2UZ3A

Crystal structure of thymidine kinase with dttp from u. urealyticum
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
207
structure length
190
Chain Sequence
IGWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKISVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIKFFKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structures of Thymidine Kinase 1 of Human and Mycoplasmic Origin
pubmed doi rcsb
source organism Ureaplasma urealyticum
molecule tags Transferase
total genus 51
structure length 190
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2uz3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2uz3A01
3Q7QA 1ESNA 1MRSA 4I1UA 3VR2A 2B6HA 1H65A 1I4DD 2H92A 4UJ5A 4PFSA 2EFHB 2V4ZA 2DFKB 3U7EB 1F5NA 1L4UA 3ZZUA 4AC9A 5CK4A 1GNPA 2FOLA 5J40A 4C2UA 4EUNA 4Z54A 4KVAA 3SBEA 2XZPA 1JJ7A 3QI2A 4KSCA 2J7KA 4KBGA 1Q21A 4GPTA 221PA 1T5IA 4C0SA 1M7HA 2FGKA 2FPLA 2VRWB 1XFAA 2XB4A 2EFEB 3BD9A 4TMKA 4RD4A 4HLUA 4ASUA 2IYTA 4FINA 3ADCA 4HB3A 4JLOA 3THYA 3I92A 1ZW6A 3LD9A 3C4JA 4D0NA 3VHXA 3K0SA 1Z6GA 2DB3A 3W6PA 2NO0A 4RZUA 4A8JC 4GOKA 3Q8XB 4A0GA 2W83A 1S3SA 2P6UA 3NC1C 2X77A 1UDXA 2G3YA 1OW3B 3K9LA 1XTQA 1RJ9B 2BBTA 3I5YA 2IYWA 1T3LA 4LK2A 2GVDC 1S4QA 2P5TB 4OK5A 2IS4A 3PUZA 4XSGA 3KY9A 1X1SA 1JR6A 1KSJA 2D62A 3CW2A 3NG1A 1SGWA 1PLKA 4DCTA 2VIIA 2QRZA 4QM6A 4QHSA 4ZCMA 4S2EA 1EWRA 1GIAA 1N6HA 2GJ9A 2DYKA 2FJUA 2XZLA 4MITA 1OT3A 3W5JA 2GRJA 1WA5A 3EC1A 1ZJ6A 2GXSA 4B43A 3U3OA 2BIFA 4JJZA 4DXAA 2R9VA 3QJYA 4M1WA 3NBFA 1N25A 4Q1BA 3DO6A 2OXRA 1V5WA 5B64A 1D2NA 4A82A 2J7PD 3SC3A 1COWA 1DE0A 2ZRMA 4UNPA 4PC3A 1XU4A 2FWRA 3AUXA 3DL0A 3HPRA 4KSBA 3KKNA 2WSMA 4YLGA 3RRZA 4B47A 4ZDIA 4CEJA 4C30A 4FCTA 1OLOA 1AQYA 3H86A 5JWOA 5FOTA 4QRHA 3RSOA 4B33A 4QNRA 1F2TB 2GAOA 4BFXA 5JBQA 1Z0DA 2GF0A 3UMRA 3TKLA 2BBSA 3R8CA 1GFIA 4URWR 1OIWA 1E1RD 4AWXA 4UNSA 1P3JA 4TQUS 4Z8YA 4B32A 2GZAA 4D25A 4M1OA 1X1RA 2XTZA 3UK6A 4JYCA 2QRNA 2ZANA 2AN9A 4OQFA 1TQ2A 3K70D 2G88A 4RD1A 2OE2A 3R20A 2DFNA 4BFZA 3IQXA 4NCJA 3CIOA 4EFMA 3QBVA 3DZDA 4HAUA 5TVKA 5D3QA 1U98A 3QEOA 5FTKA 4EDHA 2QE7A 1BIFA 3TJZA 2J3EA 2BC9A 1N6RA 2UVQA 3TUIC 4YMUA 3SYKA 1F2UB 2WKQA 2A2ZA 4EPYA 5JEDA 2BWJA 1R5NA 3NXSA 2EFGA 3L82B 1SVMA 2AR7A 2GWHA 2QAGA 4QL3A 5C46F 5B30A 2AFHE 1ZU4A 5L3SA 4A8JB 4OHXA 5HCIA 3JVVA 2QI9C 4LJAA 2R6GA 4IJMA 4ZV4A 5F98A 1U2RA 3IPYA 3WMEA 2CVHA 4HDQB 3TW4A 3PFIA 1FZQA 3U3MA 5CJ2A 4PQYA 1NIJA 1W36D 2IC5A 4FN5A 1MO6A 1N2CE 4ILEA 4Y0VA 1N3BA 4RZ3A 2DCUA 4EQ6B 1EFCA 1KAOA 1PLLA 2B21A 1U0JA 3I62A 3VNUA 2IHYA 2AHOA 2FZLA 3B5JA 5DI3B 2GEVA 2JLZA 1QHYA 4MRVA 4NE2A 2O8DA 1WQ1R 1TUIA 1VKJA 3HP1A 4URZR 1E9BA 4Q9KA 2GBLC 1D8TA 2C04A 2RHMA 2IYVA 4ZCIA 1HE8B 1TUEA 2E9SA 4WIAA 2EVWX 5B2ZA 3CH5A 4BLPA 3GJ4A 2YUUA 2VEDA 3GLHA 1FQKA 1Z5ZA 2CK3D 5DYIA 5DN6D 4POAA 2CL6X 3A58B 4DCNA 4DLRA 4Q4HA 3E70C 3SFVA 1T91A 4U02A 2DWQA 2ATXA 4Q1DA 1KJYA 2XAUA 1VCNA 1VPLA 2OFOA 4MYCA 4DRZA 4DSOA 4RCYA 2ZEJA 3ZJYA 5DH9A 3SBDA 2XITA 2QBYA 3THWB 2F7SA 5GVSA 3R9XA 2B7CA 1XPOA 1TBOA 4FXPA 3ASZA 1AZSC 4LZZA 2BEKA 4PPNA 3RRYA 2J0QA 2JJ2A 3OF5A 4B3FX 1EX6A 3ND9A 2QSYA 3UATA 4C0KA 4MDFA 3RWMB 1CEEA 1IN7A 4AYWA 1XP8A 4X8OA 1E4YA 3WBJA 2GF9A 3MAAC 3LVQE 2C03A 1DO2A 1KK0A 2VHUA 4NYMQ 4ABYA 1YR8A 1Z08A 4L9MA 2QP4A 4MRPA 3PQCA 1N5LA 3QKRB 4IOJA 2A5GA 1DAIA 1NVWQ 2AWNA 2I4IA 2IXFA 4Q00A 4HB4A 5LD2C 3FDIA 2O8BA 1OKKD 1KKLA 5FOSA 3EA0A 1MT0A 3WYAA 4DIEA 5GJCA 3MD0A 4W5JA 1U8ZA 2Q21A 3BH6A 1DPFA 4E03A 5DI9A 1OYWA 2XB2A 1JAHA 2PX3A 2NGRA 4OI2A 3QF4A 4DB2A 4Z51A 1SQ5A 5CB8A 1OFHA 5FFMA 2JLYA 3MWYW 1G8FA 2QY9A 4OBEA 3FPAA 1ZNXA 2YWGA 3C15C 4KFUA 3CONA 3AF0A 2NO9A 3X1ZA 1AGRA 1GL6A 4BLOA 2DWPA 1ZUHA 4NP6A 3CRMA 1XWIA 3IBYA 4XVRA 5CLLA 2QM7A 2FEOA 4BLSA 1ZM2A 1E2PA 3BFXA 4DZZA 4WW0A 1YKSA 3T1QA 2ZRBA 2G1KA 1Z6YA 4TSFA 4BZPA 5HR5A 1CS4C 4QGFA 1J8MF 1QHHA 1SVIA 2I1QA 3BFVA 3N70A 2ZSEA 4Q4AA 2V7QD 3AGQA 4U00A 5KTYA 1GM5A 3EW9A 1U8AA 3GLHE 3B85A 2WICA 2ZRLA 4V0NA 1OHHD 1Q3HA 5DNYB 1TL7C 1Q1EA 1IXZA 2O5VA 4QGHA 3DVLA 1I2MA 3BFKA 1GRNA 1KI4A 1Q1ZA 4TL7A 4BEBA 3TIFA 5JJLA 3IO5A 3UMSA 4P4SB 3JVUA 1ZCBA 3SJBA 2NMVA 2EU8A 3RVBA 1YZQA 2VP2A 2JAQA 2IEYA 2HCBA 1BMFA 4BFTA 1F6BA 4GP6A 2EFDB 5FPYA 2CJWB 2P65A 2W6IA 4L4UA 2A5YB 4RFSB 3NKVA 3C16C 4ZDKA 3W9YA 2ZRCA 1NNEA 3SOPA 3AP2A 4V03A 2WV9A 3K09C 1BH2A 1IQPA 4D80A 4EJSA 4B2IA 4AKHA 2VP9A 5F9FA 4G5QA 4D82A 1R2QA 2YC4C 1ZD9A 1T8TA 4YMTA 4M1MA 3BJIC 5FUYA 3LVRE 4FMDF 3U61B 4TMWA 2P2LA 4E22A 3FVQA 1IONA 3E5HA 3SJZA 3F3YA 5LD2B 2ZRAA 3TSWA 2TMKA 3BH0A 1E2MA 4JS0A 1PJRA 1UKZA 4MYHA 4MYTA 4B3XA 3LXXA 4FMCF 1XD2B 4HLUC 1I2DA 4TL6A 2HJGA 1YR9A 1E9AA 3G82C 5JJKA 4DC9A 2IHBA 1IY1A 4D0GA 1F2UA 1P9NA 2C78A 3SJAA 4OHZA 4DUGA 5BWMA 1BYUA 2ZI3A 5KNDA 1JECA 1ODFA 4A8JA 1JI0A 2FSGA 3SNHA 3CB4A 4WZAE 4OHVA 2DWOA 2FSFA 4KFRA 1ZP6A 3A1TA 3SHFA 2KBFA 1LY1A 2CHGA 4WZ6A 3A4LA 2GZHA 1NSTA 2BVNA 2JJ1D 3OFND 4YC7A 3ZS8A 4B35A 3CZPA 1TQ4A 1AK2A 2XNSA 4GFDA 3AUYA 4D6PA 1NJFA 1CTQA 2OBLA 3VNVA 1PVOA 2ZRHA 4PO8A 3REFA 1TQDA 2EQBA 2IXEA 4ESVA 3TVTA 4P31A 1R8QA 3QXJA 1NSFA 2ZU6A 4LCBA 1VCOA 1XZPA 2A30A 3PUXA 5EE5B 2Q9AA 4CW7A 1NVVQ 1A7JA 4NU0A 1O87A 3K0CC 3QXXA 4B3GA 3NBXX 1DEKA 3CR8A 4KJZA 4Q9LA 1NLZA 1VIYA 3NHBA 3W8NA 3KZ1E 2ELIA 3AGPA 2IK8A 2XOKD 2QROA 3MJRA 1N0WA 3AP3A 1UFQA 1NVUQ 3THXB 1GRRA 1CRQA 3J81k 2W6JD 1G5RA 4G01B 2ZSBA 4PAOA 1PTRA 4LBYA 3AVVA 2QGZA 3GEIA 5FI1B 5JWHA 3GD7A 5TDHA 5LB4A 4TLEA 5CITA 2IS2A 4XD7D 1MRNA 4NHOA 2N1BA 2GA8A 1GP2A 3AVQA 4FCWA 2HF8A 2J45A 2J0UA 3ADDA 3KQUA 2ZJOA 4A2QA 1GUAA 1M6NA 4JL8A 1XCPA 4LPKA 2IW3A 4LX0A 2IUTA 4B2LA 5A5GA 4NTZA 3VKWA 2ZE7A 2Q3MA 4H1VA 1UF9A 3NC0C 5KUTA 3QSYA 3QIAA 2H1LA 2A5FA 4PQFA 4Q1EA 4NONA 4TYNA 3AP1A 4US2R 3VX3A 3MG9A 4Q01A 5EXXA 1CXZA 3GLGA 1ZIOA 3AVWA 1W5SA 3GJ0A 1AKEA 1FNMA 2OG2A 3EPKA 3PG5A 3KL4A 2ZRNA 1WF3A 1CJTC 1M2OB 1Y63A 3TUJC 3THYB 1H8ED 5SZKB 2QG6A 1E2JA 5P21A 3CPJB 4IDOA 1KI8A 2VP6A 5HKKD 1XBTA 2B7BA 3KTAA 4IXNA 5AUOB 5J47A 4JLPA 4B34A 1NVVR 2MMCA 2VYFA 4HLQB 4Q7MB 1NJGA 3OESA 3Q72A 4R2IA 5AUNB 621PA 5JEEA 4PPQA 1S1MA 3PUWA 5JMTA 5M04A 4PX9A 2RGDA 5F2EA 3TR0A 4G0NA 3UWOA 3RLFA 3DDCA 1UEJA 1GNQA 1NN1A 1G3QA 1P4SA 4Z1MD 3Q5EA 4Q4JA 4QGGA 5DLQC 1WB9A 3A36A 2O8EA 4K8OA 5FPKA 1UBCA 2REOA 1E2QA 3WRXC 3DMDA 1G6HA 5ELXA 1ELOA 2HT1A 3PIRA 2ZS7A 3A6PC 2FFAA 3X1WA 2NPIA 3GPLA 1Z83A 1XNJA 1W0JD 3OZXA 3CRRA 2IS6A 4Q1CA 3BXZA 5LPNA 3EPJA 1WCV1 3NIBA 4X8MA 1WMSA 3FKSA 1E1QA 1G7RA 4BZQA 1G21E 3O8DA 3Q3JB 1ZVQA 2Z5FA 3IUYA 1J2JA 3FHTA 2IA5A 3V9PA 5BN5A 4CEJB 5IK2D 2A7QA 2J59A 4RJLA 2X2FA 3BS4A 4IVRA 3DM9B 2ZQ5A 2F1IA 4YXWA 3TNFA 5CIWA 2ZTSA 1E9RA 5AJXA 2QQ0A 3BIFA 1NRJB 1ZUNB 1S0UA 3H84A 3FHCB 3EIHA 4M8NE 5HE8A 4PO9A 4URYR 1CF4A 3EIQA 3RSLA 3LBNA 3KUDA 2P3SA 2Z6VA 2ZI9A 1KYIA 2PEYA 3AKEA 4F4IA 5G41A 5FBRB 1PTQA 2J87A 3B8HA 4ARZA 2FMXA 4IEEA 3AM1A 2W2XA 3RDPA 4PPFA 2GDJA 1A4RA 2ORWA 4KI0A 4OL0A 4L5BA 2JLSA 1Z6AA 2D7CA 5TARA 4Q02A 1QG4A 5CM9C 1KAGA 4IFBA 4L9WA 1OIXA 2ZE6A 3GLGE 5FR2A 2ZI6A 4UNRA 4ACBA 3SHWA 4XJXA 5L8VA 3OIUA 2OHFA 1N5IA 4KHZA 2JDID 3WNCA 5L3SB 3WBKA 2IYRA 1Q3TA 2WAYA 2W00A 4BQSA 1CBUA 4JLJA 1T6NA 3UIEA 1G8PA 2FSHA 3U6KA 3CRVA 2WKPA 2J5XA 4DHEA 2ZRIA 2OLJA 2KBEA 3LX5A 4ZDWA 5HZHA 4II7A 4HLCA 1RPZA 1G5TA 1US8A 2XSZA 1W1WA 2HUPA 3TMKA 4BRWA 4LHWA 3QOFA 5EP3A 3LW8A 1E99A 3KXIA 2WMNB 5DHFA 1YR7A 3WP1B 4B76A 3T61A 5GVRA 1E4VA 1IM2A 2WIAA 1Q22A 4FMDB 2O0HA 2J0VA 2FSIA 3I5XA 1MO5A 1N5JA 1YE8A 4R7ZA 3SZRA 1QDEA 3C41J 1IXSB 4A0RA 2RGBA 4L8GA 2O8DB 2QTFA 4Q47A 2HLDD 1HURA 3GFTA 1KDRA 2CDNA 4Q4LA 2ZS8A 4P33A 4FMCB 5K8LA 1KJZA 1KBFA 3W6NA 1QVRA 1YR6A 1T4GA 1VIAA 2ZRGA 3P4XA 5KSYA 3T06B 2F3RA 2R2AA 5H1YA 5J4VA 3LLMA 2PEZA 4Q4HB 5F9HA 1BYIA 3U4QA 2B92A 3LH5A 4LYHA 4NPHA 3ZIAA 5CYPA 1KZ7B 2WWGA 4GT1A 1EXMA 3ICQB 2CHQA 1KI6A 1W0KD 1QHXA 4MGIR 4QKQA 6Q21A 1KMHA 1C9KA 2OCPA 2FX3A 2QBYB 2WHXA 1FAQA 1VCIA 2W0SA 3RS2A 2IT1A 1UAAA 3AQ4A 1E2DA 1ETUA 4Q7LA 4XH9B 1ZD1A 3PXGA 4EPXA 4DSUA 3CNOA 3BOSA 3VX4A 1YZKA 3WHKA 2JLVA 2VO1A 3FMFA 3RYTC 5K8TA 4D2IA 1RC8A 1N6NA 4EJSC 3K09A 5EP1A 5KOYA 2O52A 4LYJA 1OH7A 3T34A 1ZM3A 2GEDA 3AVUA 4FW9A 5KNBA 2HEIA 4TT3A 5JJIA 1R0ZA 5JCZA 1P2SA 3BJIA 5CIQA 1OH5A 4TYWA 1JQLB 2AK2A 4JLKA 4XOIA 4HB2A 1TTTA 2WJHA 1FL9A 2Q9CA 3HU2A 3PR1A 2D06A 2HF9A 2V6JA 2O8BB 2QP3A 2CLDX 1KI9A 1E0KA 2WJVA 4EIWA 2WJGA 5KU1A 1U8YA 1G7CA 4NZYA 1K5GA 4KLZA 3DEFA 3U3RA 4RCZA 3O8BA 3VU9B 1G41A 2H16A 1Z07A 1E2GA 4NYIQ 4NH0A 4ASUD 3QF4B 1SXJA 4EFLA 3WYGA 1YZLA 1VHLA 1BS1A 3TSZA 1NBMA 2R44A 5JLJA 4LC0A 2OBNA 3V4RA 3AF4A 1FMJA 1NLYA 2ZITA 2IBMA 3FHOA 1NKTA 3SQWA 2J9RA 1ANKA 4F91B 4LYAA 3QG5A 3MRSA 3PEVA 2PT5A 4UNQA 4E5UA 5HE9A 1WRBA 4B44A 1P72A 1CU1A 4CT5A 1E9EA 1QHHB 4Q4AB 4X8LA 3KFXA 4BLRA 2V1UA 1XDBA 2CNWA 5FR1A 4I81A 4IDHA 4I1OA 5AR1A 5CDFA 2EFCB 3K0CA 5JI2E 4OKSA 1YJ5A 2F1RA 1Z22A 4R2HA 2IF2A 2NQ2C 4LJ4A 2ONKA 4ON9A 4JKYA 5CYOA 4LBWA 3L0PA 1YHNA 2B8WA 2Q0HA 4LHVA 5TV2A 5BN3A 1FARA 2H5EA 4Q48A 5J4LA 4MUBA 1COWD 2X1VA 3ASYA 2WJYA 1RRGA 2R6FA 1UDWA 2JCSA 1TF7A 2YWHA 3VR1A 3P32A 1KO7A 2ZU0C 4RD0A 1Z63A 5AWFC 3C7KA 1RYFA 4EJSB 2GESA 1DOAA 1M8PA 3QENA 4NYIR 3GJXC 3HU3A 4DSTA 5IHPA 1SHKA 1FTSA 1VG0B 4M9SA 1IBRA 3FWYA 4QBHA 2KB0A 1FFHA 1Z28A 1N6PA 1G20E 2ATVA 1T3HA 1QHSA 1NLFA 1M1YE 1Q57A 3GFOA 1E79A 1TAGA 2D74A 3FMPB 4TMXA 1XMVA 2WWXA 4KBFA 4EAQA 4B3DA 1XF9A 1E1RA 2DB6A 4K46A 3U3JA 3F0TA 2VHTA 4WA7A 5GJBA 1M34E 2QE7D 2W58A 2CLSA 4JSYA 1CIPA 3SJCA 3BH7A 3L8YA 2DR3A 1KI7A 1IN4A 3BBPA 2XGJA 4OI1A 3CLVA 1DS6A 2UZ3A 4PPGA 3UXMA 1SVOA 1NBME 1D2EA 1YVDA 1RKBA 2L0XA 1VTKA 4LBZA 2C99A 1P9RA 2CLCX 4WVFA 1EFRA 4Q5IA 4C7OB 2WWFA 4GSYA 4F38A 2FN4A 1L4YA 1XRJA 4A1FA 4M21A 4JVSB 4QOSA 4OQLA 1OXSC 3U5ZB 1SKYE 4XTCS 2SHKA 2ZE8A 1DO0A 2UZIR 4JVMA 4HUTA 4D26A 3I1FA 4CT4B 1HE1C 1G8HA 3GLFA 1OXXK 2I3BA 1XPUA 4A6PA 4RD3A 4AK9A 4XSHA 2WJJA 4JT2A 2OCYC 3NDPA 1Z0AA 2ZPTX 2ZJBA 5FBWB 5CDFE 1EFTA 3WNDA 3R9IA 1FPMA 2GXAA 1OH8A 4AG5A 2YV5A 3IIMA 3QKSA 5DO9A 2D4HA 1MOZA 3UG6A 2QQEA 2GK7A 4ZO4A 2ZJ2A 4BRUA 3WP0A 1IAQA 5E3HA 4IXMA 4DJTA 1E3MA 3BB1A 2HYDA 3U7HB 5FL3A 5FUWA 1XTSA 4BZXA 2JLQA 3O47A 3VAAA 1EK0A 3Q5DA 4W9MC 3N2EA 1O3YA 1T8UA 1KI1A 1HH4A 2BMDA 2O0KA 2JATA 2WWWA 1VECA 3W3AA 3V4FA 3UWKA 5HTKA 1H8HA 3TR5A 2J0UB 4MRSA 4QHYA 2NZJA 1RRFA 2DFTA 1A2BA 2YOHA 1TMKA 3D8BA 1N0VC 3K0FB 3P27A 2ODEA 1HT1E 1LB1B 3BWDD 4BGDA 5LDDC 2Z43A 3TQCA 3NDBB 1OH6A 1G9XA 3CRQA 3EASA 1JNYA 3KFVA 4BE7B 2PZGA 5JRJA 4U5XA 1FUUA 2YVUA 2Y8EA 4TTQA 3GLGB 2BCGY 2JJ8A 4MKFA 3NEYA 2JJ2D 3EZ7A 3CM0A 2XEXA 3ONWA 3ZZTA 5SZHB 2RHDA 3LAWA 4URVR 2R6CA 5A4JA 4QGAA 1JEEA 1P5ZB 2FPKA 3S1AA 1E0SA 1KK1A 4QJ4A 3KTAB 2FDCA 3OIYA 2F9LA 2W0MA 5G40A 1G16A 1KZGB 3CWQA 3LLUA 4MGKR 1GILA 2OCAA 3QPWA 3I8SA 1VMAA 4LYFA 2BMEA 1FUKA 4HATA 3UG7A 4JKIA 4LUCA 2XZOA 1JXMA 1UKEA 3VU9A 2XXAA 3LQQA 3EZ2A 3TH5A 3VR3A 1XEWY 4CGZA 3TGPA 4LJ6A 2OLKA 1MH1A 2QMOA 1LS1A 2X8AA 4Q4JB 5AK0A 4C0LA 4MKGA 2BV3A 3GQBA 3VHLB 2ZS9A 2O8EB 2LKDA 2IYSA 2P5SA 1E2IA 3KKOA 1B23P 1GDDA 2FEMA 1Q20A 4RSGA 4D4JA 4DEYA 4DLVA 3MWJA 4DDWA 2ROWA 1DAGA 1GWNA 2ZRPA 3GEEA 1JR3A 1W7AA 1G18A 3CUEF 4TTPA 1ZCAA 4IRUB 1P2VA 2R6DA 2ZJ5A 4KLNA 5JSZA 2ZROA 5DYGA 2N42A 3VR4A 4XTRA 3EXAA 4FD2A 5JI3E 1DVRA 1X86B 4UXHA 4A2PA 4GOXA 1EGAA 2C2HA 4MUAA 1Y3AA 4D4LA 2WIBA 4YQFA 3ZD7A 4TSFD 1DAHA 2OT3B 5FBLB 1P61B 3DKPA 2C8VA 4AKIA 4OJQA 2P67A 3B13B 4IHQA 1E98A 2DBYA 5JECA 1ZMXA 1BO6A 4ZDJA 5C4MA 4P4TA 2ZAOA 5GJWC 1G6OA 1XTJA 5A0FA 5TMPA 5EE1A 4HZUA 4LC1A 2GZDA 4YDHB 4CIDA 1GL9B 4TL9A 5L3RA 3RS3A 1ZIPA 1HQCA 4WOPA 3ZH9B 1XPRA 2V55B 4ARZB 2IF0A 3MMPA 2H57A 1TU3A 3T1TA 1UBGA 1CJVC 3HYTA 2BM1A 4ERNA 1AGPA 2IUSA 5SZIA 1AM4D 1ZNZA 4A15A 1BMFD 5GJVC 1CRPA 3EWAA 1ZAKA 4DLZA 4HYYA 4RZXA 1XMJA 1YZUA 2W6ID 4L16A 5IT5A 1IN8A 2F3TA 1TQ6A 1G8YA 3C5CA 1SZPA 2YOGA 5KSOA 4B6DA 3EZFA 1S2MA 3LDAA 3B82A 2QAJA 3LW7A 4QG7A 1EFUA 4E09A 4XVUA 1OE0A 3AF3A 2JIZA 4JIMA 4B74A 3QXCA 3CF0A 4IOLA 4ITRC 4B3BA 4QNMA 2ZJZA 4FKDA 1P73A 3H4MA 1OYYA 1W4AA 3A1WA 3CX7A 1EWQA 4DCVA 2ZYTX 1U0LA 3ADBA 1XEXB 5D3MA 1OJLA 1GKIA 1SXJC 4TYYA 3ND8A 5DISB 1US8B 2ASEA 2UKDA 3AKDA 1CP2A 3MJHA 2BBOA 4I4LA 2ZIAA 3SS8A 2CVFA 4GBMA 4CVNA 2MSEB 5FTNA 3RC8A 2IYLD 1NMZA 2H7VA 5B58C 4DUGD 4C9BA 1IOZA 3LO5A 2EYUA 1P6XA 3R7WA 1D2MA 1YZNA 2D3WA 4C7OA 1VYUA 1KO4A 2ZUBA 1A1VA 3G0HA 5FI0B 3K9HA 3H1TA 4DDUA 1JR3E 1T0HB 1AS2A 4D4KA 1G7SA 3CBQA 5E95A 1VYVA 3AVOA 1IHUA 2IYYA 2HJVA 3IEVA 3QQ5A 3FFAA 5K8UA 2YZ2A 4PZYA 4P0TA 4L15A 2G1JA 1FNNA 4ZKEA 1FP6A 1CJKC 3A4NA 4G5GA 2G77B 1ZRHA 1BOFA 2RAPA 3U4QB 4M1YA 1MABA 1OFTA 3A37A 4FCVA 3B1YA 2YNMA 3PITA 4JMPA 4GL2A 4W5WA 4BFVA 3TE6A 1KI6B 2PCLA 5EXSA 4EPWA 4DEXA 4W7SA 1KMHB 2ZJYA 121PA 1P9WA 1R4AA 1NG9A 4OQNA 3QPUA 1OF1A 4A0FA 3IDQA 1J7KA 5DSZA 3WMGA 4IDNA 1Z06A 1KDPA 2ODBA 4C0HA 3PEWA 3R8FA 3OHMA 4TZ6A 2XTMA 1NMXA 2FA9A 3KXLA 5EQTA 4XWKA 2ZYWX 4OQMA 2RMKA 4BPBA 2VHQA 2VTKA 5EJEA 3EAQA 4N0EA 4PSVA 4JLNA 1HYQA 3LBHA 1WP9A 3ICEA 2ZRJA 4TL8A 2GAAA 2FE4A 2HCJB 2OILA 2ZSDA 2OEPA 2OAP1 1KO1A 1JQJC 1RYHA 3TW8B 1U90A 3RS7A 1TX4B 3EIEA 2OESA 4HDCA 3K0FA 3L0OA 4V0LA 3T35A 4CEIA 3WNBA 5JCPA 3HR7A 4HAXA 1EFHA 3ZGXA 1E9DA 1FTNA 1E2KA 1IJEA 3FTQA 3WY9A 1UBFA 2CXXA 1W2GA 3H0KA 3CNLA 3P4YA 2KWIA 2PL3A 2NG1A 2OFXA 3CH4B 4QC2A 1Z6XA 1IY0A 2BKUA 2WAXA 5JHHB 3K70C 5EP2A 3ZLJA 4I1VA 2JGNA 3ZYCA 3KKMA 3ZVMA 1QZXA 3UMFA 1RW4A 1ZU5A 3Q85A 5AUPB 2WVJA 1SXJB 1R6BX 2C9OA 1DG1G 2VLIA 4BLQA 1P60A 5JFGA 1K5DA 1CR0A 4NCHA 4H1UA 1KY2A 2QEQA 5C4GB 1GL7A 1KSHA 5FL7D 2XNDA 5J5CA 1OFUX 2PJRA 4UXJA 3QXHA 4BFSA 4KFTA 3NH6A 1XJCA 3GLIB 4LHXA 2CHVA 1YU9A 3AKCA 4ZKDA 3O8RA 2GCNA 1G3UA 4KU4A 3EWSA 2NOAA 1XTIA 4O0MA 4TYQA 1SKYB 3DM5A 4ZI3A 2A78A 2WPDA 1NKSA 2P6RA 2Q3HA 3QVUA 2NPFA 3CXLA 2ZRFA 3LX8A 1RZ3A 4HUQA 1WBBA 2QPOA 1MO4A 4KFSA 1W36C 3QG1A 3OAAA 3PVSA 2HT6A 1FQJA 1XXHA 1MO3A 3AF2A 3K0EA 5FPSA 5CLQA 2OSBA 3GFPA 1G1MA 1P7CA 2AXPA 2QMEA 3OEHA 2KSQA 3B9QA 4TLCA 3WRYC 2QN6A 3TBKA 1TEVA 2JLWA 4ZI2A 1XCGB 3FKSD 3B1WA 1E1QD 1E0JA 4DBLC 2GJAA 3KJIA 3B1ZA 2C9YA 4OK6A 2AWOA 2BJWA 1J8YF 4JLBA 4DLYA 2WTUA 1YZGA 4IDPA 1P62B 4YXWD 4CF7A 1GTVA 3FKQA 3AVXA 4ZPXA 3LWNA 2QNRA 4RD6A 5EZ5A 1SULA 4B73A 1YQTA 3OEEA 5BQ5A 5IK2A 3LRPA 2O0JA 2QT0A 3Q9LA 3KQLA 1N6KA 2QA5A 3WYFA 3WHLA 4OQXA 3RC3A 1ZNYA 1LS6A 4M0LA 4PHGA 2QP9X 1F48A 3RWOA 3MFYA 2PT7A 4OHWA 3SU8A 3KKPA 2RB4A 3A1UA 4QJ5A 4RZ2A 1TU4A 3UFFA 3ZVNA 4PTLA 1QBKC 3RNLA 1MR3F 3TVDA 5KDOA 5KYKA 1UEIA 2PJZA 5K8IA 4Q66C 4C4PA 3BB4A 4V0MA 2F43A 3AB3A 3H2YA 4HAZA 3M6AA 2F55A 4TQAA 5FOWA 3K70B 2CL7X 3TUZC 1W4RA 2NZ8A 4NL4H 3KUCA 2N46A 4QHTA 3QF7A 1A2KC 2YHSA 3PEUA 2GCPA 3VMFA 5L3VA 4HDOB 3A1VA 4MKHA 3KQHA 1FP7A 1QF9A 3CZQA 1AQUA 2F9MA 3A1SA 2RGNA 4HEJA 2FH5B 5EUQB 4KAXA 1W4BA 1HT2E 2FFQA 2OO7A 4TMZA 3ZQJA 4R98A 3SEAA 2GNOA 1C1YA 1OXUA 1P2UA 1XMIA 4LI0A 1XEXA 2CE2X 3DPUA 1PLJA 1GITA 2WWHA 3Q7PA 4GRAA 4C0JA 2FPMA 3PV0A 5JRZA 4OK3A 2PX0A 1ZYUA 4D4MA 3FFBA 3C5HA 2GXUA 5UKDA 3W3ZB 1CLUA 3AF1A 1ESMA 2GJKA 2IS1A 2QPAA 2XSZD 3TK1A 3GLFB 4IOMA 3RRMA 1Q44A 1NY6A 4PHHA 2QM8A 3PUVA 3UANA 5EE3A 4C0AC 1DAEA 3U7FB 2ONJA 4M2LA 5CJPA 821PA 4MKIA 3SE0A 3ZVRA 2HV8A 3RHFA 2D7DA 2V8OA 1GG2A 3QKSB 3FOZA 4QJ3A 2R8RA 4N1AA 4GMDA 1RRCA 3OE7A 4HB0A 4O3MA 3U44A 5AJZA 3W8RA 3JZAA 1QHIA 3DOFA 1LW7A 2A3RA 3KB2A 4JVLA 2K5UA 4IVPA 3BORA 1EX7A 3GJ3A 5DE3A 2QU8A 1PUIA 1W2HA 3B78A 4LHYA 2V54A 5E7MA 3TAHA 1NP6A 4AYXA 1Z47A 2RCNA 4CEHA 3GJ7A 1VG1A 3ZIAD 4KXFB 2JASA 4IKEA 3ZS9A 2WSSA 1G64A 1YRAA 1JAIA 3KJGA 5JS7A 3PENA 4A9AA 2ZJ8A 4LV5B 3HWSA 3CWZA 3THOA 3UGDA 3OIVA 4DDTA 4ACAA 2F6RA 3TQFA 3SQXA 2VP4A 2GJ8A 3LA6A 1FX0A 2ZSFA 2IL1A 3U7GA 1HV8A 4AKGA 2EWWA 1GKUB 3X2SA 3MLEA 4WXRA 1LF5A 4QBIA 1G291 4V0ME 3SR0A 4TWZA 4A36A 4HLDA 2ZUDA 3K9NA 5TB5A 3DKVA 1KK2A 4I1SA 5KDDA 3S1AB 2NIPA 1R7RA 4TT3D 2P6NA 1E9CA 1X3SA 4NCIA 2AL7A 2GEUA 1RE0A 2R6AA 2REBA 2FNAA 1ZM4A 1WBDA 4B75A 3AV0B 5FTMA 2VHCA 2WJIA 3DOEA 1U9IC 1VG8A 2VA8A 4G3XA 4DT1A 4NDZA 2V3CC 3X1DA 5E7IA 5LB2A 2O8CB 1JPNA 1KGDA 3EC2A 1LTQA 4Q18A 2XXAB 2R65A 4KITB 3GP8A 1AA9A 2OUKA 4NMMA 1S1CA 2BEJA 4LJ8A 5HPYB 3KQNA 5FPTA 1N6IA 1YRBA 3B6EA 4JVNA 4YDSA 2G0NA 4UKDA 3TAUA 4ZIRB 2GCOB 1SXJD 2DHRA 3EZ6A 2ORIA 3HU1A 3CPEA 1NBMD 2J41A 3I4LA 4IDQA 3FMOB 1R0XA 4IVQA 3ADKA 4A4DA 1OIVA 4EKDA 1ZINA 3KKQA 3GLIA 2BJVA 4AG6A 5CB6A 3CKLA 1NIPA 1A5TA 5JSZB 1JBKA 1WXQA 4LY6A 3K8YA 1W47A 4TTRA 1U0HC 1HA3A 4MH0R 1CULC 3I8XA 3KX2A 4K81B 2E73A 4GP7A 3ZVLA 2V9PA 4BFWA 4F92B 1XTKA 4P3YA 3VKHA 4LJ5A 3B2EA 1K6MA 2MSCB 3KQKA 2PH1A 3GJ6A 4RY2A 3MWKA 1DG3A 4QBFA 1YZTA 4YONB 3QBTA 2CNWD 5EE9A 3D3QA 4HZUB 2C98A 3VKGA 1MKYA 3NHAA 1DELA 4NBSA 2C9CA 2QMUA 1UBEA 4KCGA 2QSZA 1KSGA 4F4JA 1PUJA 2H8KA 2ZETA 1XB2A 4P4UA 4W5HA 2IWRA 1X8KA 5HCNA 3VFDA 4MRNA 1S9DA 1U81A 4DB4A 2QGNA 3VQTA 2PCJA 2J7PA 3L0IB 3RANA 4M53A 1KOFA 1IN6A 1G5PA 1OXVA 1ZUIA 2F1HA 4JBXA 3X1YA 1W48A 2WZQA 1PV4A 2YWFA 2DFLA 4N0DA 4FI3C 1E0AA 3NWJA 4TQ9A 2CE7A 5FOVA 4BEJA 2WKRA 3U3KA 1M7GA 4PSAA 5G53C 4Z8XA 2A5JA 3AVTA 3UGLA 1R8SA 4KYIB 4DVGA 2H18A 4KYUA 2OCBA 1S8FA 2ZR9A 4NYJQ 2WWYA 4ESHA 2VQSA 5J4YA 1XZQA 2ERYA 2VSOA 1E94E 2WOOA 3MCAA 2AKYA 4QFMA 1E79D 1DTSA 2C77A 4UNNA 3T5DA 5D3MB 5KO2A 3KDSE 1M74A 2ZR7A 5AJVB 3N2IA 3IIKA 3AKYA 1ZC4A 2AX4A 1F60A 3SYLA 3EPLA 2YKGA 1SXJE 1II8B 1GZSA 4BWYA 4CDGA 5F3WB 4AI6A 1P2TA 2BOVA 2HYIC 3RS5A 1CJMA 1U94A 2HDNB 3HR8A 4OI4A 3R7WB 4JLVA 2ZAMA 3UEYA 1E32A 2NO1A 5AUQA 1QVAA 2AXNA 4GZLA 3GLIE 1GRQA 2QL6A 1EFRD 3PJRA 2QTHA 3TSOA 4A6XA 4R71A 3BAFA 4YMSA 5L3QA 3BC1A 2GK6A 3K0AA 4LV6A 5DIFA 1OB5A 4AY2A 2YINC 3HYRA 3IBGA 2IYQA 1FMLA 5J4HA 4Q9HA 4GZMA 3IQWA 5ANRB 2KJQA 2CBZA 5DHAA 5FOUA 5KNCA 1MABB 2H17A 2QZ4A 3KJEA 2FNFX 4IW3B 3A4MA 5G3ZA 3EZ9A 1D9ZA 2YYZA 4NCNA 4RD2A 1CR2A 3LY5A 1HUQA 1KNXA 4DLUA 3HDTA 3L8ZA 4URUR 1L8QA 2GILA 3REGA 2MSDB 1WDTA 2GJSA 5TXGA 1N6OA 2Z4SA 4DCUA 2QPTA 1Y8FA 3V00A 4NYJR 5EP4A 1E6CA 2GVZC 4FIDA 2IEZA 1KBEA 4HAYA 3B60A 4PC7A 1IN5A 1E2FA 3U2QA 4D81A 1B0UA 2XJ4A 3BERA 4PO1A 1NL3A 2ECKA 2CK3A 2HXYA 5DN6A 1NN5A 2B8TA 2EYQA 4AURA 5EXTA 3ZQ6A 1LFDB 3MUFA 4MRRA 5FH9A 4BFYA 2PMDA 3C14C 1H8HD 4CEIB 3RS4A 4V02A 1II0A 2PMKA 2ZR0A 2RGEA 3K9GA 1EG7A 3D31A 5H68A 4EPVA 1VYTA 2BHRA 1Z3IX 2OFWA 3MWLA 2AKAB 3W34A 1FW6A 1J99A 1XCMA 1Z2CA 1SKQA 1D9XA 2PLFA 4Q7JB 3QKTA 2VF8A 1OB2A 2R62A 1E2HA 1V43A 1FOEB 1AN0A 1QHGA 1E9FA 2PLRA 2V6IA 3R9WA 5EZ6B 3A8TA 4HZIA 1E96A 4URXR 3LBIA 2GTPA 1GOTA 1S96A 2ERXA 1NG1A 2IYXA 1Z2AA 2QMHA 3GJ8A 4A0HA 2RGNC 4PZZA 1N5KA 4DLTA 4TZ0A 2FF7A 3KB1A 1DARA 4Q19A 2VPPA 1SVKA 4JBWA 2O8CA 1KSFX 2JEOA 1NY5A 5KPJA 1CR1A 3EG5A 2LCFA 3HJNA 2ORVA 1G7TA 2J46A 3LFUA 1T3SA 3T1OA 1JXOA 2ZRKA 1SVLA 1OKKA 1DAKA 2VP5A 1JEDA 5KSPA 4O2RA 2F1JA 4IFEA 1HQYE 2NO7A 4ZIRA 4HUQB 2GCOA 2VBCA 1W5TA 3W5IA 2G83A 2VRWA 4GMXA 1CR4A 4RKFA 5FTJA 4S35A 3GLFE 4FWIB 2FU5C 3B1XA 3CO5A 4G5SA 3N5CA 4WZBE 4XWAA 5BW8A 5JHGB 1XXHB 5B57C 3PEYA 1II9A 4HAWA 4KODA 1VCMA 4US1R 1Q1BA 4XWOA 2PZFA 3M0EA 1JR3D 3CRW1 5IRCD 5JWRA 4PXAA 5C2JB 1UM8A 1LNZA 4MDEA 2OV2A 4OI0A 3P20A 1KTVA 1HEIA 2ZYUX 721PA 1R5OA 1RJ9A 2QT1A 4BLTA 3FE2A 4M9XA 1X8JA 5JZVA 4JL5A 5E7JA 4IOKA 1OFIA 4O25A 3QEJA 4RFVA 4TLBA 2V7QA 1JB1A 4G5RA 2WMOB 4DIDA 1KMQA 3T15A 1DAMA 2FFHA 3LNCA 4B6EA 2GKSA 1OHHA 3UEJA 4WAUA 1OXTA 2AD5A 2I1VB 2ZUCA 4G1UC 1CJUC 4ZCLA 2VSFA 5DGXA 1Z0JA 4H9GA 4QBGB 4OHYA 2XJ9A 4RVCA 1AKYA 2F43B 4NYMR 4KV9A 1VDZA 2ZI5A 3SN6A 1K8RA 2YWEA 3GCGA 2FGJA 3QPVA 3D6TB 2EW1A 3NBYC 4PSKA 2E87A 3FMIA 3RRNA 1Q0UA 1ZBDA 1KHTA 1KIMA 3DHWC 1ZM7A 4DSNA 2IUUA 1A82A 4O2LA 2DPXA 3KXKA 1W44A 1F2TA 4GOJA 5BYJA 1GAJA 4MGYR 2JIZD 4LOAA 5CK5A 1XMSA 4LBVA 4MA4A 1U9IA 4UQOA 4A92A 5H8WA 3MGCA 3HPQA 1KDTA 1E69A 3CX6A 5SZJA 1ZNWA 3T5GA 2CCKA 2EWVA 3O8CA 2VF7A 1RRPA 1II8A 4M9ZA 1NMYA 4KVGA 3BGWA 2RGXA 3B1VA 1AZTA 1TPZA 1MV5A 1Q12A 4F4CA 2XTNA 1KO8A 3CX8A 2AFIE 1PZNA 4LV8B 3SDZA 4BFUA 4PC1A 3BRWD 1LVGA 2GHIA 1OV4A 4B3CA 3EARA 4FMBB 4BASA 4LRWA 4PANA 4P32A 1Z6TA 1UADA 1UKYA 4C0BA 3U6BA 5GADl 4PZLA 4M1KA 1Z0KA 4M1SA 2WM9B 1R0YA 2ZI4A 3SFZA 2X2EA 3TRFA 3U44B 4Q9IA 2J0SA 3DMNA 2IYUA 2PZEA 3OFNA 2JJ1A 4IEIA 3VR6A 1W4CA 2ZRDA 1NN0A 4LDJA 1G3RA 2MMGA 3DZ8A 4V0KA 3IPXA 4DLXA 3LXRA 1R5BA 1SVWA 4TMVA 2ZE5A 2W2VA 3ZDQA 2NTYC 1KK3A 4LGMA 1G17A 4Q7KA 4E07A 4CEHB 4DKXA 4PAQA 1KNQA 1SHZA 2CCJA 2ZVQX 2XX3A 3CF2A 5AJWA 2JA1A 4JLAA 4EQ6A 1L7VC 2RGCA 2ZM5A 4KO8A 4DCSA 3PUYA 2PBRA 4NCKA 4UXIA 1BKDR 1NN3A 1U99A 3OIWA 4JZKA 1QRAA 3EX7C 521PA 4FWTA 5DI3A 1P75A 2O8FB 1FX0B 1E2LA 1ZD8A 3AVPA 2XOKA 4LWZA 2C95A 3M1IA 5FBQB 5FPHA 1G3IA 2Z83A 3AVYA 2WBLC 5HZKA 4U7DA 2W6JA 4XVQA 2VSXA 2YC2C 4OJKA 1XTRA 2DY1A 2ZJAA 2P0EA 3CPHA 4PAMA 4TN1A 3ZD6A 5FOXA 4AKEA 4C3ZA 1NI3A 4Q1AA 4XD7A 3F5FA 3T1VA 3ETLA 4M22A 2BMFA 4JYBA 3I32A 3UGIA 4F7WA 4B6FA 2JLUA 4M1TA 1S9HA 2ZSAA 2FFBA 4DT1B 3IILA 8OHMA 3GEHA 3C8UA 4LSGA 4B71A 5J4KA 4AD8A 1CKEA 1Q1QA 2G9NA 1ZC3A 1JALA 2OM2A 3NEJA 4CZ2A 4TMTA 3THWA 3E2IA 2ZI7A 2CCGA 1LF0A 2IX3A 1HTWA 1R0WA 4NKRA 2BDTA 3FYHA 2G6BA 3BE4A 2RH5A 4GI7A 1KDOA 1E2NA 3AH8A 1OPXA 3GJ5A 1T9HA 1ONBA 1UPTA 3IGFA 2GXQA 1SVSA 1DBSA 1H8EA 1KKMA 2D2FA 5H70A 3WMFA 4EPRA 4GDFA 3IEUA 3EPHA 3W6OA 3FB4A 1IXRC 3CR7A 4C2TA 5HKKA 2XNDD 4B2PA 4JL6A 1F3OA 5TY0A 2BKEA 2QAGC 3QNUA 4Q21A 1AIPA 2ANCA 2G0TA 3QKRA 5FTLA 1QG2A 5FL7A 2WOJA 2RGAA 2OZEA 1E2EA 4PHFA 2WPDD 2Q6TA 3IKJA 2OXCA 4R9UC 1I4TD 2BCJQ 3AEZA 4LJ7A 3IHLA 5BN4A 4Z1MA 1DADA 1M7BA 2ODNA 2C5LA 2D2EA 3E1SA 1D6JA 1AS3A 2BBWA 2VHJA 2Z0MA 3OAAD 4WXPA 1J90A 1XEWX 5IF9A 2LKCA 1JPJA 4J0QA 3VTKA 3OEHD 1W0JA 1S3GA 2FZ4A 4QM7A 1TNDA 1GSIA 1LV7A 1QHNA 4Y0AA 3QVVA 4N3NA 3SYNA 2W2TA 2RGGA 2IYZA 4PC6A 2J1LA 3MSXA 4UJ3A 3I72A 5E4FA 1AJEA 1WE2A 1XD9A 1Z0FA 2JLRA 3I3SR 2GBLA 3SI7A 2QENA 1G19A 1TEXA 5BYKA 3OEED 1RIFA 4PHTA 1DAFA 2REXB 2YOFA 2Q9BA 2VP0A 4YMWA 2ENNA 1NVXQ 3ECCA 421PA 3CNNA 4DWJA 4D0LB 1KJWA 4LJYA 5BXQC 1W46A 5EXPA 4JLDA 5FUVA 2BM0A 3QKUA 1NF3A 5C18A 3RS0A 2JLXA 1N6LA 4M4SA 4EPTA 5IDVA 1UKVY 2C96A 2GETA 2QUZA 4P4SA 2KE5A 4LJ9A 1L2TA 3LQRA 3IO3A 3QY0A 2WWIA 3UPUA 2A5DA 4M9QA 3JZMA 4G5OA 4DDVA 4PR0A 4PQRA 1IJFA 4A2WA 1OSNA 5KDLA 1RFLA 3I73A 1Z29A 3L2OB 3M4YA 2CJWA 4MQBA 1J70A 4DLWA 2GVIA 3K53A 4RFSA 4TLAA 1TBNA 2ENZA 4HAVA 4QXAA 4PC2A 4LHZA 4TLDA 1ZM9A 3G5UA 3X1XA 2RKOA 1GNRA 3I61A 5FUXA 4I99A 2JDIA 1XJ0A 1VG9B 4MGZR 4TYPA 3T12A 2OAQ1 2QAGB 5L3QB 3K0AB 5FBVB 1RFHA 3QXSA 1XX6A 4OYHA 5CM8B 2CMKA 5G3YA 3FGNA 2FG5A 1I4LD 5KPDA 3L43A 3B9PA 4Q03A 5EE0A 1GVNB 4EFNA 1W36B 4DLSA 1XD2A 4Q9JA 1Z0IA 4US0R 1KI3A 2A9KA 1R10A 2CL0X 4CRWB 1XXHE 3QE0A 4JT4A 2IWHA 1XA6A 1EESA 4JSTA 3CF6R 1TF5A 4GNKA 1RVDA 3IHWA 3NH9A 3NTUA 1D5CA 2LWIA 4HI0E 2IXGA 3NBZC 2V1XA 1G3MA 1G8GA 1HY3A 3BK7A 3NVAA 2QTVB 1KO5A 5EUMA 5KSZA 2HLDA 3OE7D 3EA5A 4V0OA 1T0JB 1KI2A 2ANBA 3F8TA 3PCRB 4Q1FA 3WXMA 3U60B 5C1BA 2VH5R 2X19A 1X6VA 3IIJA 4JLMA 4L9SA 1R79A 1TADA 1TF2A 3QUSA 2NO6A 4JBYA 4RKEA 2FV8A 3B7GA 3KJHA 3L0SA 1G4UR 4X8HA 3UKDA 2ZXUA 2Q3FA 2YJTD 3P26A 1T5LA 2CEAA 4B48A 3GLHB 1IY2A 2KI5A 4YMVA 3GMTA 2QORA 4F93B 3ZZ0A 2WSSD 2ZREA 2ZVPX 4AIIA 2VL7A 5JS8A 3P1JA 2O8FA 1W0KA 3K1JA 3LV8A 4BECA 2ZYVX 3TLXA 4MYUA 5AJYA 4C0QC 1X8LA 1JJVA 2Z4RA 1G4AE 1XEFA 2BMJA 3RAPR 1XD8A 4BUJA 1KY3A 4LPSA 3RABA 5LBIA 4HSEA 3D7MA 3W90A 4AYTA 1E9SA 1VHTA 4WBSA 3VR5A 3BB3A 3THXA 4XIGS 4CYMA 2AD1A 1W49A 4JJKA 2HXSA 1Z8FA 1XJQA 2OBMA 5KHOC 1C4OA 2ODWA 1N0UA 2AK3A 2E1RA 1AS0A 1GKYA 1UJ2A
chains in the Genus database with same CATH superfamily
3Q7QA 1ESNA 3UAWA 1IZ0A 5K0JA 3OQIA 2CFIA 3VR2A 4AZ0A 1UVGA 3M33A 3NR2A 1T5SA 2VH2A 2XKAA 3I39X 4CMAA 1BU8A 4GZ5A 3U1TA 3B5EA 4H31A 4X94A 3WXBA 4AC9A 3V8VA 2R8EA 1G20A 1VE6A 3LCVB 1ZICA 4RA6B 4KVAA 4R4JA 2XZPA 1ECCA 4FC6A 1K97A 3EG9B 2ZBFA 2HIHA 2J7KA 3OHSX 5IJXA 4QPNA 4GPTA 2KLBA 1A9PA 2NAPA 2WIGA 2HPZA 5BW4A 4LCJA 3FBGA 4C0SA 2WYIA 1HDIA 1ZLXA 1XFAA 3MB5A 1JLSA 3JATA 4CM4A 2JARA 4TMKA 4RD4A 1NDHA 1Q83A 4KFCA 3GK3A 2IYTA 4LTDA 2ONYA 1P9OA 1A5AB 1B14A 1VP3A 2RBKA 3ZCVA 4NMHA 3A6GA 3THYA 3WISA 2OR3A 5T7BA 3C4JA 1NHWA 3VHXA 1Z6GA 3C43A 1ORRA 2QX4A 1JVNA 1GPLA 4NARA 2GKTI 1Q9BA 4PW0A 1JQDA 4RE5A 2IEGA 3Q8XB 3ZV4A 2P6UA 4ZOBA 3AZOA 4Y18A 1J09A 3ZHQA 3K9LA 3M8KA 4XCQA 4I4IA 4YLYA 1LPSA 4GP9A 1HT0A 3FD8A 2CEKA 2KW5A 4FK8A 1XN1A 4HRYA 1FSZA 2IS4A 1N2CA 3KY9A 1W88A 1X1SA 3JQ8A 2X1MA 4IGAA 2JKVA 2P6MA 3CW2A 1JR6A 2C2MA 1R1DA 1SGWA 4CV0A 4YCMA 1DXQA 4G0ZA 1JU9A 1P1FA 4KK4A 4ZCMA 3I9JA 1EWRA 3CVWA 2DYKA 4TV9A 5H0IA 4GX0A 4HDSA 3EC1A 2COUA 4P80A 2GXSA 2YJNA 2LDXA 4OUDA 5EEHA 4EW3A 1UBRS 2R9VA 2XT0A 3CLSC 3QJYA 1NVEA 1AY0A 2B4TO 2D1QA 4QFBA 1YXMA 1N25A 1UBJS 3DO6A 4AMVA 2AA3A 1GQSA 1IL0A 3ZDZB 2ZIXA 3P9IA 1Y3CE 3W4KA 4B6OA 4DWOA 2AVDA 4YCCA 2UXDB 4FLMA 4R8LA 5L4SA 1L5HA 2H3HA 3TR6A 4KQJA 5B7PA 3R0IA 4UNPA 4KXXA 4PC3A 2BH2A 4YLGA 3RRZA 4WTOA 4KSBA 3HPRA 3ZHVA 2F00A 2BFWA 4FNOA 4UM7A 4GLOA 3RF6A 1PDVA 3KQWA 4MJ3A 4FCTA 3U4MA 1UFVA 1F14A 2EFYA 1UJCA 3PNOA 4B8WA 5HSGA 4WI1A 2I8AA 3OE4A 4MR8B 5LBUA 1XQ9A 1T4CB 3LQ1A 3EIXA 3OETA 4QRHA 5T67A 4LF8B 4FYXA 3FOAA 2CJFA 4YCAA 3KU4A 4B87A 1UR5A 2OBXA 1YIDA 3UMRA 2G8NA 5I3CA 3I2JA 1RBZA 4QTZA 1RWOA 1CDZA 1WD7A 5FLEX 3JS5A 4QT4A 3PSAA 2XCRB 5TMBA 4OQ4A 3HH8A 2ZUEA 5J23A 2V3VA 1Z4QA 2QRNA 2SKEA 5GGYA 4HG2A 3K70D 1S3IA 4LTMA 4RD1A 1WJGA 5B6IA 2DFNA 4BFZA 5J5AA 4EGCB 2V6GA 4C1BA 4XI9A 1Z5OA 3LUGA 4HDRA 4ZMBA 1PGOA 4UCXA 5TVKA 1L5WA 1N7HA 1A27A 1U98A 3MD9A 3MJCA 1EFPB 4OU4A 3AT1A 4AJEA 4EDHA 4W8GA 1K3FA 1PE0A 3HKCA 2NXWA 4IR7A 2C4NA 1YS4A 1CGII 5JEDA 3NXSA 4IDFA 3X43A 4MPJA 1CP3A 1UC5B 2C4VA 2KQUA 3L82B 4QL3A 1YS7A 3W6ZA 1DFHA 3ESXA 4CMGA 1A5BB 5IWCA 1W87A 4RK0A 4Y6RA 5HCIA 1K7CA 2QI9C 1AUQA 4RYLA 1MFZA 1QF6A 4S1PA 3OF2A 1TQ8A 4LZNA 5GOTA 3VBCA 2FX5A 4UMVA 1XELA 3A14A 1IFXA 3LIIA 1NVKA 3MMZA 5HRUA 3R5DA 3NAMA 1K1EA 5CJ2A 4PQYA 5B36A 2XYRA 1GGMA 2X9LA 3CEJA 1W36D 3NYIA 3A6HA 2JK1A 3GBPA 3AUUA 2FHPA 4BX9A 3AW8A 5JH7A 4RPIA 1DKPA 1KYWA 1EKXA 4LWQA 3O8NA 4TKUB 5CFOA 4R05A 5EZYF 5CX1A 1PT9A 1Y3DE 4EF4A 4DDKA 3D3NA 4YAIA 1I8TA 3AJ9A 4TXNA 3D8SA 5I6DA 3HM9A 4MRVA 4PEVA 3RH0A 4F3TA 1WQ1R 3N2ZB 3PXGA 1QH1A 3HP1A 1E9BA 2GBLC 1S2OA 4NFSA 1D8TA 1Y98A 2C04A 1FNDA 2WJZB 4ZCIA 4OA5A 2QIOA 2UDPA 4B6JA 2VTBA 4MWZA 5B2ZA 4BLPA 4N6NA 1VDDA 4MVJM 2VEDA 2HA5A 3HV0A 4ZAVA 1V8FA 5DN6D 4POAA 1SHTX 3A58B 3ON5A 4XLLA 3T1HB 3H1AA 1YDFA 3ZD8A 2DKVA 3SFVA 1Y8ZA 4QOIA 1NZDA 3A6KA 4D41A 3KTOA 5ICMA 2DWQA 4REQA 2QTZA 4IJKA 4ZOEA 5JAOA 5DWDA 3TGWA 3ZWAA 5CDHA 3U0BA 4XDYA 3DL2A 1VPLA 2OFOA 4O4HF 1Z82A 2IQIA 1IIBA 1YDMA 3LKVA 1FRNA 3LX6A 3JYOA 3TLEA 3ZJYA 4KIUA 1KXZA 1ADFA 1R74A 2B7CA 2WMDA 5DTRA 1WNTA 4N65A 5DTMA 2JZMA 4XGQA 4LW8A 3K6KA 2JGFA 3DF9A 3O3MB 3IT3A 1LC0A 4GI5A 2GUGA 3RYCA 2GN0A 1JU3A 1OAOC 3EY4A 5JMOA 2OHJA 5C8YF 3G2PA 4IUCS 4B3FX 3QW4B 4EW1A 3PA8A 4WKBA 2JFVA 3L05A 1KTIA 5FWYA 3R5AA 4LDPA 3CZRA 3HJFA 1XP8A 2Z95A 3WBJA 4JFAA 3WDKA 1ZJZA 2C2XA 2C0CA 4RTNA 1DO2A 4WNYA 3PHIA 2Q0QA 1EQAA 1BXGB 3A27A 2PR2A 4L9MA 1XZDA 4BGUA 4XUCA 4EI8A 3IP7A 5IDXA 1NVMB 3QKRB 1N7JA 4KLAA 1S4MA 4IOJA 2YMMA 3LT1A 1QGOA 5IG2A 4OH7A 4LF7B 3K16A 2OP0A 3FDIA 2PQMA 4LJLA 2QRVB 4M7OA 3P2MA 3DZJA 4OGLA 3T4EA 1AKVA 2ZJ4A 3IVMA 5FO0A 2Z98A 1U8ZA 2Q21A 3BTSA 2H9YA 3CH7A 2H5IA 3PXBA 2C9DA 2V9ZA 4DIFA 1NC1A 3L8GA 3JQQA 4QSHA 1BKYA 4DCJA 5TEVA 1R15A 2HPHA 3OC0A 3TCKA 1SQ5A 3JD2A 4ND3A 4MP3A 3ZK7A 4MA5A 1OFHA 2GMWA 5LMNB 1URPA 2PH7A 1G8FA 3HBNA 2AGVA 1YR2A 3RTBA 3GYGA 4S05A 1YACA 1I7LA 2NO9A 3DOUA 1AUVA 3W2EA 1SBTA 3W06A 1GL6A 5AKLA 3CWCA 3ZUGA 3ZGZA 2AOXA 2DWPA 2LR0A 1ZUHA 2X3YA 4HGPA 4CI9A 1BX0A 3IBYA 3PT9A 3FWNA 2QM7A 2FEOA 4L3WA 4OXRA 2G7MC 4YRLA 2X0KA 3NOQA 4I4CA 1BH6A 1ZM2A 1JEAA 3BFXA 2CL5A 3C4VA 3KQSA 1Z5PA 4XIJA 1LZLA 4KRYA 5DK6A 1Q91A 1Z6YA 1X80B 4BZPA 1RAGA 1CS4C 1OWLA 2VSYA 2ZSKA 4UVHA 5HR5A 4RNDB 4MUMA 1QHHA 2MR6A 3N70A 2CNDA 4FYKA 1USKA 4RK5A 1ZAYA 2V7QD 4BO1A 4EUFA 4MQFB 4WLUA 5ICCA 1U8AA 3AHHA 1UOEA 1WV1A 2F67A 2WICA 3K1YA 3DC7A 4V0NA 1SKMA 1TL7C 2XE8A 4HH0A 4PSDA 1WKCA 2EF0A 3LLSA 3LT2A 4Q4DA 2WTBA 1I2MA 3EVZA 4OQZA 4V2UA 2G5CA 1YJCA 4PYNA 3UMSA 3EEOA 1ZCBA 1KH1A 3HJTA 3SJBA 2ZBDA 4U5QA 3RVBA 3DQZA 4CN9A 4FYHA 4W1SA 4DCPA 1T4BA 2HZ7A 2J4DA 2HCBA 2ONCA 1BMFA 1F6BA 1Z26A 3PQ4A 1SWWA 2H31A 4LISA 1VE9A 2W6IA 2YHIA 2QTNA 3EOBI 4FBGA 2RHTA 4RFSB 3C3EA 2IU6A 3C6MA 5DT2A 3SMVA 3AP2A 1VA5A 4V03A 2WV9A 4C2AA 3GLVA 3GGPA 4GVXA 1UINA 3GRVA 1GNSA 2VP9A 4B6RA 4AKHA 1PD1A 3LCRA 4D82A 3Q11A 5JS2A 1QIIA 4RXUA 3QUCA 5IKXA 4ZRNA 1T8TA 4QVIA 4XDHA 4EX6A 5FUYA 2JA2A 2VHXA 3VDXA 1YQ9A 4E22A 3FVQA 2X23A 2XA2A 3UXEA 4DZTA 1ZOIA 2D5BA 1GCGA 5JTUA 1YB1A 1EVYA 3NWEA 1W19A 3KR2A 4NLLA 3VZBA 4D4IA 3TSWA 2GHRA 3QFSA 1OX6A 4MMZB 4XGRA 2YW9A 5JFTA 1UKZA 1XVVA 5FI3A 3LQ2A 4C5CA 2PLNA 1WGTA 4RK1A 4RAOA 1XAGA 2IIQA 4PIMA 4D7AA 1J33A 5KAPA 3G82C 4RULA 2Q4DA 3NHMA 2IHBA 1IUNA 2GH1A 5ALFA 1YHYA 5D84A 1ID1A 4UFPA 3I4FA 5FBKA 1VMIA 3F2IA 1SD1A 5JNTA 3U4DA 8ABPA 3IJ5A 1VI2A 3QBEA 4ZT4A 4A8JA 3P7MA 1HFKA 1TVKB 2X1LA 3V8RA 2ZKLA 4W5RA 3WYBA 5A3RA 3NV9A 2JAXA 3O8QA 2E0IA 4D9FA 4GI2A 1Z6PA 3L6DA 5HIMA 4M8SA 1R9JA 1AKRA 1LY1A 3KELA 5J1TB 3KUKA 5P8WA 3NIDB 2ZW9A 3OU6A 4OMDA 2V7EA 2SKCA 2BFOA 2IZ0A 3CZPA 1ECBA 1TQ4A 1YJ8A 2XNSA 3NM5A 3OUUA 3NGMA 4JHLA 4RVGA 3RLIA 3OJFA 3JU3A 3HJBA 3BJZA 3IUBA 3B53X 3LBYA 4I9GA 3IA7A 2ZRHA 3EXFA 4IBOA 5BW5A 4XLTA 1TQDA 4ESVA 9ABPA 1NYRA 4P31A 3HJRA 3IJRA 4RANA 1PT5A 1AHNA 1AKUA 2QRPA 3O4GA 4LCBA 5EEGA 1GA4A 4CTKA 1VCOA 1H0HA 1W1UA 2A30A 4Y2TA 4N7JA 1Y34E 1BE0A 1PJ4A 1U8TA 4NS4A 3KR1A 4NU0A 2GA9A 1O87A 4ES6A 2TMDA 5EJ8A 5EKDA 3S1SA 4LSZA 2EBFX 4D9JA 2NU4I 2OUIA 3GMSA 3H16A 4Q9LA 1E9VA 1OMOA 3QSGA 4L28A 3KZ1E 5IARA 2ELIA 1DBQA 4Q3CA 2XOKD 4K9KA 2NUTA 3ZHXA 4DOMA 5ALRA 2WE7A 2C00A 3THXB 1C4WA 2J5BA 1RR6A 1CRQA 4I5EA 2W6JD 1YRLA 4PAOA 4FJ1A 4BVKA 1V4VA 3GEPA 4HGUA 4O4LF 1FLDA 3GEIA 1B1CA 1FXWF 1LX7A 1PFYA 2XB8A 1HE5A 1ZWKA 3K31A 4TLEA 4UUOA 3M6VA 5D86A 5CITA 3FHLA 4CM1A 3FOFC 2N1BA 1V2GA 3OQIB 2OVFA 4Z2YA 1YB6A 2GA8A 3CNHA 5AJTA 4AZ0B 3AVQA 4ZREA 5K45A 4DMFA 3OD5A 3UOAB 1F8FA 3E03A 5F7XA 2J45A 2C8KA 3CVUA 1FDIA 2DRIA 2ZLBA 3NEAA 1QH0A 2BDUA 3I12A 4O2BF 3D1VA 4A2QA 4ZEOA 5K0ZA 3Q8KA 3DLIA 2FJPA 4N48A 4DJ5X 1G20B 3ZLVA 4EY7A 2CXPA 4LN1A 3VKWA 4RTPA 4I55F 1JJBA 3EQ8A 3TRDA 5KUTA 4CWAA 4MEAA 3H2SA 4OM8A 2ZBUA 1ECLA 1P29A 5HW0A 4ZQCB 1L3IA 3VPCA 1SG6A 1V5FA 4M37A 5EXXA 1FFCA 2QJRA 1CVRA 1NNLA 2YVAA 3A11A 3JATB 4RJJA 4C3OB 3BL6A 4C4AA 4CM4B 3CXUA 3AVWA 3Q7RA 4KQHA 3PICA 3ANNA 3ZWYA 4YI5A 4F8YA 3K9WA 2ZRNA 4Y8VA 1RACA 3VM6A 3HNPA 3FROA 5DCWA 1Y1SA 2ERCA 1USGA 3THYB 2DBZA 1YTLA 3AG6A 5HBGA 5KU7A 1E2JA 3VHXB 3I83A 1PV1A 4D6YA 1E7WA 2D0IA 4DILA 3PRJA 5A4FS 1KI8A 2VP6A 2ZUUA 4WKGA 3TLMA 4HJRA 5HKKD 5K51A 2VOEA 2FPPA 1MH9A 4IMPA 4ANFA 2SCUA 5BQFA 4HLQB 4Q7MB 4Y6PA 3HLTA 4IDAA 1BCSA 1G2OA 4EB3A 5ARDA 2EBUA 3BT7A 5AI4A 1BTOA 5JCJA 2BFNA 5F2EA 3UWOA 4G0NA 1U3VA 3L0CA 1N2CB 1W88B 1CG6A 1KVTA 2DG2A 2GZ2A 1NN1A 1AN1I 3I6QA 3JQ8B 5CVJA 4Z1MD 3CN9A 4ER7A 4QGGA 1DLJA 2ZWVA 3C5WP 3IKMB 4MB6A 5AESA 5DLQC 1A3CA 2P35A 1Z15A 3I37X 5K6TA 2O5EA 3OFVA 2O8EA 2QLBA 1GA1A 4PLTA 3WBFA 1RBQA 4FJ0A 2JFXA 1OBHA 4TV9B 3DMDA 1G6HA 3U37A 3VOBA 4K6CA 4MV1A 4OCZA 2XWSA 4OUDB 3GPLA 1W0JD 1KAHA 3OCZA 3BXZA 5LPNA 4OU5A 4J1QA 3NIBA 4C3UA 3EPJA 3FKSA 1RXSA 1OBFO 4X0EA 2ZIXB 1MJ9A 2ZZKA 4B3HA 4NV3A 3LG2A 4O29A 2BUAA 1GGHA 1L5HB 4GQAA 4WH0A 3N8GA 1PW7A 1LKZA 2IA5A 4H4CA 5CCEA 1Z5UA 1ZITA 4ZO8A 5FKJA 1CUJA 2N1AB 4E5YA 1I6LA 2A7QA 2GPAA 5D2CA 5A4DA 1FJGB 2LD4A 2X2FA 2XRYA 2YYSA 3HMKA 1PO7A 2F1IA 1D1SA 4HWTA 5H5JA 3RVNA 2ZTSA 4HNQA 4WDRA 2A1IA 3MTQA 2MIIA 4RDIA 1T0BA 5DAEA 3H84A 3ZX5A 4ERXA 2WFMA 1KEEA 2HU5A 4L95C 5H9VA 2B1JA 3GGSA 1GG8A 3EAGA 4EGJA 4URYR 1X1CA 4AJOA 4RKQA 3LBNA 3KUDA 2Z6VA 3RE1A 5C4IA 1HFWA 4NBKA 3AKEA 1O95C 1JSXA 2ZXEA 2QX8A 2C5HA 3B8HA 4G1EB 4G41A 1TJ3A 2FMXA 5EUCA 4ARZA 1RAHA 4IEEA 3RVPA 1F1BA 3RDPA 5KVSA 1ODKA 2IOHA 4PBRA 1U0EA 5IZCA 3ETDA 2SGQI 4IUBS 4TWIA 3DNPA 3PQ5A 3IKTA 1JG4A 1XWFA 1ZEMA 1VM6A 4G81A 4OL0A 1X7HA 4JQYA 4FVTA 5IMSA 1V5GA 4H3KB 4WESA 4IFBA 1OIXA 2E18A 1CNFA 3HKCB 1QQBA 2NVWA 2CV1A 1OMTA 2BD0A 2ZE6A 2RGUA 3AZPA 1NRXA 3OCVA 3UQZA 2YDXA 2EDCA 2OHFA 3SSMA 1T5TA 4EHKA 4RPKA 2IYPA 1N5IA 3ITDA 2PY6A 1Y6QA 2CZCA 4R1NA 5AYVA 3ZWMA 1ULZA 1A9ZA 1UJNA 3WNCA 4BB5A 3TWOA 1Q3TA 4BRSA 4RKYA 2X40A 4BQSA 5IANA 1CBUA 4JLJA 1XDWA 1T6NA 5CPFA 4WBXC 1OU4A 3U6KA 1NXPA 1RYMA 3HZHA 3ZBTA 3E9EA 3EXIA 5JQGF 1N2HA 4I5IA 4DHEA 2F48A 3QFCA 4MVJP 4C7BA 3CKYA 4LOKA 2RIPA 3H5NA 5HZHA 5EIFA 4II7A 3PPYA 4HLCA 2YR0A 5EFZA 3BWYA 4M36A 1DCTA 4FFNA 5LQKA 2AFRA 1VP9A 3ASUA 1WB4A 4HDKA 1L5LA 4LHWA 5EP3A 3T7DA 3LW8A 4KXWA 1YR7A 4TKVB 4P08A 2NZYA 3RSZA 1E4VA 5CX1B 1AUXA 2WIAA 2J0VA 1MA3A 4H27A 4R7ZA 1P77A 4GKBA 3SZRA 3VOAA 1UMDA 2OCKA 4OSPA 1IM8A 3RC1A 3C41J 2ZBGA 4NH4A 1YJXA 2RGBA 1DRVA 2FPOA 1ORTA 1R88A 2E5WA 1YDEA 3LPMA 1SUIA 3FYTA 3G3EA 4L7QA 2QTFA 4DJJA 4D6XA 2VQFB 3GFTA 1GLGA 1GTZA 1QH1B 2A14A 3I05A 3LUFA 1CY0A 3VC7A 4PG6A 1TCVA 4FMCB 4HPJB 1KBFA 1SC1A 3PX3A 3PTAA 2VTBB 4IMIB 3J81A 1YR6A 4KAFA 1T4GA 1KS9A 1T2CA 4OHKA 3P4XA 4YPOA 2F3RA 2PRJA 4MWGA 5ER9A 3CA8A 4CKEA 4D99A 5J4VA 3LLMA 1IWOA 4FYPA 4TWAA 1XTUA 2WNSA 3B9RA 3CVXA 3R3XA 2OV3A 1NI5A 2B5VA 1BYIA 2BI7A 3U4QA 3EODA 3HN7A 4TOIA 1BQ3A 1LX6A 3LH5A 4NPHA 3FDZB 2Y92A 4REQB 2QAIA 3ZIAA 2NV0A 1APBA 3OXGA 4GT1A 3UMMA 1EXMA 2B8NA 2EEPA 3ICQB 2IY7A 3C8ZA 3OA2A 2QTMA 1KMHA 6Q21A 4P93A 2XQVA 4H7EA 1RIIA 5C52B 2FX3A 3B2QA 2PSSA 3D1JA 3KZNA 4W82A 4WPGA 4XX0A 3ZWBA 3RS2A 2Q3JA 2BRUA 3VOSA 1EJ2A 3L7KA 5BOSA 2ZSIA 1T4MA 4DSUA 3CNOA 4YT2A 1THGA 3BOSA 1YZKA 4RQUA 3B3AA 2VDWA 3H11A 3WHKA 3RYCB 3EULA 1LU9A 3ZKAA 4OBBA 1Q1AA 3K6RA 3QAHA 1H2AS 2VYND 5CW2A 5FWYB 1CSOI 4XQCA 2CLOB 1P39A 1OH7A 3T34A 4B6PA 2GEDA 4FW9A 1UDBA 2C4MA 1B8NA 2ZQYA 5CM2Z 1OTYA 5JJIA 5JNVA 3E1KA 3V4PB 4MROA 2XUOA 4M8LA 4TYWA 4XOIA 4D8VA 4JA2A 4LYEA 2WJHA 4MVWA 4IHJA 2Q9CA 1MU0A 4IDGA 4RACA 1QYWA 3HTXA 2UU9B 5ED0A 5LP6C 4MP6A 1R0RE 1KI9A 3KZVA 5E2IA 3VBEA 2WJVA 1LPNA 3WZ2A 2CJYA 3DGEC 4FN4A 3TX2A 5KU1A 1U8YA 1JTEA 2O2ZA 1G7CA 3KOUA 4CMCA 4AUMA 3K8OE 3VR6H 2NUAA 4X61A 3VPSA 4ZV9A 4YH1A 1XGKA 3DEFA 4OA8A 4RA9A 4RCZA 3O8BA 4XYBA 2F8TA 3CW9A 3MEQA 3PF8A 1G41A 3QP9A 3DZFA 2F3CI 4BVGA 1SU8A 2I2DA 3HA3A 4MRAA 5IC6A 1R6XA 4R9NA 3TLJA 1VHLA 1T9KA 2H4WA 3I30X 2IEDA 4FIZA 2ZIFA 2XQIA 3TSZA 1G2QA 2JEYA 2EL9A 2P41A 3G13A 4LYYA 3RBAA 4MWSA 1O97C 2ADMA 2OBNA 2EV9A 3ZWXA 4YXFA 1FMJA 1KEPA 2YHBA 5DU2A 2B2XA 4KWTA 2Y2UA 4UBLA 2B0CA 4EKEA 2OCLA 4YMLA 2M6SA 2QUAA 3P5BA 3TNJA 4IZIA 4E5SA 3SQWA 4C03A 1T15A 5AW6A 4JX8A 1QFXA 5I9MA 2PT5A 4BNKA 3TRIA 4X7MA 2N3ZA 5HE9A 5LKAA 5JALA 4QZVA 1TO6A 1P72A 4MPTA 2FI1A 5ALKA 5F64A 4B44A 1WLYA 3S8EA 1T5BA 1QHHB 5CCLA 3LECA 5JY6A 4QAJA 4L2IA 1SK8A 4G1MB 4NQZA 3F6CA 1SPBS 5DTIA 4HNGA 3H97A 4U0KA 5T57A 2F3PA 3FG9A 2CVOA 3P9PA 4I1OA 5AI6A 3T6KA 3ILXA 4OKSA 3M1AA 2F1RA 2HQRA 3DBIA 2Z08A 3A7EA 4PLVA 4Y2XA 4R2HA 4UD2A 3V2UA 3I2FA 1GGNA 3KS9A 2IF2A 4GPBA 3GNLA 1XZNA 1KGSA 2ONKA 4ON9A 2RH8A 4JKYA 3PC3A 3IV9A 1YHNA 5JAHA 1JBEA 1FARA 1HDGO 2H5EA 5JXHA 3G88A 1ZVMA 4R2LA 1CT4I 3WIOA 2QZJA 2YS6A 4QJIA 4J2HA 1RRGA 4TKLA 4AZWA 1UDWA 2CNNA 4PFJA 3VR1A 3P32A 2B25A 1J97A 2O1WA 1Z63A 3IODA 4JLWA 3I8OA 2X86A 4KR3A 2GESA 4TTVA 1JE1A 4MV8A 1W9HA 3R09A 5AVRA 1ODJA 3DTTA 2Z3VA 3QENA 3GJXC 3K1ZA 1Y7TA 3NM4A 2OAEA 3NHWA 3T4XA 4DSTA 5JSUA 5GINE 3PXCX 2MTBA 1SHKA 5TSDA 3C97A 1FTSA 1QGUA 3IPCA 2PT6A 1VG0B 2CLKB 4BN0A 4M9SA 1IBRA 3FWYA 2KB0A 1Z28A 1R18A 2Q62A 1N6PA 3IAS1 2Q1WA 3N0XA 1F20A 1N5OX 1Z5VA 3R5XA 3WIDA 4K6KA 1RQGA 2FCRA 3FWZA 3QE2A 3AOGA 3F3KA 2NU8A 2Y6VA 1Q57A 3GFOA 4Z3KA 1TAGA 3V80A 4EAQA 2GBPA 5A0VA 1XNHA 2QTAA 1MNAA 1Z7BA 1NA5A 5CVUA 3D6FA 3JX9A 3A2KA 4GI3A 1GAXA 1GUZA 3GMIA 4LRTB 3GH3A 3DKIA 2C4KA 3FZEA 1M34E 5DWVA 3DXXA 5IXJA 3RI3A 1PNVA 1NQOA 5C8XA 2XGJA 2JCGA 3T95A 1DS6A 4PPGA 1QLWA 3I2HA 1SVOA 3A0UA 1NBME 3BFJA 3RUHA 3O8QB 3FFWA 1YI8A 3LSYA 2G82A 4WVFA 3G79A 2PH3A 2QRJA 3WWDA 4F38A 4C7OB 5ALTA 4MV0A 2QE6A 1SBCA 3EZGA 1HGXA 2JVIA 3K92A 2OM6A 1CUYA 3NTVA 3NAZA 1Y7LA 4CODB 3EXFB 4AKIA 3NBMA 3U5ZB 3E7XA 2C8JA 2ZE8A 2RAFA 4GAEA 3TIGA 3R23A 4JVMA 2Q2NA 4CKBA 3I1FA 3M83A 1U0NA 2I3ZA 2VBIA 2P78A 1EE1A 3ITEA 3NRCA 4H7HA 4JAVC 2HJRA 3GJRA 5D7BA 3WRXA 4XSHA 4AK9A 4Z6KA 2ALJA 4WUVA 2NO4A 3PC4A 2P4EA 2WJJA 1FYBA 4HL6A 3NDPA 1DJMA 4BNLA 5JAPA 1N2JA 1EFTA 3O4FA 4HOYA 4J0FA 3WNDA 1WUKS 1MHTA 3UOEA 2ES4A 1XRMA 3FYDA 2XUGA 3LP5A 2PJUA 1WXEA 3B70A 4J0DA 4KI7A 3AZQA 1OH8A 3QKSA 2JFBA 5I5GA 4S12A 2D4HA 1E3TA 4IS2A 5TQ0A 3WRYA 2QQEA 1GPUA 2GK7A 1K6EA 3AM5A 4HRXA 5TEWA 3EVTA 4BMXA 4IDEA 4D3DA 2JHCA 3ZKWA 1KJ8A 4RH3A 4Y1RA 1QRUA 3V97A 3WKAA 5FL3A 2Q45A 1PQYA 3GZTB 2GNPA 2PFSA 3M89A 1ZK3A 3Q5DA 4NZ9A 4UZFA 4QEZA 1OCEA 5COQA 4AJHA 3D4BA 4Q3DA 5FNZA 1IB6A 4ZVQA 2V5VA 5I51A 4AS2A 2O0KA 3EWNA 3PKJA 4WN9A 5B6JA 3KT8A 2WVHA 5TT0A 3QFHA 1NZFA 1YIAA 3DDWA 5C3UA 1VKNA 5JATA 2A4KA 3TR5A 2GM5A 3WQHA 1LDEA 2NZJA 3V4ZA 4CQMA 1JLKA 1A2BA 5JADA 1N0VC 1XUOA 2ODEA 1VL8A 3G7SA 5E9WA 4BGDA 3UFXA 1TZ2A 5EJGA 3RK0A 4TXJA 1L5NA 2FN9A 3NV7A 2M98A 2YN0A 4AY4A 4BE7B 5KOJA 3FC3A 5BNTA 1OZHA 2H1IA 4JWKA 3NEYA 3STTA 2JJ2D 1BE8A 3EZ7A 3RHZA 1C4KA 3UVEA 1BGVA 5BNIA 3ZZTA 4FW8A 2RHDA 3GZJA 5GV8A 4L75A 4M89A 3GFBA 3N87A 3WI7A 2HI0A 4M6WA 2PFKA 4CQLA 3MJTA 4P7GA 4J9UE 1INLA 4LI3X 4Y3UA 3KUUA 4AMZA 2FPPB 3UAZA 4PU0A 3I6IA 2SCUB 5F21A 1G16A 1KZGB 4X41A 5G40A 4MGKR 3ZGVA 3QPWA 2NU9B 3L7LA 4Y1GA 1BCSB 1T1GA 4MX8A 1TBQR 3TG8A 4HATA 4NJEA 5EYPA 3C87A 4AFNA 4LUCA 4IDCA 4IEFB 2XMGA 1OD6A 5BWBA 2E4AA 3TFOA 3AI1A 1VSUA 1JZSA 3LQQA 3TH5A 2D0OB 4CGZA 4LWPA 2HF2A 4CMIA 1GDHA 1K8YB 1MH1A 2NSHA 2JFFA 4L4YA 2O8EB 3E9RA 4G1VA 1Y1KE 1PNQA 3PXEA 4RABA 1H66A 2GKRI 1WZNA 2FEMA 3PC2A 4D4JA 1E5QA 1KR2A 1ZX1A 2IOFA 2WZBA 2Z2XA 1AG9A 1DAGA 1EWKA 1GWNA 2BHTA 2HV9A 2ZRPA 3D4OA 3DCYA 3FCSB 2CFSA 1R0LA 1PZEA 3HNOA 5K6AA 3VH4A 3CLKA 4Y2QA 3EGXB 1D6NA 1P2VA 4C21A 2ZJ5A 4DMMA 5BORA 4K9LA 3LC7O 4D56A 1FDWA 4O33A 1L5RA 2C61A 3VR4A 4XTRA 1RP7A 5JI3E 2YDYA 3ELUA 2R6ZA 3RBVA 4UXHA 4A2PA 2OV1A 1EGAA 3BAZA 4MR7B 1H1DA 2IDMA 3WK4A 2WIBA 3ZLUA 1DAHA 4MVJH 4ZAYA 1P61B 2E85A 3DKPA 1W3SA 4UHFA 4F5EA 3LDGA 4WZZA 4PXSA 5KVCA 5LQAA 2QUHA 2X0NA 1V48A 4IHQA 5JECA 5CFMA 3F7OA 3FA2A 2KCXA 3W9BA 1KEEB 1TQHA 2AJLI 3DFUA 1ZK1A 2EKZA 3C7DB 3NTRA 1RHKA 4NF2A 4P34A 5A0FA 1QLJA 2ACVA 1ISFA 1JT2A 3MM4A 2GZDA 3CU5A 1A77A 4YDHB 3FWPA 4TL9A 1M0WA 1Y6FA 1XPRA 2XV1A 4WOPA 1UJ4A 5AM4A 2V55B 4ARZB 2B7LA 4LHEA 2QRHA 3C5EA 1C0EA 1ZD2P 4PWYA 1TU3A 4UHHA 4UVIA 3VPDA 4BWVA 1IOLA 1CJVC 3DOCA 3EVNA 3HYTA 2LCQA 1A1SA 2IUSA 2Y0BA 3IJEB 4A15A 2Z6AA 2Q5IA 3AHJA 3BZUA 3V7FA 4DLZA 1A4UA 1DL5A 4RZXA 2E4YA 3PPXA 2B20A 1XMJA 4WESB 5IT5A 2P11A 4YRNA 7ABPA 3OF3A 3OZUA 1EK2A 3STUA 3SM9A 1XZGA 3C5CA 2GNAA 2N71A 3L06A 2IE0A 3ZXUB 4FTWA 1POXA 2C1ZA 4AZVA 3LDAA 1JHUA 3F7TA 1QRRA 3B82A 3LW7A 4E09A 3A6EA 4R1TA 1E60A 1L5QA 1U0TA 2JIZA 4JIMA 4OXKA 4B74A 4P22A 3BSWA 3C1UA 3QXCA 1BUSA 3BD7A 3CF0A 2JRCA 4W7HA 2SBTA 4P53A 3EXIB 1F8XA 4DV0B 1V7PC 2JFZA 2FQQA 1ZNQO 2X22A 4DCVA 1U0LA 1V3TA 4MICA 4QOHA 5D3MA 3W1EA 1JDTA 1GKIA 1SXJC 4TVBA 3CLRC 1Z7GA 3NHUA 4B82A 5B3JC 1CP2A 1R27A 3O1IC 1KL7A 4DQDA 4CVNA 4YRDA 5FNVF 2MSEB 2LXNA 5B7NA 1Z4NA 3NX4A 3T9EA 5AD1A 5D7NA 3ME5A 3TTXA 4G0WA 3KWLA 4DUGD 5KVQA 1YIOA 1OVGA 2INGX 5IXSA 4JI2B 1NT4A 2EYUA 2PZAA 4FHDA 4FR2A 4KXNA 3JD0A 3B3QA 1D2MA 2B5WA 1F06A 1UMDB 4X20A 1FMTA 5T6BA 1I3OA 3F46A 2QRKA 2O48X 3G0HA 3K9HA 4ALNA 4DDUA 4PN3A 4K1LA 3EEQA 3O0DA 1T0HB 2ODQA 5EC8A 4D4KA 4UBKA 5E9QA 3W78A 1G7SA 1Y7IA 2DQ4A 4OHPA 1D07A 5KYUA 4YRTA 2HA7A 1IHUA 5JD6A 1FXUA 1TFRA 2HJVA 5BY2A 4C22A 2EJTA 3QQ5A 1X3LA 2GFIA 2Q5EA 4XRRA 4IX1A 2W90A 4P0TA 5ERGB 4AJNA 4ZKEA 4CKEB 2IDKA 2ZIEA 4MGHA 5LKRA 1DJPA 1QKKA 5ALOA 1L6RA 2H3EA 5HWSA 2W4QA 1SHJA 4RV5A 3VJMA 2GWRA 5JUWA 1T5OA 2RAPA 5K3CA 3U4QB 3TD2A 1NW3A 2QB5A 2PVSA 4PSUA 3IOYA 3KKEA 1DXYA 4MUGA 5HI7A 1FTGA 2IHKA 3ZI7A 4F60A 4Q93A 2L2QA 4W5WA 3WWYA 2BY4A 1CPYA 2OV4A 4BFVA 4KNYA 1UMCA 4EG8A 4N8DA 3N7AA 1KMHB 1AF4A 4NFYA 121PA 1PJSA 1ZO8A 4MS1B 4XX0B 2HN9A 4QX6A 5GOZA 3CF4A 3DV0A 1KORA 4EBBA 1X19A 2CDBA 3COZA 2LIVA 3NGLA 3U3XA 1J39A 1J7KA 5CT8A 1EIZA 1Z06A 3WMGA 3LS2A 1UCFA 4CM9D 5BOSB 3OHMA 1AO0A 3PEWA 2PA0A 2PGIA 3R8FA 1NMXA 2VDWB 3H11B 3G2KA 1I33A 2QYSA 4XWKA 4TTIA 2ZYWX 3WLNA 4GUDA 4ZCSA 2AN3A 2FMUA 1LVUA 4GXQA 4KN5A 4OM7A 4RORA 2JVJA 1MJGA 3K20A 4D8WA 2QHXA 3O90A 4ZOLF 4F84A 1U9CA 3KPVA 5A9RA 4X65B 2BR4A 3PE4A 2QG4A 4JLUA 2BHNA 3CZ4A 1DJOA 2FQYA 3IMEA 4B3SB 1OGIA 1V9CA 3FLEA 1RCFA 2OAP1 3DV9A 3FVVA 4BV3A 1RYHA 5IM4F 1SCAA 1U1DA 2OBBA 2C4WA 3PVZA 2R7KA 4V0LA 1KHHA 4IHJB 4CEIA 1O4WA 3L0ZA 4ID3A 5DX0A 4UVDA 1FFAA 5KQLA 1VOTA 4MS4A 2Y71A 4XJTA 1O8BA 1E9DA 1PAUA 1XTPA 1E2KA 1IJEA 1JP7A 2R8XA 4MV9A 3IUPA 4FEAA 4BXOA 4ZJPA 3GJSA 5D51S 1PR0A 3P4YA 2YZNA 4QXOA 3KEQA 1YB2A 5TC4A 4FHFA 2Y1DA 4RA9B 2G9UA 2PS1A 3E3AA 5LQCA 5JHHB 2LE0A 1FS5A 3L9XA 5HP4A 3ZLJA 2R1VA 3KKMA 1T2DA 2HSJA 4NWIA 3Q85A 4FEGA 2GZMA 4WJKB 1DG1G 5G1NA 2VLIA 4C20A 1L5YA 4YUAA 1K5DA 4Q7EA 5JFGA 1D2GA 1BKSB 4XA8A 5C0OE 4B5KA 1HLPA 4DM7A 3OLCX 1KY2A 1KVUA 2QEQA 3O95A 3AUAA 4UAVA 2AUNA 5C4GB 4A8HA 5BPHA