9WGAA

2.2 angstroms resolution structure analysis of two refined n-acetylneuraminyllactose-wheat germ agglutinin isolectin complexes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WHEAT GERM LECTIN
publication title 2.2 A resolution structure analysis of two refined N-acetylneuraminyl-lactose--wheat germ agglutinin isolectin complexes.
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Lectin (agglutinin)
total genus 47
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA04
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA01
1Q9BA 4MPIA 4WP4A 1K7TA 2X3TA 1HEVA 1P9ZA 2LB7A 1ULMA 2CWGA 1ULKA 1WGTA 1P9GA 1UHAA 2WGCA 1K7VA 7WGAA 1K7UA 1ULNA 4AMLA 1WGCA 9WGAA 1WKXA 2DKVA 2X52A 2UVOA
chains in the Genus database with same CATH superfamily
2RIJA 3FSYA 1UUCA 2V53A 1VDDA 2XRCA 2JZMA 3QWPA 1NXUA 3SEKC 1TBRR 5JHWC 1CT0I 1MJBA 2NU3I 2N52A 3R5AA 5DAEA 1KBEA 2B8TA 1Y1CA 1OMTA 2LUYA 3OL0A 3VDPA 1OVOA 2PQ8A 2QQCA 1UHAA 1XX6A 4B6DA 1KBFA 3VDUA 1S20A 3UOEA 1MT1A 1Z2IA 1ULNA 2ERWA 5EX0A 1LR9A 2UZ3A 4SGBI 3OXLA 3OXGA 3UFFA 1HJAI 1SGYI 2GIVA 1Y1BA 2DKVA 1TOTA 3QTLD 2LEOA 1SGPI 1V1IA 2QQEA 1SGDI 4UXIA 3TO6A 1NUBA 5FUVA 5E3PA 4UXJA 2Y0MA 2GKVA 4WP4A 2GKTI 1CGII 1PJUA 2L8EA 2SGFI 1TUSA 2ARPF 4HGUA 3B4VC 5HQ8A 1P9ZA 3SGBI 1FARA 3RU0A 1IW4A 1M8CA 1PTQA 5CCLA 1TURA 2LB7A 2ENNA 3TO7A 1DS2I 2NU0I 1KMAA 5FUYA 2CWGA 2K9HA 1IY5A 2SGEI 1ULKA 1MJ9A 2VRWB 4DNCA 1FYBA 1WGTA 1P9GA 1W3SA 1TBNA 1CSOI 2ODDA 2QQ0A 2V1CA 2WGCA 1HPTA 4L9MA 1IY6A 2CJSC 2WVJA 2DB6A 2GKRI 3BJIA 2BUSA 2J87A 3HH2C 3R5DA 2V1CC 1M8BA 2ORWA 5HI7A 4A24A 1WGCA 1WKXA 1YU6C 2F3CI 1CT2I 2SGQI 1UVGA 1XBTA 2SGDI 4E1RA 2OU2A 1CGJI 2X52A 2W0TA 1Z7KB 2ELIA 2P6AC 3TO9A 2KMOA 5J8FA 3TOAA 3KY9A 3TOBA 1CE3A 2OVOA 2X3TA 2M5XA 1BUSA 2NU2I 1SGQI 1LR7A 2B0UC 2L7XA 2NU4I 1TGSI 2OZUA 1W4RA 1OYVI 1R79A 1TBQR 2A20A 2QQDA 3TJQA 1Y8FA 1ULMA 1HDLA 1CHOI 5E3RA 2FNFX 1DS3I 4OVOA 2ENZA 3VE5A 5CCMA 3UEYA 1X74A 2JXDA 5E3QA 1PPFI 1TIHA 1K7VA 1XA6A 2SGPI 3FSXA 2NU1I 4FKDA 7WGAA 1TBOA 2WCYA 1N13A 1FY7A 3E2IA 4E1PA 1LR8A 2N1AB 1UVFA 1BMOA 1OMUA 2KCXA 2ROWA 2RC4A 3MEKA 1CT4I 4UXHA 2JA1A 2JYYA 1H0ZA 3OVOA 2KMPA 1MJAA 1Q9BA 2N17A 3E59A 4MPIA 3SGQI 1K7TA 1HEVA 2QPOA 2KMRA 1X4SA 1SGRI 2KMQA 3UEJA 3GOXA 2JW6A 3OXFA 5FUXA 1WTJA 5EX3A 2YUUA 3PDNA 1U5KA 1PTRA 2CWHA 3UGDA 2CWFA 4GI3C 2DIPA 1FAQA 2YQPA 3CXLA 1AN1I 3R5BA 1YTPA 3UGIA 2ORVA 5J8CA 2GVIA 1K7UA 3FC3A 2E73A 2E5RA 4JCVE 1PCEA 4AMLA 2J9RA 1SGNI 2N71A 5FUWA 3UGLA 9WGAA 3QAHA 1V1HA 3D00A 3R5CA 1SGEI 2OD1A 1RFHA 1R0RI 2UVOA
chains in the Genus database with same CATH topology
1Q9BA 4MPIA 4WP4A 1K7TA 2X3TA 1HEVA 1P9ZA 2LB7A 1ULMA 2CWGA 1ULKA 1WGTA 1P9GA 1UHAA 2WGCA 1K7VA 7WGAA 1K7UA 1ULNA 4AMLA 1WGCA 9WGAA 1WKXA 2DKVA 2X52A 2UVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9B A;  4MPI A;  4WP4 A;  1K7T A;  2X3T A;  1HEV A;  1P9Z A;  2LB7 A;  1ULM A;  2CWG A;  1ULK A;  1WGT A;  1P9G A;  1UHA A;  2WGC A;  1K7V A;  7WGA A;  1K7U A;  1ULN A;  4AML A;  1WGC A;  9WGA A;  1WKX A;  2DKV A;  2X52 A;  2UVO A; 
#chains in the Genus database with same CATH topology
 2RIJ A;  3FSY A;  1UUC A;  2V53 A;  1VDD A;  2XRC A;  2JZM A;  3QWP A;  1NXU A;  3SEK C;  1TBR R;  5JHW C;  1CT0 I;  1MJB A;  2NU3 I;  2N52 A;  3R5A A;  5DAE A;  1KBE A;  2B8T A;  1Y1C A;  1OMT A;  2LUY A;  3OL0 A;  3VDP A;  1OVO A;  2PQ8 A;  2QQC A;  1UHA A;  1XX6 A;  4B6D A;  1KBF A;  3VDU A;  1S20 A;  3UOE A;  1MT1 A;  1Z2I A;  1ULN A;  2ERW A;  5EX0 A;  1LR9 A;  2UZ3 A;  4SGB I;  3OXL A;  3OXG A;  3UFF A;  1HJA I;  1SGY I;  2GIV A;  1Y1B A;  2DKV A;  1TOT A;  3QTL D;  2LEO A;  1SGP I;  1V1I A;  2QQE A;  1SGD I;  4UXI A;  3TO6 A;  1NUB A;  5FUV A;  5E3P A;  4UXJ A;  2Y0M A;  2GKV A;  4WP4 A;  2GKT I;  1CGI I;  1PJU A;  2L8E A;  2SGF I;  1TUS A;  2ARP F;  4HGU A;  3B4V C;  5HQ8 A;  1P9Z A;  3SGB I;  1FAR A;  3RU0 A;  1IW4 A;  1M8C A;  1PTQ A;  5CCL A;  1TUR A;  2LB7 A;  2ENN A;  3TO7 A;  1DS2 I;  2NU0 I;  1KMA A;  5FUY A;  2CWG A;  2K9H A;  1IY5 A;  2SGE I;  1ULK A;  1MJ9 A;  2VRW B;  4DNC A;  1FYB A;  1WGT A;  1P9G A;  1W3S A;  1TBN A;  1CSO I;  2ODD A;  2QQ0 A;  2V1C A;  2WGC A;  1HPT A;  4L9M A;  1IY6 A;  2CJS C;  2WVJ A;  2DB6 A;  2GKR I;  3BJI A;  2BUS A;  2J87 A;  3HH2 C;  3R5D A;  2V1C C;  1M8B A;  2ORW A;  5HI7 A;  4A24 A;  1WGC A;  1WKX A;  1YU6 C;  2F3C I;  1CT2 I;  2SGQ I;  1UVG A;  1XBT A;  2SGD I;  4E1R A;  2OU2 A;  1CGJ I;  2X52 A;  2W0T A;  1Z7K B;  2ELI A;  2P6A C;  3TO9 A;  2KMO A;  5J8F A;  3TOA A;  3KY9 A;  3TOB A;  1CE3 A;  2OVO A;  2X3T A;  2M5X A;  1BUS A;  2NU2 I;  1SGQ I;  1LR7 A;  2B0U C;  2L7X A;  2NU4 I;  1TGS I;  2OZU A;  1W4R A;  1OYV I;  1R79 A;  1TBQ R;  2A20 A;  2QQD A;  3TJQ A;  1Y8F A;  1ULM A;  1HDL A;  1CHO I;  5E3R A;  2FNF X;  1DS3 I;  4OVO A;  2ENZ A;  3VE5 A;  5CCM A;  3UEY A;  1X74 A;  2JXD A;  5E3Q A;  1PPF I;  1TIH A;  1K7V A;  1XA6 A;  2SGP I;  3FSX A;  2NU1 I;  4FKD A;  7WGA A;  1TBO A;  2WCY A;  1N13 A;  1FY7 A;  3E2I A;  4E1P A;  1LR8 A;  2N1A B;  1UVF A;  1BMO A;  1OMU A;  2KCX A;  2ROW A;  2RC4 A;  3MEK A;  1CT4 I;  4UXH A;  2JA1 A;  2JYY A;  1H0Z A;  3OVO A;  2KMP A;  1MJA A;  1Q9B A;  2N17 A;  3E59 A;  4MPI A;  3SGQ I;  1K7T A;  1HEV A;  2QPO A;  2KMR A;  1X4S A;  1SGR I;  2KMQ A;  3UEJ A;  3GOX A;  2JW6 A;  3OXF A;  5FUX A;  1WTJ A;  5EX3 A;  2YUU A;  3PDN A;  1U5K A;  1PTR A;  2CWH A;  3UGD A;  2CWF A;  4GI3 C;  2DIP A;  1FAQ A;  2YQP A;  3CXL A;  1AN1 I;  3R5B A;  1YTP A;  3UGI A;  2ORV A;  5J8C A;  2GVI A;  1K7U A;  3FC3 A;  2E73 A;  2E5R A;  4JCV E;  1PCE A;  4AML A;  2J9R A;  1SGN I;  2N71 A;  5FUW A;  3UGL A;  9WGA A;  3QAH A;  1V1H A;  3D00 A;  3R5C A;  1SGE I;  2OD1 A;  1RFH A;  1R0R I;  2UVO A; 
#chains in the Genus database with same CATH homology
 1Q9B A;  4MPI A;  4WP4 A;  1K7T A;  2X3T A;  1HEV A;  1P9Z A;  2LB7 A;  1ULM A;  2CWG A;  1ULK A;  1WGT A;  1P9G A;  1UHA A;  2WGC A;  1K7V A;  7WGA A;  1K7U A;  1ULN A;  4AML A;  1WGC A;  9WGA A;  1WKX A;  2DKV A;  2X52 A;  2UVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...