX A;  1IW4 A;  2JW6 A;  2ERW A;  2NU4 I;  5J8C A;  4B6D A;  4HGU A;  1CGJ I;  3OXF A;  2ELI A;  4E1P A;  1WTJ A;  1OMT A;  1TBQ R;  3E2I A;  7WGA A;  5FUX A;  1CE3 A;  2NU0 I;  2B0U C;  1UUC A;  1UVF A;  2LEO A;  5FUY A;  1UVG A;  1FYB A;  1SGE I;  2ARP F;  2ORW A;  2OZU A;  1CT2 I;  2QQE A;  2B8T A;  1Z7K B;  1R0R I;  1V1I A;  2KMR A;  2N1A B;  3QWP A;  4MPI A;  2CWG A;  1PTR A;  2F3C I;  3UEY A;  5J8F A;  2LB7 A;  2P6A C;  2SGE I;  1CSO I;  1KBE A;  2WVJ A;  1FAQ A;  1MJB A;  2L7X A;  2GIV A;  2OU2 A;  2WCY A;  2YUU A;  1K7T A;  4UXJ A;  3R5A A;  3R5D A;  1CT0 I;  3TJQ A;  1MJ9 A;  1DS2 I;  1AN1 I;  3UGL A;  2JXD A;  1XA6 A;  2X3T A;  4SGB I;  5FUV A;  3E59 A;  3UFF A;  2KMO A;  2CWF A;  1OMU A;  1IY5 A;  4WP4 A;  2CWH A;  1ULN A;  1SGD I;  3D00 A;  2UZ3 A;  1PPF I;  3OL0 A;  5DAE A;  2QQD A;  2A20 A;  2DIP A;  1TBO A;  1HPT A;  3VE5 A;  5CCM A;  2XRC A;  2E5R A;  2RIJ A;  2WGC A;  1XBT A;  2GVI A;  2V53 A;  3FSX A;  1LR7 A;  1V1H A;  1Y8F A;  2KCX A;  1SGY I;  2NU1 I;  3GOX A;  1TBR R;  1W3S A;  2VRW B;  2N17 A;  2SGP I;  1TUR A;  1KMA A;  1HDL A;  1TOT A;  2YQP A;  1KBF A;  3TO7 A;  3UGI A;  2N52 A;  1P9G A;  3TOB A;  2QPO A;  5FUW A;  3QAH A;  1TGS I;  4GI3 C;  1XX6 A;  3TOA A;  1H0Z A;  5CCL A;  1OVO A;  5EX0 A;  3HH2 C;  2ODD A;  2CJS C;  1YU6 C;  3RU0 A;  1VDD A;  1Z2I A;  2GKT I;  2K9H A;  2SGF I;  3R5C A;  3SGB I;  1P9Z A;  3FSY A;  3SEK C;  1W4R A;  2X52 A;  3BJI A;  3PDN A;  5E3R A;  1PCE A;  3OVO A;  4UXH A;  1CGI I;  1WGT A;  1S20 A;  3UOE A;  5E3P A; 
#chains in the Genus database with same CATH homology
 2WGC A;  1WGC A;  4MPI A;  2CWG A;  2LB7 A;  1K7U A;  1ULM A;  2DKV A;  1P9G A;  4AML A;  1HEV A;  1K7T A;  1WKX A;  2X3T A;  1P9Z A;  4WP4 A;  2X52 A;  1ULN A;  7WGA A;  1UHA A;  1WGT A;  2UVO A;  9WGA A;  1ULK A;  1K7V A;  1Q9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...