2UZ3A

Crystal structure of thymidine kinase with dttp from u. urealyticum
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
207
structure length
190
Chain Sequence
IGWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKISVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIKFFKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Thymidine Kinase 1 of Human and Mycoplasmic Origin
pubmed doi rcsb
source organism Ureaplasma urealyticum
molecule tags Transferase
molecule keywords THYMIDINE KINASE
total genus 51
structure length 190
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2uz3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2uz3A01
1LB1B 1CIPA 4G3XA 4NCHA 2R8RA 1G3RA 2ZI4A 3JVVA 5FPTA 2VQSA 1TQDA 3RAPR 1LF5A 1N6IA 1DVRA 1ZD9A 1OHHA 2VP0A 2CLCX 3K09C 5J40A 1CF4A 2JDIA 2CE2X 2IYXA 2RGBA 1E9FA 3D8BA 1TF2A 2E1RA 2ORVA 4H1VA 5JJKA 2PL3A 5FOXA 4KAXA 1S3GA 1WQ1R 4PSKA 4Q7JB 3BS4A 4FCVA 3LQQA 4R98A 2J0QA 3T1VA 3SYKA 4KBFA 3MAAC 2VIIA 3GJ8A 4HB3A 2IYQA 1HT1E 1KMQA 3L0PA 2A5YB 2D74A 1HT2E 4ZCLA 3P4XA 3EXAA 1R2QA 1N5IA 2NPIA 1QZXA 4Q01A 4O0MA 4RFVA 1KSGA 2N1BA 1YZNA 2F1JA 4ABYA 1RRFA 1YJ5A 4A82A 2QMUA 1RPZA 4BLSA 1X8KA 1JBKA 4MRNA 3WNCA 3U7FB 2P5SA 1Q20A 3NG1A 2GEVA 3MWKA 1NSFA 1XEXA 1R8QA 4PFSA 4TL9A 2PLRA 1SXJB 1W5SA 2VRWA 3K70B 4WZ6A 1IXZA 2KE5A 4B3GA 4DZZA 1SQ5A 2MMGA 1GNQA 3I32A 1ZNXA 5DI3A 4RZUA 5AWFC 3VR3A 1KO7A 3LV8A 3SDZA 3WP0A 2QTFA 4AY2A 2VSXA 1SKYB 3RHFA 3SZRA 5JJLA 1S9DA 3OEED 5EXPA 3LVRE 4V02A 5CLQA 3QJYA 1KYIA 4KSBA 3EZ6A 5TXGA 1W44A 4C0BA 3U44B 3CX8A 4QGFA 1UF9A 1EWQA 2PX0A 4JZKA 2J0VA 3QKRB 5G41A 3KL4A 2B8WA 3GCGA 4NBSA 1ZM2A 1UM8A 2NO9A 2QN6A 3VNUA 1P62B 4M0LA 2PCLA 1N5JA 3NTUA 4UNNA 2BHRA 2WWHA 1U90A 2R6DA 4FKDA 1ANKA 2VL7A 5JS7A 2Y8EA 4QHSA 4LJ8A 5CJ2A 5TB5A 2FSHA 4XVQA 2ZJ2A 2I1VB 1KK1A 2DB6A 4KVGA 2XITA 1ZM4A 3K09A 3FTQA 3GD7A 2A7QA 4JIMA 3VR5A 2GZHA 5SZKB 2EWVA 2F3RA 1Y8FA 1KOFA 3U61B 4KFSA 4CT5A 4IVQA 4DDUA 2OZEA 2G0TA 4XD7D 5FPYA 2XGJA 1L4YA 2RB4A 3DM5A 1W36B 1ZC3A 3B8HA 1E2HA 1KO5A 3GEIA 4DDTA 4BFVA 3ADDA 2CDNA 2HCJB 2HJVA 1EX7A 4TMTA 1MABA 1G7RA 2O5VA 3RS0A 4E03A 4JLOA 1SZPA 1Z5ZA 2QMEA 3KKPA 3ZIAD 4FMCB 3GLIA 3A1VA 2GJKA 3C14C 1G7CA 3TRFA 1OH7A 4R2IA 5C1BA 5IF9A 3PITA 5IK2A 3LLMA 4ZDJA 2O52A 4TMXA 2QAJA 2OFXA 4RKEA 1VTKA 4GOXA 3QOFA 5JHHB 3W5JA 4JKIA 1MO3A 5A0FA 5FR2A 4B74A 4UNPA 4LI0A 4WOPA 1KK3A 2WMNB 1FMJA 4I81A 3AF3A 2XB4A 4NPHA 1U8ZA 2QTHA 4KFTA 1ZU4A 2GWHA 5EP2A 3BH0A 3SFVA 3U3RA 4ZIRA 4PTLA 3SOPA 2WWYA 5C4MA 3TSWA 2VEDA 1KDPA 1FMLA 2W0SA 5DIFA 4Q9LA 5EXXA 1PV4A 3LAWA 2ODBA 1US8B 4EPXA 2ZI6A 4RFSB 3UEYA 2VHTA 1U2RA 3TLXA 3L8YA 4E09A 3KDSE 3A1TA 3CWQA 2FMXA 4AD8A 6Q21A 2H92A 3K0CC 4CEIA 1NLFA 3I5XA 4URXR 1NF3A 1B23P 2VF7A 2LKDA 1ESMA 4Q48A 4WVFA 3QF7A 1NLZA 4BRUA 4US2R 2OAP1 3PUZA 3H0KA 1DAIA 5CK4A 2YV5A 1J70A 1FAQA 2Z83A 5GVSA 5JFGA 3B9PA 1KIMA 4M1MA 1EX6A 2ZJZA 3AVOA 4NH0A 3FMFA 4L16A 3PEUA 1OKKA 3MLEA 1DAFA 2HXYA 4HDOB 4QL3A 4DC9A 1E4VA 4PPGA 2CLSA 3SE0A 4A15A 4LHXA 2DBYA 3W8NA 2XXAB 5JI2E 5L8VA 5DYGA 3MWLA 4NKRA 2XZOA 1P3JA 4RD1A 1XD9A 2G88A 3IDQA 2CNWA 1MH1A 1OJLA 3IKJA 2C78A 2ZI7A 3P1JA 4UXHA 1RRPA 4HZUA 3A1SA 5J4VA 2YOHA 3UMFA 1XF9A 3EZFA 5JZVA 3RNLA 4TQAA 2YOFA 3K9GA 3Q7PA 2QBYB 1G17A 2ERYA 3HR7A 1Z8FA 2Q21A 3O8RA 2J87A 2R62A 2XNDD 3ADCA 4OI2A 2BVNA 3TUJC 4HAZA 3RSOA 1A2KC 2X8AA 3OESA 5TDHA 3PUVA 2RKOA 1NJFA 2UVQA 2F9MA 2YWFA 1N3BA 3KKMA 3ND9A 1W1WA 2CMKA 3EWAA 4NTZA 1DTSA 4AIIA 4KITB 3AF2A 4M22A 2WTUA 1DG3A 2ZREA 2XAUA 1E99A 4OI4A 3T34A 1R10A 1SVIA 2TMKA 4NCIA 4WIAA 2EU8A 1TF5A 2Z0MA 4JBXA 1VIAA 4PHGA 2WWWA 1ZM9A 4DLRA 2X2FA 3FPAA 3WHKA 3T35A 5TV2A 4AKGA 5E7IA 1VYTA 3DO6A 5AJWA 1QVAA 4NYJR 4OQMA 5IT5A 2FNFX 4TMVA 5JHGB 3K0CA 2Q3MA 1Q22A 4XWKA 4E07A 3RRMA 5J4YA 4KODA 2WMOB 2NZJA 1G21E 1YZUA 4YQFA 3C7KA 3EIEA 3HU2A 2MSEB 1W5TA 3GMTA 4MGKR 3AVVA 2E87A 1YU9A 2JJ1D 3IIMA 4Q21A 3SHWA 1I4DD 2BM0A 2JATA 4AI6A 3GJ5A 2WKQA 1XFAA 3TR0A 5E7MA 2PH1A 3LY5A 3C5CA 1IJFA 1NRJB 3K9NA 2DWOA 5K8IA 4BZQA 1JPJA 2FNAA 1W4AA 4OBEA 3L82B 4GSYA 2QNRA 1V5WA 4D81A 1LS6A 1JJ7A 1XA6A 1OLOA 4TZ0A 4OJQA 2J7KA 4GP7A 1E2KA 2ONJA 3U6KA 4V0NA 1TNDA 4W7SA 3IEVA 1DAMA 1PLJA 3BH7A 1T5LA 3AVPA 4ERNA 1XCMA 2XX3A 1VMAA 3KKNA 1GL7A 4BLQA 3RSLA 2OBNA 2P6NA 4LJ5A 5JCPA 4TZ6A 2GXSA 2ZI5A 2GVZC 4WZBE 4JVLA 1FP7A 1V43A 3B82A 4G1UC 4B3FX 2QPAA 4OQFA 4A8JB 5GADl 3NBFA 4AC9A 1TQ4A 1IXSB 1R5NA 2OHFA 1ZP6A 2YYZA 4LHZA 4Q7MB 1NY5A 3AV0B 2CCKA 3MCAA 3UIEA 3A8TA 1G6OA 2XEXA 1II8B 1Z2CA 2EQBA 2REOA 4CEJB 1G64A 2OBMA 4LYJA 4Q1AA 1NVUQ 1FTNA 5SZJA 3RS5A 2V4ZA 1GKUB 4LV6A 5AK0A 4HDQB 4B32A 3R9XA 1TX4B 1MOZA 2O8BB 3K0AB 5LBIA 4Q4JA 5KPDA 4Z1MA 4BFYA 3ZYCA 1NVVQ 3ICEA 2V1XA 3LH5A 1X8LA 3H86A 3THXA 1XTQA 4KLNA 5BN4A 3M6AA 4JVNA 4PAQA 2JCSA 3R9WA 4IDPA 3PVSA 2R9VA 3B2EA 5CM8B 4FD2A 1E2NA 3R7WB 2OLJA 1NKTA 1CJTC 1CS4C 4PR0A 4B75A 3T5DA 3DMNA 3L0OA 3Q9LA 3WNDA 1G3IA 4YMUA 1AKYA 1SVOA 3S1AA 5KNBA 2QZ4A 3PEYA 3W90A 4PHTA 2JAQA 2Z5FA 1IAQA 3IIKA 3LBHA 3O47A 3DZ8A 4Q9HA 2AK2A 5EJEA 5CYPA 4G5OA 1J90A 2YUUA 4C3ZA 2H5EA 1E9RA 2WWGA 1KZ7B 3MMPA 1XCGB 3NC1C 2J0UB 1E9AA 4F4IA 4V0OA 3U4QB 3SJZA 2YKGA 1GWNA 5CLLA 2ELIA 4Q9IA 2F6RA 2VP2A 5GVRA 1KI7A 4LPKA 3PEVA 4JJKA 2G77B 4JL5A 5FUYA 2H7VA 2VA8A 4M21A 3ASZA 4DLVA 1YRBA 4O2RA 4DUGD 3FKSA 3ONWA 1LTQA 2ONKA 1YQTA 2VHCA 2XJ4A 4KI0A 2K5UA 3VNVA 2BIFA 2WOOA 3CM0A 4LYFA 1E4YA 1P75A 1T4GA 4YDHB 4PZLA 3QXSA 2ZRFA 4NCNA 1K6MA 1W0JD 1HY3A 1X3SA 4KV9A 4Q5IA 4GNKA 4M1SA 4C9BA 1OXVA 2VP6A 3WNBA 1QHXA 3LX8A 1KBEA 4DEXA 1XJCA 3CRW1 5L3SA 1XJ0A 1ZCAA 1R6BX 3FFAA 4QC2A 5FTJA 3SQWA 3TUIC 1KDTA 2GDJA 4X8LA 3ZS9A 5E3HA 3PJRA 1PVOA 3LX5A 2C77A 2ZU6A 3PUXA 1FNNA 2GRJA 4IDQA 4M2LA 3U6BA 3K0SA 4BE7B 1OFUX 4TTPA 3W3ZB 3TGPA 2D4HA 2IS1A 1NMZA 2QG6A 2ASEA 2FG5A 2D2FA 3KFVA 2OCBA 5EZ5A 1JJVA 1XU4A 2GZDA 2O0HA 1W47A 4M9QA 2Q0HA 1NJGA 4DDVA 3L2OB 3B60A 5H1YA 3VHXA 1Q1QA 2VLIA 4M4SA 3VR6A 1TAGA 3CX6A 4EJSA 2JJ2D 3V4FA 3X1WA 3ZH9B 3MJHA 2QM8A 4RY2A 1R0WA 1J8YF 3QF4A 4Q1DA 4Z54A 1HYQA 2ZYVX 3FWYA 1F60A 1T3LA 4MKGA 2VPPA 1P73A 4WXPA 1CEEA 4FI3C 4EQ6B 1GITA 2Q9BA 2ATXA 2QT0A 4HSEA 3WBJA 1AA9A 3H4MA 3GQBA 3EZ2A 4A4DA 2JJ2A 4YXWD 2OCAA 2W6IA 5JEEA 1OHHD 5L3SB 3AF4A 1EG7A 3TAHA 1QG2A 4URZR 1SXJC 5FI0B 1AQYA 2IYZA 2RHMA 3CF2A 4PHHA 3AH8A 2WSSA 1MO4A 3W6NA 1TUIA 2A5JA 1HE1C 4LC1A 1E2JA 3CRRA 2WVJA 3NH9A 3EPKA 1FUKA 1IY1A 1HEIA 1CJVC 1VCIA 2OXCA 1YKSA 3PV0A 4DWJA 1PTRA 4BLRA 3GLGE 1G5RA 2WAXA 5DHAA 4URVR 1NG9A 2HJGA 5KUTA 4EPTA 1KI6A 1NN3A 4U5XA 3D31A 3LRPA 1E1QA 5BW8A 1GFIA 3SEAA 2KSQA 2NQ2C 2PZFA 3JZAA 4CEHB 3U4QA 2ZSBA 3N5CA 3VU9B 4AYXA 1MRSA 1VDZA 3A4MA 3HDTA 5JEDA 3AP3A 3UMSA 2GXAA 2J45A 3DKPA 5DISB 5DI3B 1T3HA 3AKDA 4QGAA 1XXHA 4ZV4A 2OLKA 2F3TA 4LBVA 4D2IA 2ZYTX 1LNZA 2P6RA 2ZJYA 1F2TA 2QI9C 5JCZA 3BGWA 1N6OA 2FH5B 2V1UA 4Q4AB 2ZVQX 3IQWA 1LVGA 4XTRA 3PUYA 4Z1MD 1R5OA 3F8TA 4TTQA 1NL3A 1NMYA 1NG1A 2Q6TA 2IYUA 3QG1A 5EE0A 3BB3A 2EFHB 3AB3A 4OI1A 3WXMA 4QM6A 2IS4A 1K5DA 3P32A 1ZRHA 1FTSA 4EPWA 5D3QA 2ZE7A 4H9GA 4PZZA 3I92A 3B7GA 3BERA 1G1MA 4O3MA 1N5KA 3U7HB 1B0UA 1ZCBA 3QUSA 1UBCA 5KSZA 2VP4A 1NY6A 2KWIA 3BRWD 1II8A 2Z4SA 1T0JB 4DBLC 1AZSC 1SVWA 3VR1A 3WHLA 1Z6XA 3IGFA 1CLUA 4OJKA 2ZRCA 2EFDB 4BZXA 1GKIA 1TU3A 2YOGA 4YMSA 4BEJA 5TY0A 1T3SA 1ZUNB 2YNMA 2VBCA 3TKLA 3PFIA 4TYQA 3R20A 4WZAE 1OIWA 4RD3A 1QF9A 5DO9A 3THYB 4PSVA 3SHFA 1F6BA 3UGLA 2ZI3A 1A82A 2QMHA 4LBYA 2KBEA 2EYUA 2IYYA 2MSDB 3U5ZB 1H8HD 3ASYA 2QORA 1GKYA 3UANA 1G3QA 2RH5A 2XSZA 1D2NA 4DUGA 2CEAA 3MUFA 4IHQA 4MGZR 2ODNA 2C9OA 4RZ3A 3LBNA 4Q47A 5DGXA 1TADA 4DLTA 4AG6A 1XPOA 4ACAA 4OKSA 3KXLA 5D3MA 4P33A 3ZZUA 2NTYC 1Z28A 1P4SA 3QXCA 4PPFA 1JECA 1GNPA 4C7OB 3MD0A 1XDBA 2HLDD 4V0ME 4BFSA 4DT1B 2V3CC 2IYWA 2CCGA 2QP3A 4A0GA 4B3DA 1UFQA 2ZRKA 5JSZB 2DFNA 2RGNC 5C46F 1QG4A 3TJZA 4Q4JB 3A6PC 2ANCA 2GJSA 4LHVA 1GZSA 2GXUA 2AHOA 3M0EA 2GTPA 1BKDR 2DWPA 2GCNA 2LKCA 4X8MA 3SS8A 4ZCMA 2X77A 4TSFA 1JAIA 2BBOA 4FMDF 4P3YA 1AZTA 5G3YA 2ZYUX 2C95A 3TW4A 4D4JA 5LD2B 1DS6A 1GAJA 2KJQA 4MYCA 1UBEA 3NBZC 1OH5A 1Z0DA 3FGNA 1XTSA 2EYQA 1T6NA 1R7RA 4TSFD 5FOUA 1II9A 4IFEA 1W7AA 2QSZA 3AKYA 4KFUA 3ZZ0A 4AYWA 3QPVA 4NP6A 1EGAA 3P20A 2ZPTX 4J0QA 4LC0A 4MRRA 4JYCA 2EFEB 4LDJA 2AKYA 2GK6A 2IF2A 2FN4A 1IY2A 3IO5A 3CNOA 3KJIA 2H1LA 2OBLA 3VTKA 2WHXA 4LYAA 1UBGA 4DCUA 3QKUA 2CHQA 4P4TA 2ZRBA 4XJXA 4PQYA 5EE9A 3UG6A 1JQJC 3FMIA 4F4CA 4Z8YA 1IN8A 2QMOA 4KYIB 4NE2A 5F9FA 1AS2A 1YZKA 5FTMA 4LHWA 2AR7A 1KDOA 1E9SA 2J5XA 3HU1A 1G5TA 3NH6A 4RD0A 4C30A 3SNHA 2CK3D 4I1VA 1OT3A 3OF5A 4M53A 2QT1A 3C4JA 4MYTA 5D3MB 4RZ2A 2O8EA 3BIFA 3RS2A 3F3YA 1A1VA 3OFND 3RDPA 1XEWY 2IYLD 4IOJA 2CK3A 2C9YA 4HLUA 3KFXA 2RGNA 2BV3A 3RLFA 4POAA 2WJIA 1KMHA 2ZJAA 2IUSA 3TVTA 3P27A 4NCKA 5GJVC 2XOKD 5H68A 2W2XA 4JJZA 3D7MA 1AK2A 3KJHA 1NLYA 3THYA 4PO1A 3EA0A 3M1IA 4LHYA 3FHCB 2GNOA 2HXSA 3NKVA 5FBWB 3RS7A 1WA5A 2Z4RA 3ND8A 1OE0A 3OIYA 4RFSA 2XOKA 4X8HA 2GXQA 4CZ2A 1JR3D 5FOSA 4PQFA 4D0GA 2REXB 4JVMA 4DSNA 1YZGA 2GJ8A 3CLVA 4OHVA 1FNMA 1NKSA 3W6PA 4L8GA 1AGRA 2V7QA 3FB4A 1LV7A 3WMFA 1QHHA 2A5GA 5DHFA 5CIQA 3PENA 2ZUCA 2IBMA 1KY3A 1OPXA 3K0EA 2RCNA 3RANA 2FE4A 2YC2C 3BB1A 2A9KA 2FGKA 2PT5A 4B6FA 4DRZA 4BASA 1VCOA 4IVRA 3EX7C 1QHIA 4KCGA 2QQ0A 1PLLA 2UKDA 1XRJA 4M1KA 5J4HA 4Q4AA 5CM9C 2WJGA 3ZIAA 1KSHA 2XXAA 2R6CA 1IONA 3OAAD 2NO6A 1BMFA 1F2TB 4XOIA 4DLSA 2IEZA 4JL6A 4WA7A 1GRNA 4OQXA 4IOLA 2QA5A 3FFBA 3RS4A 1JI0A 1P2VA 1S0UA 2E73A 4I1SA 2FDCA 2EVWX 3AP1A 3GLHE 3K0FA 2FFQA 2ZRJA 4LCBA 4HB0A 1GG2A 3LO5A 2W6JA 1BYUA 5A5GA 4BLTA 621PA 1U0HC 4QNRA 3NXSA 3TQFA 2PBRA 3U2QA 1FPMA 5B64A 4V0MA 2GBLA 2GK7A 5AUNB 1CR1A 3EASA 1AM4D 3E70C 3AVUA 1RIFA 2G1JA 2OXRA 3DEFA 2QRZA 3MRSA 1NVWQ 3X1ZA 1G8PA 5KO2A 4HLQB 4QBGB 1FARA 4EJSC 3AQ4A 5KU1A 1YR9A 1IHUA 3ZZTA 3OHMA 2OCYC 4B48A 3OEHA 1KI8A 4WAUA 1FQJA 4RD2A 3I4LA 1M7GA 1GSIA 4M9ZA 4EPRA 1VG0B 4IDOA 4DJTA 4LK2A 3AKCA 2JLSA 1KTVA 2HF8A 2VF8A 1QHNA 4MDFA 4QOSA 2ORWA 2PZEA 4EQ6A 3A4NA 4Q7KA 1KI4A 2ZM5A 3ZD6A 3MJRA 4MH0R 4PC1A 3AM1A 2ZXUA 4U02A 5FL7D 5EXSA 2BCGY 4A6PA 4JT4A 1T8TA 3QEJA 2J59A 4JLVA 3BBPA 3BORA 2F43B 1XMSA 1TMKA 1XMJA 5JLJA 2KBFA 2V8OA 3RWOA 5FPHA 2YWGA 4LY6A 3NC0C 2GEUA 2JLWA 4QJ5A 4PAMA 1FUUA 2X2EA 4ZCIA 2NG1A 2AWOA 3KY9A 3NDPA 1OV4A 2A5DA 3KX2A 5HZKA 3GFOA 1S2MA 4LJ6A 3FKSD 1RFLA 4AKHA 2J9RA 2AXPA 4LV5B 5EXTA 3CH4B 1ONBA 2PX3A 1G6HA 3FMPB 3ZVRA 1RKBA 2GHIA 3SBDA 4A2WA 4CRWB 2BJVA 1JNYA 1E9DA 2F9LA 3NWJA 5F9HA 3GJ7A 4ASUA 4QXAA 4A2PA 3V4RA 4NYIQ 1A5TA 4ZDKA 4UJ5A 1ZAKA 2WICA 1N25A 2F55A 3DM9B 2CVFA 4LPSA 2GJ9A 1OW3B 3N70A 3QKRA 3I1FA 3CH5A 5J4KA 1X86B 4Y0VA 4EAQA 1QVRA 3CRVA 3BJIA 3NIBA 5FI1B 1FQKA 1HE8B 2ZEJA 5J4LA 4NMMA 5H8WA 4NYMR 2VH5R 2ZI9A 2ZAOA 4CIDA 2ROWA 4LGMA 1RE0A 1ZC4A 3VHLB 8OHMA 1KY2A 1XZQA 1E98A 1E69A 2AXNA 3H2YA 2ZVPX 4G5RA 4RZXA 4URYR 4B2IA 5LPNA 4W5WA 2FZLA 5JWRA 2CLDX 1KHTA 1SXJA 1KI1A 5KNCA 1RC8A 2AFIE 4A92A 3RVBA 1BS1A 1N0UA 1UEIA 3K53A 2ATVA 1Z0IA 2B7BA 4B33A 4PXAA 1L4UA 5LB4A 4MYHA 3CR8A 5KTYA 4JLNA 3THXB 4HAUA 2BMJA 4F38A 1YVDA 3A1WA 1DARA 4HYYA 1VCMA 5EE1A 2BOVA 3LA6A 4HAVA 3I8XA 1E9BA 3TUZC 5FBRB 2RGAA 2WKRA 4FMDB 4TWZA 3DL0A 1COWD 1KAGA 2EFCB 5KHOC 3G5UA 3OAAA 2JGNA 1P60A 3F5FA 1OH8A 2PZGA 2PMKA 1M6NA 1G18A 2WWXA 5JRZA 1TBOA 2FFBA 2WOJA 4UQOA 1Q44A 4O2LA 1LFDB 1GL6A 1RZ3A 4DB2A 3W3AA 1IJEA 3KTAA 5DNYB 4WBSA 4FW9A 3HP1A 4M1TA 5JMTA 4GDFA 3QIAA 2JLUA 1Z47A 3UXMA 4PSAA 1CR4A 2IXFA 4R9UC 4XIGS 2PJZA 4CDGA 1ZNZA 3KZ1E 4ZKEA 1S1CA 4KYUA 5BYJA 3VX3A 3DVLA 5EQTA 2QGNA 5KPJA 4C2TA 4OI0A 4IOKA 4DEYA 1ZD1A 3SJAA 2YWHA 5EP1A 5EP4A 4AKIA 4HDCA 1XTJA 5DSZA 1W2GA 3GP8A 3K9HA 3UWKA 4A0FA 1PJRA 3U3OA 3OE7A 1CU1A 5F2EA 4JMPA 4BPBA 3ADBA 3AF0A 1Q1EA 3OEHD 3PG5A 2QY9A 4IRUB 4EIWA 5FUXA 4G5GA 4M9SA 4AG5A 2ZTSA 1M74A 3UWOA 1EFTA 4MYUA 2FFHA 3LFUA 1GTVA 3T15A 2I4IA 2DFLA 2CCJA 4V0KA 3THWA 1JEEA 1U99A 2OESA 3L0IB 4ESVA 2G6BA 1O87A 3AEZA 1UKEA 4ESHA 3Q5EA 3KUDA 2BBSA 4ZDWA 2ANBA 4RCYA 2C8VA 4PZYA 5FBLB 3WMEA 1HV8A 1KO8A 2RGXA 1EESA 1DADA 2C03A 1TF7A 3A58B 1E2LA 4YLGA 4ARZB 4B73A 1N6HA 1OF1A 3BFKA 4HLCA 4B34A 4MGYR 4B6DA 5B30A 1U8AA 4LWZA 1ZU5A 4QNMA 2QE7A 2F1IA 1VG9B 5HKKD 2OT3B 1P2SA 1SXJE 2P5TB 2ZE5A 4EKDA 1C9KA 4I4LA 1SKYE 4FMCF 2C04A 2D62A 4P0TA 4KFRA 4TYYA 1TQ6A 4NZYA 2P3SA 3C41J 1BH2A 1NVXQ 1NN1A 1Q21A 2N42A 1GP2A 3FDIA 4GRAA 4Q66C 5DE3A 4A9AA 4B6EA 5KDLA 2QBYA 2VHQA 4JLAA 1KO1A 4B3CA 1AS3A 1EK0A 1NSTA 2IC5A 4P31A 1R0XA 2XNDA 4W9MC 4QRHA 2A30A 2ZSEA 1Z07A 4OK5A 4FN5A 3MWYW 5EZ6B 3QF4B 5HZHA 3DHWC 4CGZA 2ZJ8A 4QGHA 2FX3A 3K0FB 1S8FA 4MQBA 1LY1A 1T8UA 2F43A 3U3JA 3CBQA 2W0MA 4W5HA 3UATA 4X8OA 1UKZA 4TTRA 2VHUA 4XVUA 2HT1A 4FWIB 4GFDA 5C18A 5DN6D 4II7A 4BFTA 421PA 3B1WA 5JRJA 3E1SA 1E2FA 3C16C 3T1TA 4Q00A 2YVUA 3IBYA 4XH9B 1SXJD 3AVYA 2A78A 3GJ4A 3QG5A 3RRNA 4BEBA 1FW6A 1QBKC 4GZMA 3BB4A 4UNSA 1OIXA 2ZRPA 3HYRA 4BZPA 1ZNYA 3GEEA 4DSUA 4EUNA 1E79A 1SGWA 1WF3A 3HPRA 1Z6GA 4JVSB 5TARA 4MRPA 3U3KA 3MFYA 4CEIB 3THOA 1IOZA 1HA3A 2WSSD 2KB0A 1QDEA 3EIQA 2ORIA 1BOFA 3QVUA 2LWIA 3B6EA 4FCWA 4MRSA 2MSCB 5ANRB 4PO9A 5AUQA 4DLYA 4DLWA 5BYKA 1E2PA 3GLFA 5AJXA 1VECA 4P4UA 4TLAA 3G82C 1US8A 1UKVY 2ZU0C 3LWNA 5L3RA 2O8FB 2N46A 2JASA 2V6JA 4OHWA 1AS0A 2OV2A 1Z6TA 2RHDA 5F98A 2J1LA 2ZS7A 3UEJA 4ACBA 4DIDA 2FA9A 1KKMA 1Y63A 1E94E 1VYVA 2J0UA 4NDZA 1U81A 3EZ9A 3MG9A 5BQ5A 3ZGXA 2XTMA 2JLZA 2WZQA 3IUYA 3QBVA 1EFRA 1OYYA 3S1AB 121PA 5FFMA 3W6OA 1KDRA 3X1YA 2P2LA 4G5SA 3RRYA 3WRYC 1D2EA 1CJUC 2FEOA 2NO1A 4MRVA 1GRRA 1G3UA 1YR8A 3LD9A 3R7WA 3SFZA 2EW1A 3GLIB 4NONA 3WRXC 3VR4A 1IQPA 4AWXA 1XB2A 1R4AA 2P65A 1MABB 4YDSA 4NHOA 2SHKA 2HF9A 5B57C 4MDEA 2Q9CA 4AYTA 1YZQA 3CRMA 1CKEA 2L0XA 3K0AA 2O8BA 2BKUA 4PC7A 4FCTA 1E0SA 2WAYA 4BFXA 4BFUA 3V9PA 1OYWA 1M7BA 4V03A 1QRAA 2ZRLA 3VKGA 1NIJA 3T61A 2E9SA 1A7JA 4TLEA 1ZM7A 2VYFA 1XMVA 4LJ7A 4NYMQ 4URWR 1M34E 2V6IA 3U3MA 1Y3AA 4ITRC 1AIPA 4US1R 2A2ZA 2LCFA 5CK5A 1OH6A 1GM5A 3RRZA 4C0HA 3CW2A 5AJVB 4TL7A 3ZDQA 1N6PA 4OL0A 3OIVA 1U0JA 3W5IA 2UZ3A 5FH9A 1UBFA 1YRAA 2QPTA 1EXMA 3AP2A 1DAHA 4C0LA 1RYHA 2BMEA 2D06A 1E32A 4TL6A 2XJ9A 3KXKA 3LXXA 4FMBB 1AKEA 4LOAA 2QQEA 3A36A 4BECA 1UAAA 5FUVA 2KI5A 2ZANA 3K1JA 3VKHA 2OG2A 2W2TA 5BXQC 3PUWA 4HZIA 1Q12A 2ZRDA 4IDHA 4YMVA 5ELXA 4K81B 2XNSA 5JSZA 1HURA 3THWB 3O8BA 2IL1A 4UJ3A 2W6JD 4HI0E 3TSZA 1UADA 3ZD7A 4M1WA 5TVKA 2JLVA 3B1XA 1S4QA 3AVQA 4EFMA 3GLGB 4TT3A 4A0RA 5AUOB 2C99A 1ODFA 3GJ0A 4O25A 1OXXK 1VHTA 3GFPA 3QPUA 1LW7A 4JYBA 2CL0X 3AUYA 1S1MA 4N3NA 4N0EA 2WSMA 3B1YA 4A0HA 1FL9A 2FPLA 2WIAA 2R44A 5IDVA 1VIYA 1PLKA 3CIOA 3BFXA 1Q0UA 3VX4A 1NMXA 3Q72A 5L3QB 4L9MA 4Y0AA 2AD1A 2WIBA 1DEKA 1OIVA 3I8SA 4KVAA 3IEUA 2R2AA 2OAQ1 4Q1FA 1IY0A 3WY9A 1Z0AA 1X1SA 2BJWA 3IHLA 2ZE6A 3KTAB 4KLZA 5EUMA 1GVNB 1U9IA 1PZNA 3RC8A 4GI7A 4IKEA 5CDFE 3Q8XB 5K8UA 1I2MA 1NIPA 3R8CA 3C8UA 4JKYA 4LV8B 2QGZA 3FE2A 1D6JA 1W48A 2XTZA 1GNRA 2NPFA 4PO8A 1TL7C 4JSTA 1I4TD 2AKAB 2JLQA 1Z6YA 4LRWA 2ZSAA 5KOYA 4MKHA 3BAFA 1N0WA 3DOEA 3EC1A 4EPVA 2G9NA 4A6XA 3IIJA 4MKFA 3C15C 4A1FA 1C4OA 1BO6A 1ZINA 3GJ3A 4JLMA 3NEYA 1R79A 1K8RA 2QU8A 1ETUA 3SI7A 4CF7A 1EFUA 2OEPA 4DT1A 2JIZA 2FOLA 4L4UA 4NYJQ 4C7OA 3KJGA 2OO7A 2MMCA 4LBWA 2C5LA 3UGIA 2IUTA 1UDWA 2V9PA 3CUEF 2C2HA 5E95A 2RGDA 4TMWA 4KXFB 3I62A 2NO7A 3KUCA 2CBZA 3T12A 1P5ZB 1XXHB 4Q4HB 3O8CA 4HUQB 1R0ZA 3MSXA 4IEEA 4S35A 3UGDA 4NCJA 1D2MA 5CIWA 3UG7A 1MRNA 4YMWA 3OEEA 2QP4A 1JAHA 3BH6A 3QSYA 5DLQC 2BEKA 4CEHA 1WCV1 4TMKA 4Q4HA 2J0SA 5L3VA 4M1YA 1SHZA 4IEIA 1I2DA 5GJWC 1N6KA 3WYFA 1HQCA 1A2BA 1IBRA 2Q3HA 3DZDA 1RVDA 4OHYA 4PPNA 4F92B 4Q7LA 2HUPA 1J7KA 2GZAA 5FOTA 3K70D 1UDXA 4WXRA 1M8PA 1NP6A 3TW8B 1RJ9B 1AJEA 3L0SA 2B6HA 4PX9A 2OILA 3RS3A 5JBQA 2BCJQ 1VPLA 1JB1A 1KJYA 3FOZA 2DY1A 2I1QA 3I73A 3MGCA 4Q4LA 5GJBA 4DLXA 2FFAA 4GMDA 2IWRA 2BKEA 3VQTA 2ZETA 2F1RA 3R9IA 4CW7A 2IYTA 2FSIA 3A4LA 3REFA 4PC6A 1E1RD 4N0DA 2IA5A 1ZJ6A 4IDNA 4L9SA 1CJMA 4MUBA 4CT4B 1J8MF 4F4JA 3QKSB 1G8GA 3O8DA 5EE5B 1MO6A 2JJ1A 1CULC 2IXGA 3LQRA 2A3RA 2QAGC 1FP6A 1E2QA 3NBYC 3FHTA 4TLDA 2CVHA 4EJSB 3SYLA 4HLUC 5TMPA 4C2UA 1II0A 2WWFA 4B76A 1X1RA 2IW3A 3SYNA 5E4FA 1NBMD 4TYWA 3VMFA 2ZUDA 4JS0A 5IK2D 4Q03A 1W4BA 1WMSA 3VU9A 4FWTA 1Q3TA 3QXXA 2OE2A 4PC3A 1E0JA 4RSGA 2VO1A 3PCRB 3GJXC 4XD7A 4D4KA 1YZTA 2GETA 5LD2C 1KI6B 2BBWA 5BWMA 3Q85A 4AK9A 1NI3A 2WPDD 4XWOA 4F7WA 1KI2A 5KYKA 4KU4A 4TT3D 2AD5A 2PLFA 1H8EA 2UZIR 2ZIAA 3LVQE 4BUJA 1EWRA 4MKIA 3EPJA 1GUAA 3H84A 1VG8A 2GKSA 4B2LA 4LBZA 4DB4A 1Q1ZA 4FIDA 4LYHA 2JLYA 1DE0A 3KJEA 3U60B 2Q9AA 2CHGA 5JWHA 1MR3F 2IYRA 1E9EA 4IW3B 2O8CA 4RD6A 1G8HA 3QEOA 2DYKA 2EWWA 2G83A 4DVGA 1K5GA 1NBME 4D0LB 4LZZA 1P2UA 4MUAA 3ZQ6A 4D25A 1DAEA 3ADKA 4N1AA 5EE3A 1XD2A 2VRWB 2GCPA 4EFNA 2XTNA 4P4SB 1I4LD 2OFOA 5CB8A 1G20E 3QE0A 4JLKA 4LJ9A 1KZGB 3SU8A 1F5NA 1NN5A 3ETLA 3R8FA 1CXZA 3IILA 4BQSA 5KSOA 3TE6A 1ZW6A 1Z0FA 5FOWA 1DAGA 1BIFA 3IPYA 1XZPA 2RGCA 2QAGA 2DPXA 3NEJA 1ZVQA 4DLUA 3IHWA 1KK2A 4GBMA 3NHAA 2QL6A 4QJ4A 1DO2A 1G7TA 1Z2AA 1TEVA 3K70C 2Z43A 1KNQA 1SVMA 2AL7A 3CPEA 4NU0A 2ZSDA 5G3ZA 3VR2A 1JXOA 4DKXA 2CL6X 1Q57A 2P0EA 3CPHA 2IEYA 2B21A 2R6AA 2ZRHA 2ZJBA 3Q5DA 4B35A 1M1YE 3TQCA 2I3BA 3BJIC 3FMOB 4KBGA 4D6PA 2W83A 1F48A 3D3QA 2AWNA 4B2PA 2FGJA 3KQHA 3SJBA 3PQCA 4BWYA 2OFWA 5UKDA 3X1XA 2CJWB 4QBHA 3LLUA 1MT0A 4Q9KA 1G5PA 4DCSA 3PEWA 3SR0A 2QUZA 4LJ4A 2OUKA 1KGDA 3CZPA 2ODEA 4P4SA 3BWDD 4GZLA 5B58C 5CITA 3EAQA 3SQXA 4LJAA 5FTKA 1KJZA 3P4YA 3B78A 3CR7A 1WXQA 3ZS8A 5BN3A 5CB6A 1JR6A 1T91A 1U8YA 3TMKA 1ZUHA 3LW8A 4OK3A 4D4LA 4EPYA 4QGGA 4OQNA 3I72A 4Q1CA 4S2EA 2WJHA 3NDBB 1JPNA 1S96A 2GILA 4ZI3A 4RJLA 2B8TA 3WP1B 4LSGA 3P26A 3TSOA 1TBNA 4DLZA 5HR5A 1G41A 4UKDA 3IQXA 1OFIA 3B13B 1X8JA 4KSCA 2O0JA 3CNLA 1JR3A 1Z0KA 4Q18A 2O8FA 1OFTA 1Z29A 3CO5A 4OHXA 4RVCA 2J3EA 3GLFB 2BBTA 1XPUA 2RGEA 3QI2A 2BEJA 4A8JC 3DDCA 3EARA 4TLBA 2B7CA 3TBKA 5P21A 721PA 4BLOA 3N2IA 2ZSFA 1COWA 3GJ6A 4YXWA 2YZ2A 5EUQB 1R0YA 4L9WA 5LDDC 1U94A 1H8HA 2YINC 4CEJA 1KI3A 2VP5A 2IX3A 1VKJA 3QBTA 2DR3A 3QY0A 1LF0A 1Z63A 2ZR7A 2QAGB 4LUCA 1D8TA 1IN5A 1BMFD 4TQUS 1FFHA 2ENNA 2HCBA 4B47A 2W2VA 1U98A 1Q1BA 5HE8A 1P61B 2JJ8A 3IPXA 1H65A 1UEJA 3EC2A 5LB2A 2J46A 1S9HA 1KI9A 2QP9X 4IFBA 221PA 2ZE8A 1ZBDA 3QNUA 2IS2A 2IYSA 1W36D 4H1UA 5FBVB 1AQUA 1DO0A 3E5HA 3UMRA 5KNDA 4ILEA 2NZ8A 1HQYE 3CPJB 2O8CB 5H70A 2R6GA 3RWMB 2DFKB 3JVUA 4JLDA 4BFWA 2YHSA 821PA 2WM9B 3UK6A 5HTKA 1SKQA 5SZHB 2PEYA 3WBKA 3FHOA 2QRNA 1L8QA 1G4UR 3FVQA 4HATA 4UNRA 3I3SR 1DAKA 4KHZA 4D0NA 1XJQA 1CR0A 1J99A 1KNXA 1OKKD 2ODWA 2JEOA 1N6RA 2QSYA 3QKTA 3T5GA 4C0KA 4JBWA 4R2HA 3SC3A 4B43A 1P9NA 4QG7A 4B71A 2ZR0A 1KAOA 2C98A 1R5BA 2JDID 4KJZA 1E2MA 3EPHA 3GPLA 1XBTA 3BOSA 1P9WA 3GLIE 1ELOA 4DDWA 4TQ9A 1OB2A 4HAXA 2GA8A 1A4RA 4QFMA 1W4CA 2QROA 4C0SA 2FSGA 2FZ4A 3ZVLA 1JEDA 3B1ZA 1ZNWA 2GBLC 2ZRIA 4HB4A 4MITA 2ZS9A 1RRGA 1CP2A 4ASUD 1FOEB 3NBXX 3BFVA 1QHGA 1SULA 1D9XA 2B92A 5CDFA 1RFHA 1YHNA 2CXXA 5G53C 2YWEA 1Z6AA 1HTWA 4QHTA 3G0HA 1F2UB 4ZIRB 1GRQA 3KQUA 1CTQA 1Q3HA 2VSFA 1P72A 3DPUA 4PPQA 2CNWD 4I1UA 4P32A 3Q3JB 5IRCD 4NL4H 1BYIA 2ZYWX 3SN6A 2XZLA 2QE7D 2YJTD 3DOFA 5HKKA 1XWIA 3ZVNA 3WYGA 3Q7QA 1DPFA 4IOMA 1JXMA 2FPKA 2IF0A 4XTCS 1O3YA 1OXUA 3AGPA 5F3WB 1G16A 2NIPA 3IBGA 1XEWX 1F2UA 1RJ9A 1KO4A 2F1HA 4RCZA 4IVPA 4M1OA 3NHBA 3CXLA 4BFZA 5HPYB 4HUTA 2CHVA 1YE8A 1T9HA 4JLPA 3AF1A 2H8KA 3OZXA 1N6LA 4QHYA 4QJ3A 3QPWA 3VFDA 4TL8A 1EFCA 1VCNA 2BWJA 1LS1A 4CVNA 2ZS8A 1XMIA 3EIHA 5DH9A 1NVVR 3UKDA 5B2ZA 2IYVA 2EFGA 4HB2A 1Z83A 5GJCA 4DCVA 1CR2A 1OXSC 3IO3A 4HUQA 4US0R 1WB9A 4G5QA 3BC1A 3VAAA 3HWSA 1G9XA 3T06B 2A5FA 2GVIA 1WDTA 5DN6A 4DHEA 1PUJA 5KSYA 5HCIA 1ZMXA 1XPRA 3C5HA 4GPTA 4TYPA 1E0AA 4HAWA 1RYFA 2G0NA 1Z08A 2D2EA 2QEQA 5FBQB 1D5CA 2DB3A 4Q1EA 1XX6A 1IN6A 1XTRA 5AR1A 4AURA 4E22A 2WJYA 4R71A 2D7CA 2HDNB 2WKPA 2HYDA 1XD8A 2OCPA 2ZITA 3BK7A 3U7EB 1CRQA 1E96A 1YZLA 5JWOA 3E2IA 3D6TB 1E9CA 2AN9A 1E1QD 5FL3A 3X2SA 3LBIA 2NGRA 3A1UA 3AGQA 4RKFA 2FPMA 1EFRD 2GVDC 2DHRA 4LX0A 2GEDA 3I61A 2OM2A 2FV8A 2HYIC 1JALA 4PAOA 1GL9B 1E2IA 2NO0A 3BE4A 3WMGA 2IK8A 4JL8A 4QBIA 3L43A 5DYIA 1XNJA 1G4AE 2AX4A 4U7DA 2VTKA 3GLHB 5FOVA 2W58A 5FPSA 4D26A 4ZO4A 5G40A 1E2EA 2P6UA 2CL7X 3DMDA 4KO8A 4C4PA 1G3MA 4ZI2A 1P9RA 2JA1A 4Q9JA 5KDOA 5L3QA 4JBYA 2REBA 1HUQA 4UXJA 3QVVA 5EP3A 1CBUA 2FWRA 4D80A 4JLJA 4PC2A 1L2TA 3KQLA 1IM2A 3B85A 521PA 5AJYA 3NVAA 1CRPA 1Z3IX 2PMDA 3SBEA 4BGDA 2QPOA 2ENZA 1WP9A 2FSFA 3KB1A 3OE7D 5KSPA 4GT1A 4EDHA 5FUWA 5JI3E 4TLCA 1RW4A 1C1YA 2V54A 4OYHA 2BMFA 3T1OA 1KSFX 3GLGA 3AUXA 5C2JB 1ZYUA 1Z06A 4Q1BA 3TVDA 1PUIA 2IUUA 3B9QA 4PANA 5FL7A 3GLHA 4CYMA 4XSGA 3V00A 1KK0A 3KB2A 3DKVA 4TMZA 2ZRAA 1P6XA 4M8NE 1SVLA 1Z22A 1KKLA 2GJAA 2P67A 3TAUA 3CWZA 4OHZA 1YR6A 3RYTC 3U44A 2IXEA 3ECCA 5K8TA 1S3SA 1E6CA 2Q3FA 3M4YA 4C0JA 1P7CA 1VHLA 3EZ7A 3EWSA 3KXIA 4L15A 2PCJA 5JJIA 3GLFE 3QXHA 1DG1G 1FZQA 3WYAA 1F3OA 1W0KA 1W0JA 1ZIPA 2IS6A 3BXZA 1W46A 2X19A 1W2HA 3RC3A 2BMDA 3UPUA 1CJKC 3KQKA 2OSBA 1DOAA 2G3YA 1M2OB 4B3XA 1XEXB 3REGA 5JS8A 4HAYA 1AGPA 1W0KD 1YR7A 1W4RA 4I99A 2ECKA 2CJWA 2DFTA 4Q02A 3I5YA 1XTIA 1M7HA 1ZIOA 4QBFA 2J41A 3KKQA 1TQ2A 1KBFA 4IJMA 4A2QA 4DXAA 1P2TA 5BN5A 1GILA 1GOTA 1QHYA 2RMKA 2ZRGA 3EG5A 3KQNA 1MO5A 3W8RA 3ZJYA 4DCTA 2D3WA 3UFFA 2GCOA 3OIUA 2QM7A 2NMVA 1H8ED 1T0HB 2IWHA 2WJVA 2H18A 3AVTA 2FU5C 2V55B 3K9LA 4IXMA 4PHFA 4W5JA 1OB5A 1E3MA 4UNQA 2WV9A 3RABA 5HCNA 2GF0A 2ZJOA 5E7JA 1R8SA 3CB4A 1U9IC 1OXTA 1QHSA 2ZJ5A 2HLDA 3CX7A 5JECA 3AVWA 2PT7A 2W6ID 4ON9A 1TEXA 3W9YA 3VKWA 2H57A 3HYTA 4A8JA 1DELA 2PJRA 1T5IA 1XD2B 4EFLA 1GIAA 4C0AC 3B1VA 3TK1A 3L8ZA 4OK6A 3TNFA 3KKOA 2JLXA 3AVXA 4U00A 5HE9A 2RAPA 5K8LA 1E79D 1IXRC 1ESNA 3CF0A 1QHHB 5IHPA 4G0NA 4OQLA 3PXGA 2ZRMA 1OSNA 2G1KA 5J5CA 2O8DA 1ZM3A 4QM7A 1KSJA 2XZPA 4K8OA 1AN0A 2RGGA 1JQLB 4YMTA 2WWIA 1G8YA 1G7SA 5AUPB 2R65A 1IN4A 2VSOA 1FX0B 1UJ2A 1U0LA 1HH4A 4GOJA 3ZVMA 5DI9A 3F0TA 1MKYA 4ZDIA 4LJYA 1D9ZA 2Z6VA 3N2EA 4FINA 2F7SA 2J7PD 1DBSA 1MV5A 4HEJA 1X6VA 1KMHB 2FEMA 2PEZA 4IXNA 1N6NA 2WJJA 2C96A 1PTQA 2JIZD 4YC7A 3HPQA 2FJUA 4B3BA 2X1VA 3LNCA 4ARZA 3SJCA 1WBBA 4Z8XA 2H16A 2J7PA 3JZMA 2O8EB 4HLDA 2IT1A 2QTVB 1L7VC 1GDDA 2GAAA 5AJZA 4D4MA 4F91B 5FTNA 1G19A 3QENA 4M9XA 1SHKA 4XVRA 5C4GB 3W34A 1TTTA 4DSOA 3J81k 2O0KA 3QXJA 3T1QA 2QENA 4NYIR 2ERXA 3LXRA 4JSYA 2CE7A 3CZQA 5CYOA 3GEHA 2ZAMA 2VHJA 4GMXA 1W36C 1G8FA 3OFNA 4UXIA 1Z0JA 1TU4A 4DCNA 4MGIR 3QKSA 1TPZA 1EFHA 2ZUBA 2FF7A 2GAOA 3TIFA 3X1DA 1E0KA 3CONA 5CJPA 4TYNA 1TUEA 3LW7A 2XB2A 1KJWA 2BM1A 3BD9A 1E2GA 4I1OA 4DIEA 3CF6R 1N0VC 4MA4A 1W49A 4HZUB 3HR8A 1XP8A 5FR1A 3U7GA 4WW0A 3CKLA 2YC4C 2DCUA 2VP9A 1WRBA 2W00A 2ZQ5A 4GOKA 2XSZD 1XEFA 1XCPA 2ZRNA 3CNNA 2JLRA 3B5JA 1E2DA 2R6FA 3EA5A 3FKQA 5M04A 4PQRA 4DSTA 2HT6A 5J47A 4F93B 2V7QD 3ZLJA 1E1RA 2ZR9A 3QQ5A 5KDDA 4URUR 3ZQJA 4V0LA 1J2JA 1UPTA 2HEIA 4TN1A 2D7DA 2IHBA 2C9CA 4D82A 3PR1A 2NOAA 1VG1A 1VYUA 1N5LA 1SVSA 4RD4A 4C0QC 5FTLA 3K8YA 4R7ZA 3EW9A 2ZROA 2WPDA 4XWAA 1XTKA 4BLPA 4JLBA 2WBLC 4Q19A 4GL2A 2GCOB 5FPKA 3CRQA 1NBMA 3FYHA 4ZPXA 2AK3A 2GF9A 4YONB 3TR5A 1WBDA 1NNEA 5SZIA 4K46A 4ZKDA 1FX0A 3EPLA 3H1TA 3HJNA 5A4JA 3OIWA 3PIRA 4XSHA 3ICQB 2HV8A 1UKYA 2O8DB 4A36A 1SVKA 2IHYA 3AKEA 1ZD8A 2DWQA 3GFTA 1WE2A 3HU3A 1N2CE 1XXHE 3TH5A 4QKQA 4B44A 2BC9A 4L5BA 2BDTA 1OFHA 2GESA 4JT2A 2H17A 4AKEA 4E5UA 3A37A 1RRCA 3MWJA 4BRWA 2AFHE 4Z51A 4FXPA 1IN7A 4GP6A 1JR3E 4G01B 1NN0A 1ZUIA 1G291 3LDAA
chains in the Genus database with same CATH superfamily
1CIPA 2ABWA 4G3XA 3QYFA 1J1UA 2R8RA 2DY0A 4LWPA 1H6DA 5FPTA 4CDNA 1E3SA 1TQDA 3RAPR 1PL0A 1DVRA 1NUSA 2VP0A 2I80A 1T2AA 2ATEA 4PX3A 3WGJA 2OZLA 2CE2X 3CG0A 4EK9A 5A5DA 3VNRA 2RGBA 1NVBA 3FZNA 4OVOA 1ESEA 3QFRA 2E7ZA 4I50A 3H13A 2E1RA 4RJKA 2ORVA 3T3DA 1TM4E 2EKQA 2WPNA 4ZAGA 1S3GA 1WQ1R 1E18A 1YTPA 2BTQB 2DSNA 3BS4A 4PSKA 1VHWA 4FCVA 1JHQA 4V38A 4ZVVA 3SS9X 1NURA 4R3UC 4MLZA 1V6SA 1REQB 3E8SA 2X3YA 1Y6GA 1HT1E 1KMQA 5EI5A 3L0PA 3T3NA 3E9QA 4EVQA 4XDHA 1E60A 4FVTA 3ZWAA 5C81A 2EHJA 2R8PA 2NPIA 1QZXA 2HO4A 4O0MA 4MS1B 2N1BA 1KJQA 1XVTA 1YZNA 4P22A 4RVHA 4ABYA 1I7SB 2H4WA 1BH6A 1P1IA 1RQGA 1QQ5A 3GXOA 4JC5A 1JBKA 4LAFA 4BLSA 4Q4CA 3CN9A 1Q20A 3CKKA 1L6RA 4BO5A 2WRZA 3A14A 1XEXA 3B36A 1CQIA 3NNNA 4S05A 4MR8B 1Z4KA 1T4MA 4IQFA 3CW8X 1GNQA 3LOUA 1Z5UA 3G0IA 3G68A 4RZUA 2ZJ1A 4BL5A 4AY2A 2NWQA 5KU7A 4PBSA 3K0BA 5JC1A 4EGAA 2L8EA 3AESA 2DHQA 2QRUA 5EXPA 2DR0A 3FA2A 1IH8A 4KSBA 2VNHA 2QTLA 4LJRA 3D5TA 3U26A 1BCRA 4AQYB 1IZ0A 2JBWA 1SGNI 1KERA 1N2HA 1NXSA 2X86A 3HRHA 4LWOA 4KQ2A 4JZKA 4KQHA 4MVWA 4Y7DA 2ODTX 4MI1A 2J0VA 3RF6A 2H8GA 3GCGA 2OYRA 4HAIA 3IAS6 4C07A 2AFVA 1UM8A 4FC6A 4HGQA 5E3JA 3OZIA 3TKAA 1P62B 4M0LA 2XCLA 2PCLA 4L57A 4UNNA 1UXKA 4K9DA 2VJCA 3TTUA 2BHRA 2WWHA 1JEAA 1T26A 3ZY3A 4WJLA 9ATCA 4P3NA 5JS7A 5E0OA 2PKWA 4JGBA 1N92A 4FKMA 3P9YA 1YR1A 1ACLA 3D1JA 1MX1A 4CDMA 2ZJ2A 2O3JA 1KK1A 3GOXA 3R0XA 2DB6A 2CHUA 4KVGA 1KTIA 4Y9TA 1ZM4A 1GD1O 4ESEA 1MT1A 1HYBA 3AEXA 3F6YA 3GD7A 2FPSA 1NQVA 2HJSA 4GRIA 3S2IA 2GZRA 3IOMA 2GZHA 5SZKB 2EWVA 1L4NA 4B8ZA 4KFSA 4DDUA 1W93A 1X92A 4YI3A 2CL5A 2P1RA 1J6UA 2XA9A 2XGJA 3ZNQA 1L4YA 1NP7A 3FYUA 3B8HA 4DADA 5CA1F 1E2HA 1KO5A 3GEIA 4KOEC 4DDTA 4IMIB 4FTWA 4BFVA 3ADDA 2HCJB 4EB0A 1TJNA 5CB4B 4LXHA 2O5VA 3LDFA 1SZPA 1Z5ZA 3DTVA 3KKPA 4JLOA 1M2NA 1F6DA 5CT6A 4FMCB 4ZQEA 4LY9A 1MPXA 4KTTE 3DZKA 3C14C 4AAYA 4B3TB 2O2GA 1U4NA 5C1BA 1C9MA 1ORRA 4Z0TA 5IF9A 1NJ6A 3M70A 4G56A 3V8EA 2I7XA 2JAPA 1OASA 2FMKA 5K3BA 3S5UA 1WEKA 4FFRA 1C1DB 4WKPA 3WISA 3UO8B 1AXEA 3FPJA 1MW8X 2QUAA 2C3UA 1PR5A 3NFRA 5LZ9A 5L4SA 5FR2A 4CLOA 5J1SB 1SUCA 5DT9A 4PYNA 1T13A 1VB5A 4UFNA 4I81A 3UWDA 2VLBA 3AF3A 3I2IA 1KBZA 1MCZA 1XL1A 5CEJA 1JDJA 2ZBEA 4YRQA 1VJCA 5LJIA 2ZB3A 4ZHSA 2BFOA 1C3JA 4N41A 4M0UA 4FYKA 1ZU4A 4MW6A 2GWHA 3DTTA 3SFVA 4ZIRA 2GPTA 1T1RA 4PTLA 3PD1A 5AXCA 3SOPA 1FXUA 1FMLA 1V0JA 2W0SA 1UKBA 3IIEA 4ZREA 1KGSA 1EKXA 3D0QA 2ZPAA 2GJ4A 1KP9A 4Q9LA 3VDMA 4BGVA 4BN4A 1PV4A 2ODBA 1TO2E 1UC5B 1J0DA 1T2CA 4UD2A 4YTEA 1S7GA 4CCYB 4E0BA 1JG2A 2A5LA 5IM5A 3PGMA 4FHFA 4L1KA 1U2RA 2OB1A 5DDIP 4IAOA 4WK0B 2BMAA 2HCFA 3L8YA 4U8HA 1DGQA 4B5KA 3KDSE 3A1TA 3G8YA 4P38A 2P2YA 2XODA 4AD8A 2H92A 2IKQA 3DW1X 1YNSA 1LQUA 3M3HA 1I14A 3PP8A 1RPAA 4IIJA 5CVVA 2Y2VA 4QYWA 4WCFB 3BL8A 4KXMA 3V2UA 3F5SA 3BRSA 4NRDA 2K6GA 5TNXA 2P35A 4BPRA 4NJMA 1BHJA 1JEQA 1YB2A 3H0KA 1W1UA 3PUZA 3WADA 1TK3A 4HN9A 4NZ9A 1YA6A 3PI7A 4GM1A 2OK7A 3W78A 3G8CA 1NULA 1V8BA 3FUWA 2H9YA 3ISTA 4M1MA 4CLRB 4RTJA 2Y1DA 3AVOA 1R4MB 3R4VA 5AW3A 5BSTA 1DUVG 5TS3A 1JFFB 2OV4A 4AG3A 1KL7A 1C30A 1OKKA 1USVA 3DQPA 4MEJA 8ATCA 4DC9A 3SE0A 1P1CA 4A15A 1ZN7A 1BN6A 2DBYA 2QLFA 4LHXA 1TA4A 2H08A 4JEIA 3W8NA 5JI2E 1KS9A 5A9TA 4ZRMA 2YY7A 3IOYA 3RJMA 2R8YA 4CFSA 5JNTA 1G5HA 4MWCA 5H9VA 3RBZA 1EFVA 4DEVA 3SQLA 1PR2A 1H0RA 3LC7O 1TKBA 3QMVA 5AHXA 3Q5GA 1AVTA 2PV0A 4UXHA 1Q16A 5J4VA 3QITA 2YOHA 1L5KA 3V1LA 4ZYVA 3OTGA 1K3UB 2HHLA 2XUZA 2B3DA 1NWHA 1UZAA 3B9BA 4G81A 5E1BA 3MD9A 4OMDA 4I46A 1LBQA 1RACA 1OX4B 2AG1A 3K30A 1PNVA 1QCDA 3HR7A 4RPKA 3UT5B 5C8DA 2FPIB 2QVXX 4JI2B 3E53A 3JWPA 2J87A 2XNDD 4IG9A 4RYLA 3A9CA 2PGIA 1Q2UA 1M8CA 1BSVA 4OI2A 1VJ5A 3ICVA 1DT3A 3RSOA 4WLOA 1A2KC 5LIRA 3OESA 1S8AA 4K9NA 2PKCA 3ONDA 4PAGA 4GZ5A 4MJXA 4QDZA 5JPCA 5IM4A 1X1CA 3I83A 1DTSA 3OD5A 3P0IA 3O4IA 4M22A 2HHAA 2YWCA 2ZREA 4C87A 1E99A 2IYOA 3T34A 5CDHA 1SVIA 1G59A 2B4AA 2VSNA 1TF5A 5MN5A 2WWWA 3AETA 1ZM9A 4L50A 2X2FA 3RSZA 5FA8A 4DLRA 4AJPA 4AKGA 4P2GA 4ODIA 3E82A 5E7IA 3T7CA 3MWFA 3SC6A 1VYTA 3MLBA 1QVAA 4OJYA 1FRFS 3DH0A 2IYAA 2FNFX 5JHGB 2MSNA 2IZZA 2GM9A 4Y30A 3RRMA 1B6TA 2WVGA 3EG9B 1F38A 2B37A 4YQFA 2LIVA 3C7KA 2QVLA 3K6RA 4X3PA 1MOQA 4DDKA 2E87A 2A0WA 2JJ1D 1SQFA 4RNDB 1I4DD 2IEAA 4AMVA 1U2DA 2O2YA 4KPYA 2WKQA 1XFAA 1U31A 3B6MA 4AO8A 3E9DA 2ACVA 4CTKA 3CN7A 3LY5A 1MIOB 2FSUA 1TRKA 1LBSA 3AM4A 1NRJB 3C5CA 3DOJA 4UMEA 2V1CA 4B09A 2NQ8A 5F73A 1ATZA 1ZL0A 3PR2B 3JQAD 1A04A 4BZQA 4PYRA 1VXOA 4J4HA 3EDMA 2TMDA 1H0KA 1W4AA 3L82B 1WXWA 1FNSA 1O58A 2H0RA 3IYLW 1Q7TA 4KQKA 4D81A 4TZ0A 4DDMA 4OJQA 1O6FA 2J7KA 2ZZNA 3VNQA 1XZMA 1TNDA 4AZ3A 4W7SA 1K7TA 1C7JA 3TIXB 1PLJA 3PDUA 1CUUA 2A3NA 2XOXA 5GWXA 5EWLA 2N75A 4F2HA 1O6ZA 2JFGA 3KKNA 3Q2OA 4PG4A 2Z2IA 3WICA 1J21A 4RO0A 4KLRA 3QPCA 3M5PA 2BN4A 2I4MA 2CUNA 1HLFA 1V43A 4B3FX 2V3VA 4FFBA 3W3AD 4AC9A 2HBZA 1TQ4A 1ML4A 1R5NA 2WYOA 4YLYA 2YUTA 3PFGA 5GY7A 2YYZA 1TGSI 4Z9FA 4QD3A 5K0JA 1HNZB 3KT6A 1FS5A 5G0TA 5EOVA 3LCVB 1G6OA 2PUVA 1II8B 2FLVA 3TBFA 5CFNA 2REOA 2Z2YA 3WB1A 4YAJA 4CE6A 3FW1A 2QOEA 1NVUQ 4JH0A 1Z7YA 1FTNA 3N2NA 3NV9A 1G6KA 1GKUB 2VP3A 1TFUA 2ZB8A 1UBTS 3NHYA 5AK0A 5BV7A 5CG1A 4L7VA 3SEQA 3ONVA 1IPFA 4Q4JA 5KPDA 5M5BA 2VAWA 3NAZA 1NVVQ 3KLPX 3ICEA 5TMBA 1QP0A 3WLHA 3LH5A 3B2QA 1TAUA 3B6JA 1C5KA 1X8LA 1OMTA 3H86A 1IG3A 1E4EB 2OV1A 4KLNA 4LDAA 1RSZA 4YP9A 5JZ9A 2I8CA 1ISMA 2BY4A 3GGSA 2ZTMA 4PAQA 1FU8A 3VTFA 4IDPA 3JWJA 2W2PA 2YL2A 3D0KA 1AHHA 4FD2A 5JXGA 4QA9A 1GQQA 2A92A 3KVRA 3T5DA 3DMNA 4FNGA 1I10A 3UY4A 3ZKWA 4AWAA 2LW7A 5BOSA 5JNWA 5JY1A 3CZRA 3PEYA 1SXQA 4PWYA 2ST1A 3O38A 3SZMA 3IIKA 3LBHA 5LC1A 4Q9HA 3L0ZA 4BMSA 3BJEA 1XROA 1ISFA 2YUUA 3GT0A 4QXOA 1LDNA 2GNAA 2WWGA 3TXXA 3GZTB 4OYLA 3NC1C 3A6DA 1OLXA 4RSRA 1UVGA 1LUAA 2NTJA 4F4IA 2YKGA 4DIBA 3KETA 4Q9IA 2GZSA 1JR2A 3R24A 1DWUA 4I5DA 4L8LA 4LPKA 1Y4UA 3I5UA 1HSOA 4KNYA 1GLNA 1LSUA 1V11A 4JJKA 4KJXA 5AIAA 1S5PA 2G77B 4JL5A 3T9EA 4R0MA 4ZHQA 2MT9A 4PSCA 4MPRA 2VDPB 2REQA 4GYKA 4GGPA 3S2GA 4CF6A 4Z49A 3FKSA 1JLLB 1GUBA 1LTQA 2X5JO 3U4IA 2VHCA 2FRVA 3GIDA 1L4FA 3RUAA 4IZ6A 6PFKA 5IUNC 2AMJA 3SF8A 4R9SA 1E4YA 4XQGA 1SUAA 3G49A 1BWSA 2HA3A 1N5RA 2ZRFA 1K6MA 3HVRA 3TTYA 4KV9A 5DYTA 5EKUA 4BNGA 2HMWA 3QLVC 4C9BA 4ZTZB 1OXVA 4DMKA 3WNBA 4BQQA 1BA3A 1QHXA 5JCOA 2P9YA 4DEXA 1GUDA 3HHPA 4JYZA 1XJ0A 2WW8A 2JK0A 1KAMA 1ORDA 1R6BX 1ND6A 4MEBA 4HDNB 4QC2A 1SAYA 5FTJA 4BATA 3AHDA 3Q8LA 5E3HA 4X8LA 5JMWA 3MCUA 4IMPA 1VBFA 3H9BA 1Z8DA 4GHWA 3MSCA 1FNNA 2GRJA 4M2LA 1SQ6A 3FX2A 3DLHA 3CEJA 3EOAI 4AKSA 2X3UA 4AMBA 4KP7A 1BX1A 2ASEA 2FG5A 3O1JC 3RT7A 2PZAA 2OCBA 1JJVA 1PE0A 2O0HA 3RKUA 2KMRA 1W47A 5LKRA 1SUFA 1YA8A 1NJGA 3TOZA 4DDVA 1ZAYA 2VOJA 3KYIB 4I9GA 5D1HA 5CCXA 1PKEA 2UVPA 1YULA 2A94A 2VLIA 1SXPA 4PW0A 4HFRA 4TMYA 2VHYA 4HBZA 3U81A 1FA9A 1PVVA 2COUA 1CRWG 1DAOA 3ZH9B 1SUDA 2GLXA 1J8YF 3TIIA 3N8HA 4OBXA 3DDUA 1V35A 2O4CA 4Y2SA 3FWYA 3P9KA 4RPIA 4C1NA 2CV1A 1P73A 3IP9A 1H1LB 4GD3Q 4MQMA 4ONEA 1GITA 4HSEA 4ZOLF 5ETJA 4EQ6B 3EZNA 1ZCJA 4QVGA 4RA6A 2Q5FA 3UOGA 1A69A 3EZ2A 4A4DA 2ZYGA 4JBHA 4MTLA 3HO6A 2OCAA 5DHQA 4YXWD 1I6LA 3HJUA 3H5RA 3ORYA 2P6PA 3Q7SA 4FEAA 4G4JA 5AI5A 1MB9A 2R00A 1J2TA 1OHHD 1WXDA 2R7LA 3W77A 5L3SB 4JFAA 4TTTS 4CGYA 5IC4A 2A35A 5DHRA 2NYAA 3C1OA 2R1VB 3FBTA 4OM7A 1KAEA 4IDAA 4HX2A 5JZVA 2RFLA 1NUBA 3R3HA 1TUIA 2C2XA 4V0QA 4BFCA 4IQ0A 4XPZA 1BCSA 1SM4A 4DMCA 5ADHA 4HMOA 3A3OA 3V7FA 3T5TA 1KOLA 1M10A 2O6HA 1G9SA 2REQB 3IMFA 2FZCA 4A27A 4RS3A 1Z33A 1V11B 5CXQA 4C4TA 2G9QA 2VNKA 1HPLA 3SEAA 2G1AA 2NQ2C 2PZFA 4MPIA 1HORA 3FPSA 1NVEA 1UXOA 2F62A 1RHMA 2YN2A 3GG9A 2HJWA 5HRAA 4IV8A 4KO1S 4AYXA 1MRSA 1VDZA 4MR7A 3U4QA 4QIHA 1KVQA 3UMSA 1DCMA 4JBLA 3CMCO 2BP7A 3I2FA 1EJ0A 3FPHA 3OQMA 3CLUD 3JYQA 1LPPA 4QGAA 1XXHA 4MQ5A 1AX9A 1GTZA 3OKFA 3WRYA 5JS2A 4ND8B 1EAYA 1HKHA 4BKMA 4BLUA 4H1WA 1FRQA 3BJMA 2PYZA 3N8NA 4DRXB 2XEDA 2FP4A 4KXXA 1APBA 1F2TA 3L0BA 4UQLA 3LPAA 2G1UA 3DP9A 4G89A 4UE6A 4XZ3A 3WIBA 1FXWA 1YB4A 4OJTA 2YRWA 2CY0A 2IZ7A 3GLRA 4JBIA 4BX9A 2H3EA 3PUYA 4CNBA 4Z1MD 4GUAA 2Z8ZA 5BV8A 1W85A 1ZZGA 1XYYA 1ZJWA 2C5EA 2XZDA 4UUOA 1NMYA 1A50B 1RWPA 1YB7A 2Q6TA 2IYUA 4OLFA 3ZHCA 3I1YA 3BRWA 2PX2A 1SIOA 2V74B 1DIBA 1K5DA 2UZ1A 1ZRHA 2OC4A 3P32A 4EPWA 4B8YA 2ACKA 2DUJA 1SIUA 4H9GA 3DHVA 3CX4A 2HRQA 3LX4A 4O3MA 3MJDA 3U7HB 3V8QA 1V96A 1HE4A 1VBMA 2QG9A 4IH4A 4MW7A 3BRWD 3ZH2A 4IDEA 3V33A 4AMUA 5LQDA 3E7XA 4MNTA 1XN1A 1IMJA 3MFQA 4RA9A 3T8YA 1W30A 3IGFA 3KPYA 2O7SA 3NVMB 4HUJA 4I55F 2EFDB 4OJKA 4BZXA 5IABA 3HJAA 4G5XA 4YMSA 1ST3A 3FCYA 4W8HA 2WD9A 3H2ZA 3KWJA 2EX1A 4Z9XA 1VIMA 1EBFA 5EGSA 5CCMA 2ZGVA 2ZTUA 4HC4A 4D41A 4WP4A 2NU9B 4HL6A 3LY8A 1CETA 4CMCA 1RZUA 1JR4A 1PK7A 2OCXA 2IDKA 2J5KA 3UGLA 4KRXA 1CGJI 3AX6A 3HK2A 2KBEA 3BMQA 4OHFA 2QYSA 3LYLA 1H4SA 1A72A 3IE0A 1X15A 3VDNB 3UANA 4GMHA 1G3QA 2RH5A 3U4HA 4REQB 4DUGA 3SVZA 3R5KA 5IDWA 4CXMA 4DLBA 3QY9A 4G4SO 2GN1A 1P7YA 2ODNA 2C9OA 3ETHA 1SHTX 1KZ4A 1NTOA 3LBNA 3M89A 5J8CA 4FHZA 4RZ3A 3GJSA 4YNBA 5DGXA 3TL2A 4FB5A 2BR3A 2HU2A 1DUSA 1OAOC 3ECSA 2QNIA 3PNMA 4H31A 4OKSA 3TLMA 1BU8A 4YMLA 3PFBA 2NTYC 3W5SA 3HS3A 5B7QA 2IVZA 1NVGA 2VK8A 5E6RA 4XLLA 2AE2A 4V0ME 4BFSA 2HLDD 3G2HA 4DT1B 5JSUA 3FY4A 1YE5A 4D46A 4D8XA 4DFDA 5DIZA 5A62A 2EP5A 4A0GA 1UFQA 2ZRKA 3L7IA 3SYKA 2NP7A 3G9QA 3HLKA 3L7NA 1I2AA 3EA4A 1FZTA 2JF0A 3HB7A 5BR8B 2GYUA 4Q4JB 3MRXA 1RAAA 1Z5OA 4LHVA 4PTZA 2AHOA 2XCSB 3IALA 1IZYA 4P0QB 2QTMA 1AMOA 3OQHA 4JI1B 2Z1DA 5FTWA 2DWPA 4CHTA 3TBHA 3BIJA 3O2SB 4X8MA 1HTBA 1ZK2A 2G28A 3SS8A 1O9HA 3C1TA 5FWYA 2H0QA 2RIRA 3KE9A 2YVLA 2WWRA 3ZV6A 3FF4A 4IDGA 1AZTA 2ZYUX 3DKKA 5LD2B 2Q99A 3QWHA 4ZC1A 4W1QA 1GCAA 1Z2OX 3LRTA 4G4GA 2Q4RA 3NBZC 2YCBA 2ADOA 2I4OA 1OH5A 1Z0DA 3FGNA 1XTSA 2EYQA 4X1IA 1CY6A 3ZE6A 3WL3A 1Q1NA 2X3FA 1O0BA 1II9A 1XJ5A 3EQ7A 4CT0A 4LK3A 4E4TA 4F97A 4KFUA 1FBNA 4QE3A 5G02A 1T9GS 5AW5A 1Y3DE 4NP6A 1VSVA 1TKAA 3WGHA 3FOAA 5C1OA 2CJSC 4NCBA 2HIHA 4J0QA 1NJ2A 1XKLA 3U62A 2G72A 2FPOA 2V7WA 4NULA 4BVKA 1T9DA 2GZ2A 3C1UA 4FYYA 3PK0A 4PFJA 1WMAA 2P9ZA 1HNXB 1WCIB 3SG0A 2GK6A 2QN8A 1T9BA 1A9SA 1ZVJA 2ZLBA 3OOWA 1I5RA 2AOTA 4E5VA 4EG0A 1D1PA 2QD1A 3SZLA 3IO5A 1ITZA 3KJIA 2BFFB 4RK0A 3C74A 4KQFA 4IO0A 4RF3A 4MULA 4ALLA 4LYAA 3CSSA 2JZMA 1JJBA 2BGNA 3QJ5A 4NNOA 1M1ZA 3DE4X 1JT9A 3I9OA 1SD1A 4P4TA 4XJXA 3DMTA 3FMIA 5AM1A 2Y99A 2YIVX 3C39A 4Z8YA 4FR0A 4F2DA 4WK2B 3H0EA 5F9FA 1YZKA 4DC0A 2DPGA 4X6XA 5FO1A 3ND5A 2DWUA 5ADWA 2VNJA 1JIJA 1G5TA 3H9UA 3X0DA 3GJYA 1YWGO 1ZD4A 2XD9A 3BWXA 2VQDA 3N7AA 4OGKA 3UHJA 5AHOA 3TKLA 1V39A 4TYMA 3O26A 1XAGA 1KFEB 2CWWA 2YHAA 1CQJA 2FYTA 4RZ2A 3WGIA 1KJNA 2PH3A 3F74A 5CH3A 3X3HA 3IQZA 3ZY4A 1B8VA 1D2HA 3ORHA 1FLVA 4CFZA 2FQ1A 2C9YA 1P6UA 2EBFX 2PA3A 4PO3X 4PYLA 2GYWA 3FSEA 3KFXA 3OZVA 5CX1A 4MSUA 2BV3A 3T99A 3WB2A 2ZJAA 2IUSA 1UUFA 3FF1A 4JC4A 4RDCA 2DBVO 4E3WA 5KX5A 5H68A 3DAFA 1WY7A 3JYNA 1XC7A 3BEOA 2YN4A 1XZJA 1NLYA 1YO6A 1ZRSA 3PDWA 4RHCA 1TVKB 1XHFA 2KLHA 4Q39A 3GGOA 4GX0A 1JP7A 3EA0A 3QPDA 5FQOA 3VJRA 1RTKA 2HXSA 5FBWB 4YAEA 3U1VA 2WR8A 1L5OA 2MDTA 4G8CA 5AM2A 1HG0A 2YXLA 2CV2A 1POXA 2IVFA 3P2OA 5AKYA 5EX0A 1C0PA 3G7UA 4E51A 1TQ8A 5FOSA 4ZZ3A 4JVMA 2HCTA 1O08A 1Z4OA 3STYA 1RXYA 3KR0A 4DDHA 4DSNA 4KN8A 5EIBD 5CMLA 1GGJA 4YO8A 5HDQA 3THSA 4B84A 1AGRA 5KINB 4IF4A 1WOYA 3FB4A 1UXJA 8GPBA 4DWWA 5DHFA 5CIQA 1O95C 1Q0QA 3CEAA 3BWMA 5H5JA 2IRWA 5KTMA 2IBMA 2PQMA 4KPUA 2JZNA 1C81A 4E12A 4BTVA 5E9QA 4DBLE 1N2SA 2RCNA 4R05A 3V4ZA 2FE4A 4HVCA 3DL4A 3DEZA 1UM9B 5JISA 2PT5A 3SHQA 1NDHA 2P2DA 2EZ4A 2I3ZA 2C8JA 5C9ZA 4JHXA 1VCOA 1VE6A 4KAAA 3GWGA 2QQ0A 1WKCA 3VDPA 4Z9BA 4YQEA 4CQMD 2AF4C 1A8UA 3F71A 4TRNA 3R09A 3WWPA 3WYDA 3ZIAA 4JU8A 3D1LA 3ZU3A 3I28A 4GXTA 2PZ8A 1F2TB 2W2NA 4DLSA 4J7CA 4YI5A 4WA7A 5K1ZA 5HIJA 1H3FA 1CZNA 2QA5A 3FFBA 3RS4A 4Z3OA 2E73A 4A23A 1QYXA 4J49A 1JFSA 3H5AA 1ZONA 2HO5A 4Q3LA 3KBBA 1ZQ9A 4MPJA 1IY6A 3EDCA 3MXOA 4X93A 4OXNA 5P21A 3LUCA 4OPMA 1P2BA 2RHOA 5BWNA 4NJMB 2N1AB 1U8EA 4DW8A 1U0HC 4YAOA 3IFSA 4E08A 4ZOLB 1DQPA 1TW3A 1WULS 3CQ9A 3PKIA 1F0PA 1TCBA 2Z95A 3U2QA 2CWGA 3N74A 5B64A 4FX5A 4DIOA 3BHMA 2C2MA 4RJJA 4DNOA 2GK7A 2DWCA 4Y6RA 4C4YA 3KJQA 3GRPA 5AUNB 2QR5A 4BJHB 4ZAVA 1R0KA 1MHPA 1QANA 1JHYA 2R1TB 3AVUA 1L3IA 2EGUA 3D81A 3G85A 4PRYA 2G1JA 3DEFA 2AW5A 3RU2A 5ABPA 4CTOA 4RF5A 1G8PA 1P8AA 5KO2A 3ACBA 4IGFA 3AQ4A 5KU1A 2DGDA 3MIIA 4ARSA 2XADA 2BEUB 2LCIA 5INTA 2OCYC 4KQXA 1RLUA 2XUFA 3TEJA 3GL9A 2Y66A 4B48A 1QLWA 3R7LA 5A2GA 2ID8A 3DFZA 3FYUC 1L7AA 4EPRA 2O14A 2I8AA 2VF8A 4BNYA 4BO3A 1QHNA 4G85A 3HKDA 3KDAA 4M38A 2NN3C 4IFTA 5EIFA 1Q19A 4MDFA 4QOSA 1C1DA 5FNVA 2NTNA 3V7NA 2I34A 2PLNA 4EQ6A 1RJFA 3HL0A 4QGSA 1V4NA 2B8EA 3MJRA 5HK8A 2R1ZA 3H11B 4JJ6A 4F85A 3K6SB 4ZVNA 2ADMA 4TVBA 1UMCA 2ZXUA 4U02A 2POQX 3M7IA 4BX3A 3VR2D 2BCGY 3RGWS 4MKZA 4R2KA 2PUBA 1AHNA 1UMBA 1RLIA 3GVIA 3C24A 3ZWDA 4A6PA 2P4SA 4JJGA 4CMEA 2J59A 4D8TA 4CIWA 1L8XA 1VYHA 3KYBA 3ROGA 1GKLA 4IINA 4R1UA 1IXYA 5CLIA 1TMKA 3CEPB 4IG4A 5REQA 3RWOA 5FPHA 2DAPA 4LZPA 2ZYHA 2JIOA 5BWOA 2RHHA 4LY6A 1QUEA 1YV9A 4IGIA 2JLWA 3KEFA 4AMLA 4QJ5A 3LSYA 1SCUB 1M2HA 2X2EA 3M81A 3AHEA 4P7KA 2IYFA 2Z1NA 3NDPA 2PQ8A 5KB3A 4QTTB 3LF1A 3OXFA 3DXZA 2VG8A 4DYVA 3CVOA 5CJJA 1RFLA 3BWYA 4G63A 3RK1A 3WLFA 1J49A 1XA3A 5HHTA 4MI9A 3I2YX 5EXTA 4PNZA 1Q15A 1YZFA 4BNLA 2P4EA 3EE6A 3ICWA 4QQ8A 4TXJA 2W6MA 1JNYA 1E9DA 2ZIEA 4LWQA 2J3DA 5F5LA 3RS9A 1EIWA 1JJAA 1SG9A 4M49A 3RUCA 1T2FA 1X7HA 1VP3A 4NYIQ 2Z30A 3Q7TA 5BR1A 4K87A 1ZZEA 4UJ5A 3B48A 3EVAA 3LMKA 3DM9B 1O0SA 3UMMA 3LBFA 1A9QA 3I1FA 3CH5A 3A1EA 1G8KA 1GFZA 1RE1A 1X1QA 2DKOA 3F4KA 3FLAA 3QLEA 3BJIA 4JUAA 1KMCA 4OMFG 2DPYA 1HE8B 5L51A 2ZEJA 5D8DA 2WVHA 4BVFA 5J4LA 4NYMR 1RWWA 1RM0A 4WT7A 1FVXA 2ARPF 3E1KA 3MPUA 4Z4EA 3T9CA 3VHLB 1KY2A 4LKRA 4YCJA 1VA4A 4EHAA 4HTFB 3B70A 3IURA 5F76A 1EYZA 2BUAA 7ABPA 4EB6A 1OFGA 1TA0A 4HQFA 4TT8A 2FZLA 3L4BA 2CLDX 3AR3A 1SXJA 4EH1A 1KI1A 2AI2A 4G8DA 5BRAA 2O8NA 1B8OA 4L2IB 1PWEA 1R27A 2AFIE 3RYFB 3RVBA 1Z7EA 1UEIA 1N0UA 1QH0A 1MJNA 2FCAA 2FY8A 4KUGA 3U19A 3LZDA 4L3VA 1L4UA 4BE4A 1Z18A 1KBOA 1SR8A 1O96B 4MS1A 1VGRA 4YJGB 1ZGHA 2XD4A 4U9IS 3MA0A 1GKKA 3MT0A 1M73E 1MFPA 1QH1A 1Y33E 3QWIA 5F1OA 2BMJA 2GZMA 3A1WA 1KJIA 1VCMA 5I4CA 4R9RA 1ZK4A 2VWPA 1SCIA 1V7QA 3FXAA 5CDSA 5FBRB 2CMDA 3TNJA 1SPBS 4N65A 1E7RA 1LBTA 2Q3JA 4FMDB 4TWZA 5HA5A 5LDGA 3TSYA 3DL0A 3TTVA 1I2CA 3JYLA 1GNTA 3G5UA 4LDZA 2HDHA 1XLUA 3GQVA 1P60A 2HMAA 3PI6A 4KUHA 2OBBA 1VHQA 5AK6A 4DANA 3EGOA 3BMNA 4PQGA 3J7AC 5C8YA 1SOAA 2FFBA 1BKYA 2WOJA 4UQOA 4ECEA 4O2LA 1LFDB 2FZGA 4D99A 5KQGA 2LCQA 1GQOA 4NMHA 4DB2A 2GAFA 3W3AA 3KTAA 1WP4A 5BPFA 3P0EA 5DNYB 5F4ZA 4C4AA 5DBOA 3C3DA 3NRCA 4OG2A 4BV2A 3UH1A 2A0YA 5JMTA 2BR4A 3AEYA 1MJHA 3KT3A 4GDFA 5CA0F 3GCXA 2C5FA 2JLUA 2BFCB 1U2EA 3KD3A 1Z47A 1T0UA 1A9RA 4Q1VA 4PSAA 2XCQA 3UXMA 2EJWA 1ADCA 2PJZA 2AOUB 3IPLA 1ABBA 1HMPA 1S1CA 1M6EX 4E11A 5BV0A 4UBIA 5KPJA 5CBPA 5K3EA 2BM9A 4B0PA 3SJAA 3W1VA 3MXTA 2YWHA 4P7BA 2ZKLA 5EP1A 5EP4A 1G21A 3PKZA 3QUQA 2WY2D 1QO0D 2QN3A 4ABTA 2UV8A 1XTJA 2QYTA 3UJNA 1AQJA 1RQNA 5CVJA 3FWHA 1W2GA 2QD5A 4A0FA 3MMZA 5FWXA 2P9FA 3BZBA 3UWKA 2WJZB 4BPBA 1CP3A 3KQWA 3QHAA 4EIWA 4M9SA 4J4BA 1U2ZA 2UYGA 1NXQA 2W7TA 4OXIA 4QG3A 1GTVA 4XGKA 2PNJA 2AB0A 1W19A 2CCJA 4RMJA 1T2NA 3GU3A 4EUKA 4L2IA 2BGRA 2GN9A 2CN1A 3L0IB 5B2FA 1YL6A 3TIGA 1GLGA 1O87A 1B1AA 1E7SA 1MZVA 1J4AA 3AEZA 1UKEA 3M6LA 3ODGA 3QSGA 2QU7A 3FHJA 2ETXA 4IP0A 1K63A 4K40A 4CUZA 4DQXA 2C8VA 4BY9E 1ID1A 4M0KA 1EUDA 2C03A 1TF7A 3ITDA 4IILA 2HRBA 3UJPA 1K7YA 1SU4A 2NO4A 4KNWA 2CJFA 1B2RA 4DNQA 1NXVA 3L8MA 3MC1A 3QEKA 4QAQA 1IW4A 1YCHA 2IE8A 4EEKA 4MR9B 1U8AA 4DZRA 4GXNA 2BR5A 4C21A 2WQ6A 4QNMA 2QE7A 2CDAA 4R8KA 3UJHA 4FNAA 1Y3BE 2WYUA 4UAJA 1J7JA 2P5TB 1VFNA 4PYOA 3CE6A 2WB2A 4JU9A 3CEHA 4WFQA 4FXOA 3A10A 4EKDA 2R66A 3F8WA 2CXQA 3WOHA 2GAIA 5TF4A 1LBHA 4HFJA 3Q3GE 1QONA 2GKGA 5EN4A 3TNDA 3AFMA 1LDBA 1Q21A 2W6OA 5GOZA 1DL5A 1FYWA 1MDBA 1QV6A 4Q66C 3T4EA 5BRJA 4KQCA 2FFRA 3GRCA 5LZ2A 4ZOEA 1D6SA 2HSJA 1HDEA 5K2MA 3QNMA 3D4IA 1KO1A 4G1MB 3OU7A 1NBAA 4DQLA 3FOWA 3ZPXA 3SSOA 1MQSA 1XWWA 3RKRA 2ZSEA 2BKLA 3RU9A 4GKJB 1Z07A 4OK5A 4XSVA 3T7TA 2VQ6A 3QF4B 2JFYA 5HZHA 1CG6A 1RHRA 2P79A 3CPSA 4N6OA 4QGHA 3PT9A 3JQAB 1NGSA 2NZXA 2YJ6A 3GA5A 1CIJA 2F43A 2HB6A 2CVPA 3U3JA 4AJOA 4D1YA 2NV0A 1UKZA 4X8OA 5AKGA 5DNVA 4AZWA 2FFJA 3OJ0A 4TQGA 2MJLA 2Z8YA 4GFDA 3LK6A 1Z2EA 4QX6A 3TQTA 5C18A 1ZSVA 4PR3A 3HA3A 2ACWA 1UH5A 1GAXA 1R50A 2C97A 2GMWA 1WABA 3C16C 4MX8A 1YS9A 2EZUA 4YJKA 4Q00A 3SFTA 1IM8A 2E5RA 4XH9B 3QU9A 4MUKA 2AV6A 2PYIA 1AUOA 3N3BC 1B14A 1N2XA 1XP5A 3BB4A 1V1HA 4UNSA 4ML3A 3HYRA 4YFVA 3RTCA 2Y76A 1ZNYA 4BZPA 4L76A 2V6GA 2H1FA 4DSUA 4EUNA 3QRWA 1WF3A 3HPRA 4NOJA 5TARA 3NANA 3VTZA 3HYLA 3JRNA 4CEIB 2XDQB 1VE5A 1XTPA 3F73A 4UTOA 2CLOB 1MJGA 1UFRA 1EEHA 2W2LA 2WSSD 5ALHA 1J24A 1EGQA 1GZVA 2I6QA 2LWIA 3DFUA 2IPOA 3QVUA 4JB0A 2XH8A 5AUQA 4DLYA 5BYKA 1E2PA 3KSMA 3IAS1 1P80A 5AJXA 3T7SA 3WLKX 5JXIA 1US8A 1UKVY 2BMWA 3Q41A 2O8FB 2O07A 3R0VA 2FB9A 2JGEA 2JASA 2I76A 1MD9A 4KR3A 4ZI7F 5DBIA 1T6YA 4DRYA 1AS0A 2O2EA 1CQPA 1RXIA 4O8ZA 1DEXA 5F98A 1I2BA 2RH4A 4CIBA 2XDWA 2J1LA 1I24A 1FUIA 1Y4SA 2DQYA 2ZS7A 3CLSD 4NBNA 2FCRA 5E8JA 4DIDA 1KKMA 3PA8A 1WSAA 2BEWA 5K0LA 1L4EA 1VYVA 2GTHA 3CB2A 1DRUA 3RYCA 1HE3A 5FNZA 3FCOA 5HMMA 3E18A 3N8DA 3EZ9A 4LOKA 1ICIA 2TMYA 5EL0A 2CNOA 2XTMA 3CUUA 3REOA 4NMLA 2A58A 3QBVA 1RJWA 1V2HE 3EVGA 1S8OA 1EEXB 3R0ZA 1KFJB 3EUWA 4MYDA 2HWUA 2I71A 2P2LA 3WRYC 3RRYA 1GY8A 3G6KA 5EJ5A 2YZMA 1FJ2A 2IBSA 3OTIA 1CJUC 3KAJA 4UAVA 3TLEA 3CLTC 1DC4A 3WRXC 2VUIB 5FJIA 3ELBA 3VR4A 1IQPA 1NR1A 5CB4F 1ISJA 3HA7A 5AW6A 1K66A 2SHKA 1ZLYA 2I1LA 3DV2A 4J0CA 4MDEA 1BJRE 3B6ZA 1BXGA 4AYTA 4N40A 2WSBA