9WGAA

2.2 angstroms resolution structure analysis of two refined n-acetylneuraminyllactose-wheat germ agglutinin isolectin complexes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.2 A resolution structure analysis of two refined N-acetylneuraminyl-lactose--wheat germ agglutinin isolectin complexes.
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Lectin (agglutinin)
molecule keywords WHEAT GERM LECTIN
total genus 47
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA04
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 9wgaA01
1ULKA 1ULMA 4AMLA 1HEVA 2DKVA 1Q9BA 2X52A 7WGAA 1K7TA 4MPIA 2X3TA 2WGCA 2UVOA 1WGTA 4WP4A 1UHAA 1P9ZA 1ULNA 1K7UA 2LB7A 1K7VA 1P9GA 1WKXA 1WGCA 2CWGA 9WGAA
chains in the Genus database with same CATH superfamily
1TIHA 5FUYA 4AMLA 1HEVA 5FUVA 2DKVA 1WTJA 2E5RA 1OMTA 2K9HA 1OMUA 1TGSI 1XBTA 3OXLA 1UUCA 3SGBI 1UVGA 1CHOI 1NXUA 1V1IA 3CXLA 4B6DA 3HH2C 1KBFA 1V1HA 2QQEA 3TOBA 4DNCA 2WGCA 2KMOA 3QTLD 2GKRI 3D00A 1PTQA 4UXJA 1FAQA 1MJBA 3UGLA 2OVOA 1TBNA 2V1CA 1SGRI 1Z2IA 1WGTA 2KMRA 1UHAA 1P9ZA 1R0RI 1TBQR 2L7XA 2KMPA 2SGFI 5CCLA 1SGEI 3UGDA 1K7UA 2V53A 2YUUA 1AN1I 3TO6A 3TO9A 1WGCA 5HI7A 2ORWA 2V1CC 5EX0A 1PTRA 5CCMA 1IY6A 2ORVA 3FSXA 5E3PA 1ULKA 1ULMA 1X74A 1OVOA 1U5KA 2ENZA 1DS3I 2SGPI 2GIVA 1MJAA 2JZMA 2E73A 2JW6A 1NUBA 2A20A 2NU0I 1W4RA 2RIJA 3OL0A 5HQ8A 1PPFI 2GKTI 3FSYA 2ARPF 2CWFA 1BUSA 3FC3A 2ERWA 1M8CA 2B8TA 2OZUA 5EX3A 2UVOA 3UGIA 1IW4A 1CE3A 3BJIA 1H0ZA 3VDPA 1CGII 2CWHA 4WP4A 3E59A 1UVFA 2JXDA 4UXHA 1KBEA 1SGPI 1HJAI 1TOTA 1YU6C 3GOXA 2LB7A 1WKXA 2JA1A 2QQDA 2UZ3A 1R79A 4E1PA 3R5CA 1S20A 1SGNI 1FARA 2QPOA 2WCYA 2F3CI 2ROWA 3UFFA 3QAHA 2N71A 5FUWA 1Q9BA 3OVOA 2OD1A 2SGDI 3UEJA 1Z7KB 1VDDA 1FYBA 1CGJI 1BMOA 2N52A 1CSOI 2VRWB 3PDNA 2W0TA 1MT1A 3TJQA 3E2IA 1PCEA 4MPIA 2ELIA 2X3TA 1SGDI 2CJSC 4SGBI 2SGEI 3TO7A 2N1AB 1HDLA 3TOAA 1OYVI 3MEKA 1X4SA 3OXFA 1KMAA 1DS2I 2N17A 2QQ0A 2GKVA 2NU1I 1ULNA 2KCXA 2P6AC 3KY9A 3VDUA 1MJ9A 4A24A 1XA6A 4GI3C 1N13A 2NU2I 5J8FA 1FY7A 1K7VA 4UXIA 1SGYI 2Y0MA 2L8EA 2CWGA 2LEOA 5J8CA 1XX6A 1RFHA 1CT2I 1TURA 2DB6A 4L9MA 9WGAA 5JHWC 3VE5A 2ENNA 3UEYA 4OVOA 2OU2A 2FNFX 2RC4A 2X52A 2QQCA 3UOEA 3B4VC 1PJUA 2J87A 1Y8FA 5E3QA 4E1RA 1TUSA 2B0UC 7WGAA 2M5XA 4JCVE 1K7TA 2WVJA 3R5DA 1SGQI 5DAEA 1HPTA 3R5AA 1IY5A 2GVIA 2JYYA 1TBRR 2NU4I 4FKDA 2KMQA 1TBOA 2YQPA 3QWPA 3RU0A 1M8BA 2DIPA 2XRCA 5E3RA 1Y1CA 2SGQI 3R5BA 1W3SA 2PQ8A 3OXGA 2LUYA 2NU3I 2ODDA 1Y1BA 2BUSA 4HGUA 1CT4I 1YTPA 1P9GA 2J9RA 3SEKC 3SGQI 1LR7A 5FUXA 1CT0I 1LR8A 1LR9A
chains in the Genus database with same CATH topology
1ULKA 1ULMA 4AMLA 1HEVA 2DKVA 1Q9BA 2X52A 7WGAA 1K7TA 4MPIA 2X3TA 2WGCA 2UVOA 1WGTA 4WP4A 1UHAA 1P9ZA 1ULNA 1K7UA 2LB7A 1K7VA 1P9GA 1WKXA 1WGCA 2CWGA 9WGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULK A;  1ULM A;  4AML A;  1HEV A;  2DKV A;  1Q9B A;  2X52 A;  7WGA A;  1K7T A;  4MPI A;  2X3T A;  2WGC A;  2UVO A;  1WGT A;  4WP4 A;  1UHA A;  1P9Z A;  1ULN A;  1K7U A;  2LB7 A;  1K7V A;  1P9G A;  1WKX A;  1WGC A;  2CWG A;  9WGA A; 
#chains in the Genus database with same CATH topology
 1TIH A;  5FUY A;  4AML A;  1HEV A;  5FUV A;  2DKV A;  1WTJ A;  2E5R A;  1OMT A;  2K9H A;  1OMU A;  1TGS I;  1XBT A;  3OXL A;  1UUC A;  3SGB I;  1UVG A;  1CHO I;  1NXU A;  1V1I A;  3CXL A;  4B6D A;  3HH2 C;  1KBF A;  1V1H A;  2QQE A;  3TOB A;  4DNC A;  2WGC A;  2KMO A;  3QTL D;  2GKR I;  3D00 A;  1PTQ A;  4UXJ A;  1FAQ A;  1MJB A;  3UGL A;  2OVO A;  1TBN A;  2V1C A;  1SGR I;  1Z2I A;  1WGT A;  2KMR A;  1UHA A;  1P9Z A;  1R0R I;  1TBQ R;  2L7X A;  2KMP A;  2SGF I;  5CCL A;  1SGE I;  3UGD A;  1K7U A;  2V53 A;  2YUU A;  1AN1 I;  3TO6 A;  3TO9 A;  1WGC A;  5HI7 A;  2ORW A;  2V1C C;  5EX0 A;  1PTR A;  5CCM A;  1IY6 A;  2ORV A;  3FSX A;  5E3P A;  1ULK A;  1ULM A;  1X74 A;  1OVO A;  1U5K A;  2ENZ A;  1DS3 I;  2SGP I;  2GIV A;  1MJA A;  2JZM A;  2E73 A;  2JW6 A;  1NUB A;  2A20 A;  2NU0 I;  1W4R A;  2RIJ A;  3OL0 A;  5HQ8 A;  1PPF I;  2GKT I;  3FSY A;  2ARP F;  2CWF A;  1BUS A;  3FC3 A;  2ERW A;  1M8C A;  2B8T A;  2OZU A;  5EX3 A;  2UVO A;  3UGI A;  1IW4 A;  1CE3 A;  3BJI A;  1H0Z A;  3VDP A;  1CGI I;  2CWH A;  4WP4 A;  3E59 A;  1UVF A;  2JXD A;  4UXH A;  1KBE A;  1SGP I;  1HJA I;  1TOT A;  1YU6 C;  3GOX A;  2LB7 A;  1WKX A;  2JA1 A;  2QQD A;  2UZ3 A;  1R79 A;  4E1P A;  3R5C A;  1S20 A;  1SGN I;  1FAR A;  2QPO A;  2WCY A;  2F3C I;  2ROW A;  3UFF A;  3QAH A;  2N71 A;  5FUW A;  1Q9B A;  3OVO A;  2OD1 A;  2SGD I;  3UEJ A;  1Z7K B;  1VDD A;  1FYB A;  1CGJ I;  1BMO A;  2N52 A;  1CSO I;  2VRW B;  3PDN A;  2W0T A;  1MT1 A;  3TJQ A;  3E2I A;  1PCE A;  4MPI A;  2ELI A;  2X3T A;  1SGD I;  2CJS C;  4SGB I;  2SGE I;  3TO7 A;  2N1A B;  1HDL A;  3TOA A;  1OYV I;  3MEK A;  1X4S A;  3OXF A;  1KMA A;  1DS2 I;  2N17 A;  2QQ0 A;  2GKV A;  2NU1 I;  1ULN A;  2KCX A;  2P6A C;  3KY9 A;  3VDU A;  1MJ9 A;  4A24 A;  1XA6 A;  4GI3 C;  1N13 A;  2NU2 I;  5J8F A;  1FY7 A;  1K7V A;  4UXI A;  1SGY I;  2Y0M A;  2L8E A;  2CWG A;  2LEO A;  5J8C A;  1XX6 A;  1RFH A;  1CT2 I;  1TUR A;  2DB6 A;  4L9M A;  9WGA A;  5JHW C;  3VE5 A;  2ENN A;  3UEY A;  4OVO A;  2OU2 A;  2FNF X;  2RC4 A;  2X52 A;  2QQC A;  3UOE A;  3B4V C;  1PJU A;  2J87 A;  1Y8F A;  5E3Q A;  4E1R A;  1TUS A;  2B0U C;  7WGA A;  2M5X A;  4JCV E;  1K7T A;  2WVJ A;  3R5D A;  1SGQ I;  5DAE A;  1HPT A;  3R5A A;  1IY5 A;  2GVI A;  2JYY A;  1TBR R;  2NU4 I;  4FKD A;  2KMQ A;  1TBO A;  2YQP A;  3QWP A;  3RU0 A;  1M8B A;  2DIP A;  2XRC A;  5E3R A;  1Y1C A;  2SGQ I;  3R5B A;  1W3S A;  2PQ8 A;  3OXG A;  2LUY A;  2NU3 I;  2ODD A;  1Y1B A;  2BUS A;  4HGU A;  1CT4 I;  1YTP A;  1P9G A;  2J9R A;  3SEK C;  3SGQ I;  1LR7 A;  5FUX A;  1CT0 I;  1LR8 A;  1LR9 A; 
#chains in the Genus database with same CATH homology
 1ULK A;  1ULM A;  4AML A;  1HEV A;  2DKV A;  1Q9B A;  2X52 A;  7WGA A;  1K7T A;  4MPI A;  2X3T A;  2WGC A;  2UVO A;  1WGT A;  4WP4 A;  1UHA A;  1P9Z A;  1ULN A;  1K7U A;  2LB7 A;  1K7V A;  1P9G A;  1WKX A;  1WGC A;  2CWG A;  9WGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...