2UZ3A

Crystal structure of thymidine kinase with dttp from u. urealyticum
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
207
structure length
190
Chain Sequence
IGWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKISVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIKFFKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structures of Thymidine Kinase 1 of Human and Mycoplasmic Origin
pubmed doi rcsb
source organism Ureaplasma urealyticum
molecule tags Transferase
total genus 51
structure length 190
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2uz3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2uz3A01
4LBYA 4PO9A 4B47A 5CITA 2LCFA 4C0LA 5KSOA 1NVUQ 5J40A 3OFND 3QVVA 4GFDA 3WRYC 1UKVY 2NG1A 4PHTA 1IN8A 1G20E 2QQ0A 2GVZC 2NO9A 3SJAA 4A6PA 4TL7A 1T3HA 2RGAA 1QZXA 4RY2A 3NEYA 3SZRA 3SEAA 1PLKA 1NVWQ 1MOZA 3K0SA 2ROWA 1G16A 1SQ5A 1IAQA 1NKSA 5DI9A 1SXJC 2VSXA 4RD3A 3W5IA 1E2JA 4FINA 1XPRA 2XOKA 4G5OA 4PPGA 2XXAB 2XZLA 1E0AA 4B76A 1G41A 3PEVA 3KJEA 3K70D 3HWSA 1X6VA 2QP9X 1FNNA 1K8RA 1FQJA 1KMHB 3AKYA 2AWOA 3OIUA 3M6AA 4LV8B 2XTMA 5HTKA 1N0UA 2JLVA 3W6OA 2Z5FA 1U8YA 2O52A 1XDBA 3EPLA 4ON9A 4A8JB 2J0UA 2QP3A 1G4UR 1KSJA 3H84A 221PA 5F9FA 3QUSA 1GWNA 5BN4A 1LF0A 4FCVA 1JAIA 2ODWA 3WYGA 4A0GA 1NN0A 1HV8A 1KDTA 3I3SR 1HT1E 4RZ2A 4BFZA 5JI3E 1Q1BA 1KAOA 4P3YA 3OEED 4ACBA 2ZJZA 3VR2A 3I92A 3WMEA 4FKDA 5FL7D 4FXPA 1E9CA 1G3QA 2IHYA 3A4LA 3LQQA 4UJ5A 1IN5A 5G3YA 3EWSA 1E96A 1P62B 1BS1A 2GZHA 3AGPA 2HT6A 4PPNA 4RFSA 1ZVQA 1KSHA 5EE0A 4UXIA 2GCPA 2PL3A 3D31A 4LY6A 1CR4A 2QTHA 1NJGA 4RZUA 1PTRA 1XEWX 5KNCA 3OF5A 3TJZA 5GADl 1CRPA 2PCJA 1OFTA 2OAP1 1WMSA 2O8DA 3N70A 4B2LA 3FVQA 4DUGA 4LHZA 2AKAB 1JXMA 1TU3A 3HR7A 2QRNA 4TLBA 3Q9LA 3B7GA 3ASYA 3MWYW 4DCVA 4QGAA 2CHVA 3VR5A 1KI6A 1ZCBA 2WKPA 3PUXA 2IYZA 1NMZA 4F4CA 1N6PA 2EW1A 2A78A 2H1LA 2Q3HA 3B1VA 4B73A 2JAQA 3H4MA 3BB1A 3KTAA 3D3QA 2XSZD 3QJYA 2ANCA 3CR8A 1AKYA 1EX6A 4E07A 3BFKA 4B33A 4N0EA 2WSSD 3AB3A 2GJ8A 4B3XA 1I4DD 2OM2A 4BFYA 1XPOA 2IYXA 2J41A 2F3TA 2ZI3A 1D2EA 3MMPA 1VPLA 1E9FA 3RSOA 3RLFA 4V0KA 4Y0AA 2QPAA 3EIEA 4OI4A 4RZ3A 4D0GA 1CF4A 1R4AA 3THXB 2FU5C 2XZOA 2IYUA 1W4BA 4AY2A 4LJ5A 2ZPTX 3P26A 5FTJA 1II8A 4OQNA 5L3QB 2OUKA 4FW9A 4OK5A 3ZVLA 4HSEA 3Q85A 2WIBA 3PFIA 1NKTA 4LI0A 2PZFA 3RRYA 1GNRA 1T5IA 2C2HA 4B6FA 1QG4A 3P27A 1GNQA 4TL8A 3P1JA 5SZKB 1PVOA 2EU8A 3KKPA 2X8AA 4Q7KA 2BV3A 5G3ZA 2CL6X 8OHMA 1TQ4A 4MRVA 2D74A 1CKEA 5FTLA 1X8KA 3HP1A 3PVSA 2XJ4A 2NOAA 2GCOA 5CLQA 3WYAA 4HZUA 4X8OA 4OHZA 5DO9A 1KHTA 3KL4A 3W8NA 4EJSB 3MG9A 2ZANA 3CRRA 3GFTA 2VP4A 3K0FA 3B9QA 1Z28A 1ZNWA 2J7PA 1KZGB 4JL5A 2CJWB 1X1RA 4QJ5A 3C8UA 3GFPA 4MUAA 3RS5A 3RC3A 1GKIA 4YXWA 1WQ1R 2G0TA 3VQTA 2HXYA 2IUSA 4TLDA 1E2PA 3BGWA 2P5SA 2SHKA 1XFAA 4JVSB 4QRHA 3LAWA 1Z0AA 2XB4A 2W0SA 1IM2A 5FOTA 1ANKA 5CIQA 1BO6A 3JZAA 1UKYA 2ZUDA 3IIJA 3T5GA 1OXSC 5FPKA 4LBWA 5CYPA 1L4UA 2I3BA 4GP7A 3QG5A 3L0PA 4EUNA 3THWA 4PZZA 3SOPA 3WP0A 5EE5B 5L3RA 2ZVPX 4M1KA 1GL9B 2V9PA 3HPRA 1GM5A 4NCKA 3K9GA 2QMOA 3AF0A 2ZAOA 2PLFA 1YQTA 4UKDA 2EFHB 3I32A 4XSGA 4TQ9A 5KDDA 1KBEA 3IEUA 4Q4AB 1F2UA 4URWR 4ESVA 2IS1A 2KI5A 1JECA 3G82C 3LDAA 2V54A 5AUPB 1N6IA 4NE2A 2YWFA 1V43A 1XD8A 2O0KA 1W36C 2O8BB 1TBOA 1KJWA 2NZJA 4B34A 2Z0MA 4FMDB 5LB4A 4GI7A 1DEKA 2OCAA 2ZJAA 1TL7C 4FN5A 3QI2A 4WXRA 1Z6YA 3AH8A 4OQMA 4P4UA 5CK5A 2FEOA 3R7WB 4R2HA 2QEQA 3DKPA 4OHYA 2WJGA 1AQUA 3A8TA 1W4CA 2RGGA 4JLAA 3K09C 2C77A 3ZVNA 4UXJA 5FI1B 1E2EA 1G3IA 1XA6A 3FMPB 2XGJA 1U0HC 1P9NA 3IO5A 4BZPA 4G5SA 2QL6A 2ZI7A 2EYQA 2B8TA 4Z8XA 3B85A 1NVVR 2ZSDA 5GJVC 1NJFA 2YWGA 4ZKEA 4P32A 4HB3A 1T0HB 5FBRB 3IBYA 1VKJA 2H57A 2C95A 2CK3A 3H1TA 3LLMA 4M22A 2FPKA 2YINC 1CTQA 1Z3IX 3UGIA 1ZAKA 4JLBA 1E79A 1FZQA 4KHZA 4IXMA 2ATXA 2W0MA 4KU4A 3FFBA 4R98A 3G0HA 3LX8A 3KFVA 1KNXA 1YR7A 2EQBA 2RGNC 1M34E 2ZE6A 4CEIA 5FOUA 4ZPXA 1XEFA 1MT0A 3LVQE 1UDXA 2FX3A 5B64A 4GOJA 4QOSA 4XTCS 5DYIA 5G53C 3WRXC 3J81k 3THYA 2QAJA 1ZU5A 1FMJA 1DADA 1KIMA 2FGJA 3LBHA 5TXGA 2BWJA 3BC1A 4Q02A 3D6TB 4TN1A 1A5TA 4CGZA 3K09A 1NVXQ 3PITA 2IHBA 2GXSA 5J4LA 1E1QD 1VTKA 3D8BA 4B32A 4F91B 5JMTA 5EQTA 1S0UA 1IN4A 2ZRHA 2HF8A 3IUYA 1DS6A 4IW3B 4JJZA 4DLXA 4XWOA 4FCTA 1U8AA 1JAHA 4D2IA 2J0VA 5E7IA 2VYFA 1MKYA 4N3NA 1EGAA 2ZRLA 2QNRA 1NG9A 4GOXA 2GK6A 4TSFA 5FOVA 2P5TB 2HYDA 1E2FA 1QHIA 1Z6AA 1G6HA 1GIAA 3NH9A 2PZEA 3GLFA 3ZD6A 4F4JA 3MUFA 1R6BX 3CNLA 4DZZA 1CP2A 4HAWA 4M9ZA 1VYTA 3LO5A 3T1QA 1NN5A 2RGNA 1TQDA 2ONKA 1UEJA 4POAA 1Z0KA 2ZE8A 4B3BA 2OCBA 2OAQ1 4RFSB 2L0XA 4M1SA 4PC7A 4ERNA 3CPHA 4PX9A 3FGNA 5E95A 4MRNA 3RNLA 2QE7D 4EDHA 3VTKA 1M1YE 5E3HA 4D0NA 4Q03A 5KPDA 3TVTA 5EP1A 3UGLA 4OYHA 1FUKA 1NMXA 1E2DA 1ODFA 2QP4A 1II9A 2ZYTX 2EFGA 2R6FA 3B13B 4RD2A 1KO8A 2AFHE 2VIIA 3AEZA 3UIEA 1WBDA 3U7FB 5IRCD 1T5LA 4DEXA 1EWQA 4XJXA 1A4RA 2O8DB 3TSWA 4Q01A 2IS4A 1ZUHA 3U2QA 4JBYA 1P61B 4U5XA 2BBWA 4ZI2A 2GJSA 1KI6B 3T34A 1PLLA 2G77B 4YDSA 4BFXA 1T3LA 2VSFA 4GMDA 1G291 4B2PA 2PX3A 2JATA 2AD5A 3B1WA 4MYUA 2IYTA 3CRQA 3PV0A 3EIQA 3CW2A 4I81A 3M1IA 4NYIR 4V02A 5KNBA 2QSYA 1Z29A 1UF9A 2WOOA 1ZUNB 1OB5A 2YUUA 2Q21A 3NDBB 4IDHA 1TF5A 1YE8A 5AJZA 3VR3A 1RZ3A 2YOHA 3AP1A 3T12A 4M1YA 2ONJA 1OHHA 1NVVQ 4AC9A 1KMHA 4LUCA 3GMTA 4M9XA 5JJIA 1OPXA 4C0SA 1VECA 3CPJB 5FBQB 2O8CB 4B6DA 1Q1ZA 4F92B 1E0SA 2WJYA 3RANA 1NL3A 4JT4A 5GJCA 1II8B 2BMEA 3UMSA 2ZRKA 4G0NA 4TTQA 2XOKD 3CX8A 2QAGC 3FKQA 1T8TA 4D6PA 3MJHA 5FPYA 1OF1A 1ZU4A 2ZSEA 1OH8A 1C1YA 2RHDA 3ZGXA 1NN3A 4Q00A 1N5IA 4AG5A 5JLJA 2ZS9A 1K5DA 4ZDJA 2AN9A 2ELIA 3CB4A 4A2QA 721PA 4S35A 1XTJA 4IVPA 5TDHA 3JZMA 3I61A 1Q21A 1R0WA 1VHTA 1S96A 1ZIPA 1ZP6A 1TPZA 2UZIR 3EIHA 3H86A 3NC0C 3KQNA 3SJCA 4JKYA 5KHOC 1CLUA 2ZRPA 1GNPA 4OHVA 2Q9AA 2VSOA 2PT5A 1TUIA 2E73A 1C4OA 3NVAA 3PUYA 4IOKA 4Q1FA 4V0LA 1KTVA 2Q3MA 4TQAA 4XSHA 3SC3A 4F93B 4HZUB 1CULC 3VR4A 3UWKA 2ZRMA 4QBFA 1KKMA 3HDTA 1KK3A 1E94E 1XX6A 4ZI3A 5C46F 4TYNA 3K0FB 3IILA 4UNNA 2VP6A 2HYIC 2JIZA 2KB0A 1UDWA 2I1QA 4HEJA 3WHLA 2P6NA 3B5JA 5FH9A 3L82B 4RVCA 2ZVQX 1G3RA 2A5FA 3BORA 2JDIA 4Q4HB 1HUQA 2ZEJA 2O0JA 1S3GA 4NDZA 5FR2A 3AF3A 4Q48A 1SXJD 1OXUA 1RC8A 4TYYA 4BLSA 2NO6A 2QGNA 1UJ2A 1Q0UA 1TADA 3U6BA 1Z8FA 4WAUA 1LF5A 3F5FA 2QAGA 4YMVA 5EE3A 4WW0A 1N5KA 1ZM3A 4K8OA 4LJ6A 1COWA 4DUGD 5IT5A 3TIFA 2B7BA 1OJLA 1NIJA 2K5UA 3LXXA 3GEHA 4KODA 4TTPA 4KFSA 4X8HA 3AUYA 1HURA 1EWRA 2BMDA 1E4VA 1F6BA 3C15C 2DB6A 4URVR 1DAKA 4LJ7A 3W6NA 1ZD9A 2GDJA 4CVNA 5FUXA 2KSQA 4U02A 1XTRA 1UFQA 2W83A 2QY9A 4IFBA 5L3QA 3QEJA 1U0LA 4LJ4A 5BYJA 2OLJA 4UNPA 4DLSA 5EUMA 3ADKA 5FR1A 4KO8A 5AWFC 5H70A 1GOTA 1G8FA 3GJ8A 3OEHA 4NPHA 4O2LA 4TYPA 4YONB 4AK9A 3IHLA 2GAAA 4XVRA 2JLQA 5BN5A 1AN0A 1IXSB 1F2UB 4QJ3A 3BE4A 4BRWA 1E0KA 3W5JA 1RRCA 4HATA 2FFHA 3MD0A 4KLNA 3DZDA 2IW3A 3VMFA 5GVRA 1HT2E 2Q9BA 4JZKA 2NGRA 4NBSA 3GJ5A 2ORIA 4WOPA 1OKKA 2HF9A 4Q7JB 1F60A 4IOJA 5JRZA 2B21A 4AKGA 4MKGA 2WWFA 2V6IA 2YJTD 3RAPR 3WBJA 3C5CA 4KFRA 4MYCA 2BOVA 3B60A 3DM9B 1S2MA 2IXGA 1FTSA 2VF8A 3HU1A 1ZBDA 4CIDA 1GKYA 5JRJA 2VPPA 1Q3HA 4IDOA 4MRPA 1S8FA 1F2TB 1CIPA 3LV8A 2IYQA 3BWDD 3PUWA 4NTZA 3PXGA 5GJBA 2OV2A 2HJVA 4TLEA 4MKFA 1ZC3A 5L3SA 4IFEA 4P33A 2ZJOA 2F1IA 1XP8A 2J7PD 3K8YA 1P9WA 2FSHA 5ELXA 5C4MA 2BBSA 1N2CE 2YOFA 3RRNA 4JIMA 1NBME 4YXWD 4C3ZA 1G3MA 1ZJ6A 2IYYA 4IEIA 1CS4C 4M0LA 1EG7A 3OE7A 4Q18A 3A37A 1W36B 4CEIB 4BZXA 1OE0A 5FBWB 1GILA 1ZD8A 1F5NA 3EAQA 2NTYC 4FMBB 4AKEA 3K0AB 4LGMA 1FPMA 2DWPA 5IF9A 4U7DA 1S4QA 4MDEA 4FWTA 4UXHA 3VHXA 1T6NA 1OT3A 2UKDA 3MJRA 4ZCLA 2FWRA 1E6CA 4QBIA 2DB3A 4FD2A 3FHOA 2R6GA 1U81A 2D06A 4Q4AA 4RFVA 2O0HA 4LV5B 4M9QA 3A1VA 4MRRA 2BCGY 1N6NA 4IDQA 5CLLA 3K1JA 1UBCA 4LHYA 1BKDR 4IKEA 3AGQA 4ILEA 3MWJA 1II0A 2KWIA 1G8HA 4OI0A 1N6OA 1FQKA 1NLYA 1J90A 3F3YA 3FTQA 4M2LA 1DELA 4JVNA 3MLEA 1DAMA 2W2VA 2ZJ2A 2CMKA 3R7WA 3SDZA 1M8PA 2GZDA 4AIIA 3TAHA 2H8KA 2JCSA 1A1VA 3CF6R 4L5BA 5FPTA 4PPFA 1CJVC 1XZQA 4DLWA 4TZ0A 3ND8A 2WPDD 1A7JA 1E69A 3RS3A 3B1ZA 3ZIAA 4GMXA 2BBOA 1NIPA 1EFHA 1AZSC 1GTVA 1MH1A 5B30A 5TB5A 5JS7A 3IPYA 2KBEA 2PBRA 4M1TA 2RGEA 2JJ8A 1OFHA 1R0ZA 1E9SA 4D4MA 1JALA 2ORVA 1UAAA 3UFFA 4PHHA 3GJXC 1FP7A 1XMIA 2GNOA 1KJYA 1XTKA 3TSZA 4LZZA 2EFDB 4UNQA 2Z4RA 3D7MA 1E2GA 3CONA 2FGKA 2JEOA 2ZRGA 4DSTA 2JLZA 4DDWA 3OIVA 3TNFA 2XNDA 2FG5A 3B82A 1RVDA 2Z6VA 3U61B 3KQHA 1IBRA 4GBMA 2IUUA 1P9RA 4XTRA 1E79D 3RS0A 3LXRA 2XX3A 4W5HA 5KOYA 2CVHA 3QQ5A 4B75A 4YQFA 2AXPA 3WYFA 2BEKA 3TQFA 2NIPA 2FZ4A 1W36D 3ZQ6A 3AVPA 2A5YB 2GAOA 2G6BA 3HJNA 3PEYA 1GL6A 4ARZA 2F1RA 2PMDA 2G3YA 3A4NA 4O25A 3QPVA 3TUIC 1KAGA 4PHGA 3ZH9B 4A9AA 4ASUA 1IXZA 3T06B 4DBLC 1IN7A 2JLRA 1PUIA 1JQLB 1TEVA 1YJ5A 4QFMA 3U3MA 4BEJA 3ZJYA 4LC0A 1OIWA 5KSYA 4US1R 1WF3A 2WWHA 4A36A 5FI0B 4OK3A 2FFQA 2VO1A 3QE0A 4W5JA 1NY6A 4DWJA 4B6EA 4DXAA 2J87A 1RYFA 4E22A 3NXSA 2H92A 3KDSE 3TMKA 3UEYA 4LYHA 2OXRA 1O3YA 2CVFA 1KSFX 2F9MA 1KDPA 3NBFA 3RS4A 1G5TA 2GJAA 3ZD7A 3DVLA 2JGNA 1P73A 1M74A 2FDCA 1CJMA 3GP8A 2XNSA 4BLPA 1FUUA 1C9KA 1KY2A 1TF7A 2VLIA 3P4YA 4EPXA 1CJTC 2IBMA 4TWZA 2RAPA 5F2EA 3U44B 3I73A 2RMKA 3QNUA 4MKHA 4DSOA 2VHJA 3N5CA 421PA 2JLYA 1DOAA 2AK2A 2WMNB 1T91A 1YR8A 3IEVA 3X1YA 2A9KA 3I62A 1Q44A 4GT1A 5J5CA 2GEDA 4B48A 4PSAA 2B92A 4QHYA 4EPWA 1NF3A 1OFUX 5C4GB 4W9MC 4TLAA 2OT3B 3I1FA 1U90A 1KI7A 1WXQA 2GF0A 3GD7A 2QAGB 4QBGB 3BBPA 4NP6A 3X2SA 2CXXA 3NTUA 4XH9B 2ZRBA 4URXR 1W5SA 3GEIA 3ZVRA 4DB4A 3BH6A 5DHAA 1PJRA 1NNEA 1ZNXA 4UQOA 4BUJA 5BN3A 4X8MA 2IF2A 1SZPA 2P6UA 2ZUBA 3CRW1 1X8JA 2B7CA 3ONWA 5H1YA 3DDCA 1R5NA 3FYHA 1GZSA 1M6NA 4D81A 2VQSA 4XWAA 2O8CA 2E87A 3KKQA 4HLDA 3PJRA 3GJ0A 3U4QA 2LKDA 5KSPA 3WBKA 1TQ2A 2GBLC 2ZUCA 3QG1A 3WHKA 3FHCB 2CBZA 2G1JA 4I4LA 5L3VA 1P75A 2DWOA 4EFNA 3VNVA 1O87A 4TYWA 1OHHD 2OSBA 5CDFE 2GEUA 4QM6A 1WBBA 1Q1EA 1ZCAA 2C78A 5KO2A 1W0JD 1AS2A 3UPUA 1HH4A 5KU1A 3OHMA 4RD1A 4KI0A 3WNCA 3I8SA 1FMLA 2ZE7A 4WZBE 1I4TD 4A2PA 4NCHA 1PTQA 1YZGA 3WY9A 3SYNA 1DPFA 4JMPA 1ESMA 3NEJA 2YNMA 4JJKA 2WICA 1VCNA 2JJ2A 1YZQA 1G7SA 2ZYWX 1CXZA 3F8TA 3BFXA 2FNAA 1R79A 1DBSA 4DCSA 1JR3D 3CWQA 2J46A 4BLTA 2FJUA 1QHHB 2DFTA 3LA6A 1GDDA 2IA5A 5FL3A 4US0R 1R0YA 4Q4HA 2J9RA 4TQUS 4WA7A 3SQWA 1S9DA 1P60A 3IO3A 1OFIA 2FSIA 5JCZA 2GBLA 5CYOA 1X3SA 1E1RA 1SVSA 4MKIA 3B8HA 3E2IA 3HYRA 4HB2A 3WP1B 2PEZA 2OILA 1F3OA 3NH6A 4JLMA 1OYWA 2ZRDA 1EX7A 5L3SB 1NLFA 3FFAA 1DG3A 4Z8YA 2ZM5A 2IYLD 5EUQB 1LNZA 1P4SA 3KY9A 4C0JA 2FV8A 3U3RA 2ZRIA 1H8HA 2IXEA 4QGFA 2GJ9A 2JDID 2YYZA 3SBEA 5JWHA 3O47A 2NO0A 2BC9A 3BJIC 4G5GA 4BLQA 2FPMA 2ZU6A 2JLUA 3KJGA 3BH0A 1TAGA 3A36A 5B58C 4C0QC 1EFRD 4GOKA 3TH5A 4IVRA 4DCUA 4DLUA 1BH2A 4D4KA 3LVRE 3NHAA 3QPWA 3EWAA 4JSYA 2JLWA 3A1SA 2Q0HA 3AM1A 2DR3A 4LWZA 2O8FA 3GJ4A 3BRWD 2HLDA 1SGWA 2V4ZA 3VHLB 1V5WA 3TRFA 4C0AC 1TQ6A 3FOZA 2ZSFA 2EFEB 2QM7A 4V0ME 3CZPA 1AJEA 2Q6TA 4G5QA 4LHXA 1XCGB 3MGCA 5DNYB 2WJIA 3OEHD 4TT3A 4C0KA 2B8WA 1XCPA 5FTNA 1YRBA 2J59A 4HLUA 4KFTA 2EYUA 2KJQA 3KB1A 4QGHA 2BHRA 2FZLA 4JYBA 4BPBA 4A1FA 4NCJA 3SJBA 2OFOA 2A5DA 3OIWA 5HE8A 3LX5A 3FKSA 1H8EA 3KQKA 4Q9LA 1D8TA 3BJIA 5CM8B 3K70C 4IVQA 4LBZA 3RDPA 2C9YA 3VX3A 1XJQA 4CRWB 1ZM7A 5IK2A 2CDNA 1FOEB 2ZRAA 4OI2A 3RC8A 2HCBA 1R5BA 4NYJR 5D3QA 2CE2X 3O8BA 1F2TA 1OKKD 4RKFA 4HAZA 1TX4B 2WOJA 5K8LA 3CZQA 1RFLA 3FE2A 4PO8A 1SVOA 4TTRA 1VG0B 1YZUA 1EFTA 1J8MF 2OLKA 1TBNA 2Y8EA 3X1WA 2Z43A 4I1VA 3MSXA 4MYTA 1ZMXA 3T1VA 3N2EA 3B6EA 1S1CA 4PXAA 1AZTA 1I2DA 1KO1A 1NSFA 2YVUA 4QHSA 4EFLA 2VH5R 2G1KA 3SYLA 2A3RA 4NCIA 4QM7A 1SULA 1UKZA 2IL1A 2NQ2C 4D4LA 1XB2A 4DCNA 4JKIA 4PZYA 1VG8A 5IHPA 3K0AA 1VDZA 3UKDA 3I5XA 3U7GA 5A0FA 3T35A 2I4IA 5M04A 3DMDA 4EPTA 3LWNA 4D4JA 5CJPA 1Q12A 1VYUA 1KI9A 3QXXA 2HDNB 1XMVA 2V8OA 4Q5IA 1G8GA 2CNWA 3M4YA 4A2WA 1HTWA 1QHNA 1HEIA 2F55A 1L7VC 5FPSA 2Q9CA 2N42A 2IUTA 3L8YA 3OE7D 4K81B 4QXAA 4BLRA 1MV5A 1NG1A 3SR0A 1JJ7A 2HJGA 2IYRA 2J5XA 4HLCA 4ARZB 1Z6GA 4JL8A 2ZJBA 1VIAA 4WVFA 4PSKA 2AHOA 2CLCX 1IONA 1LS6A 4NCNA 1M7GA 3VFDA 5FOXA 4L9MA 4BFSA 1XD9A 3V00A 1D2MA 4MGZR 2CEAA 2WM9B 5AUQA 4Q9KA 4AKIA 4B35A 2O8EB 4NZYA 2Z83A 4OJKA 1KI8A 1U8ZA 2FEMA 3DZ8A 1XJCA 2QI9C 1JJVA 4GDFA 4DLZA 2RGCA 1BOFA 2J45A 1J2JA 1JNYA 1QHYA 3V4RA 4M9SA 3TLXA 3VR1A 2REOA 1OH5A 1JI0A 2LWIA 2YC4C 3TE6A 4DDUA 4Q19A 2WKQA 3A1UA 4Z54A 4EPRA 4EKDA 3CR7A 5E7MA 1RYHA 3SN6A 4JLJA 4J0QA 1R0XA 2VHTA 4PQFA 4YC7A 5HKKA 3AVVA 3UMFA 4MGYR 2A7QA 4OHXA 1WE2A 3U7EB 3SU8A 1JEDA 4HAUA 3ZIAD 5EE1A 2CL0X 1CR2A 1G17A 1P6XA 1ETUA 3EZ6A 4YMUA 3KUDA 4M4SA 4GP6A 4W5WA 4UNRA 3U5ZB 2YKGA 2C9OA 2WWXA 3CPEA 4YLGA 1ZNZA 4B74A 1XTSA 2GRJA 1D9XA 2XAUA 1OSNA 4TMZA 1OB2A 4C0HA 1VHLA 3IGFA 1AGPA 3ND9A 1KI2A 2V7QA 4URUR 2BJWA 3QKRA 2VA8A 4N1AA 5BQ5A 1R8SA 3R9WA 2RGDA 1E9EA 1LVGA 4XVUA 2GJKA 1CR0A 3ICEA 2WBLC 1VG1A 4CEJA 1JBKA 3GLHA 5FTKA 1N6RA 3AV0B 3AVTA 2OCYC 4URYR 4NYJQ 5D3MA 2IC5A 4Q1AA 3NWJA 4HUQB 4RD4A 2D7DA 3KKOA 1OH6A 4AYXA 2XNDD 1E9BA 4JT2A 2GETA 3R20A 5AJXA 3W90A 5JJLA 1IN6A 4DKXA 1U98A 2BKUA 1KI3A 3U4QB 4PAQA 1AKEA 4Q47A 1P2VA 4FIDA 5HR5A 3GCGA 4R7ZA 2EWWA 2P65A 3DM5A 3HPQA 3DO6A 4HUTA 5JWOA 2GESA 2J3EA 3ZS8A 5HE9A 1ZUIA 5KTYA 1YR6A 5A5GA 2AR7A 4P4SA 4IHQA 5P21A 4X8LA 4FI3C 1NBMA 1X8LA 1IXRC 2X2FA 3QIAA 1T3SA 4BQSA 3AF1A 3R8CA 3RWOA 1Z0JA 4ASUD 2FNFX 2FPLA 2C03A 4DHEA 2H17A 5EP2A 2F9LA 3UMRA 4KYUA 3QKTA 2IYVA 3RS7A 2QU8A 5J47A 4RZXA 4ZDWA 2EWVA 3MWLA 2RKOA 1N6KA 1SKYE 4NHOA 4LHWA 4DRZA 1RPZA 1J70A 3V9PA 1Z2CA 2FN4A 2NZ8A 5AJVB 2ZROA 4CYMA 1U9IC 3QEOA 4I99A 5FFMA 3O8CA 3U44A 2MSDB 4L15A 1N5JA 3REGA 3ZZUA 2F3RA 5DGXA 4ZCMA 4Z1MA 1US8A 3R9IA 1U0JA 1VYVA 3NBYC 4P31A 4HLQB 1W5TA 1E2MA 3ADDA 1YZTA 1JPJA 3BD9A 2IT1A 2ZTSA 2IS6A 3PIRA 3ZVMA 2VRWA 4PQRA 1XPUA 3JVUA 3QF7A 1J8YF 1KJZA 3CBQA 2BBTA 3L0SA 2ZETA 1GAJA 1E2QA 5FBVB 1CJUC 1ZD1A 4YDHB 4QNMA 2QA5A 3WMFA 1QDEA 2EVWX 4V0OA 4M1WA 1JR6A 2DWQA 3P32A 3UG7A 1P2UA 4LYJA 4OHWA 5CM9C 1Z5ZA 4L9SA 5GVSA 2WZQA 2XTZA 4JLDA 4LJ8A 3TAUA 2DBYA 1N25A 1TNDA 4MRSA 4AI6A 4HB0A 4BE7B 1B23P 1J99A 2PJZA 5FUYA 4QGGA 3ICQB 2UVQA 3Q8XB 4TL9A 4A0RA 4TYQA 2OHFA 3SHFA 3FMIA 4HAXA 2ZYVX 2RCNA 3CM0A 5G41A 4BRUA 2QENA 4QKQA 2O8FB 1DAGA 1U9IA 1AM4D 3EZ9A 5LB2A 1Z63A 2BM1A 4DB2A 2WKRA 1DO2A 4AKHA 3DOEA 1PUJA 4D82A 1RRFA 3AUXA 4ZO4A 4YMWA 3EZ2A 3SYKA 1R10A 1AGRA 4KXFB 4DLVA 5LBIA 1QHSA 2GHIA 4LBVA 3AF4A 2WAXA 2D2FA 2OBMA 1AIPA 5TV2A 4JLOA 3BIFA 4KVGA 4C4PA 3GPLA 2YZ2A 3W6PA 3QY0A 2C98A 3GJ6A 2FSGA 4OQXA 4TMWA 3EW9A 4AWXA 4LK2A 3GLHE 2IXFA 1LV7A 3TBKA 4IXNA 4TMTA 4JSTA 3ZLJA 1NSTA 1NRJB 1QHHA 1BYIA 3IQWA 3L2OB 4MGKR 4UNSA 2FFAA 2OCPA 3C41J 3ADBA 4DDVA 1R7RA 2ZI9A 2IWRA 4XIGS 5G40A 1I2MA 4LPSA 2ZJYA 1R8QA 1K5GA 3PUVA 4FMCF 2KBFA 5AUNB 4EQ6A 2FF7A 2JJ2D 1GRNA 2H7VA 2QQEA 3HR8A 5BYKA 1GITA 2QM8A 4DIEA 5E4FA 2GVIA 2VP0A 2QBYA 3EXAA 4JLPA 4QG7A 4BEBA 2ECKA 4UJ3A 2QROA 3AKDA 2BCJQ 2MMGA 4NONA 4A6XA 4GNKA 5J4YA 4DEYA 2QTVB 2EFCB 1QHGA 1KK0A 1DAFA 1XF9A 4C7OA 1E1RD 4OBEA 1X1SA 5AUOB 3WNDA 4DSNA 4NU0A 5AK0A 3LH5A 3U3KA 3LW7A 2C04A 1Z08A 1ZM9A 4V0NA 2CE7A 2QPOA 1SKYB 4LYAA 2YWHA 1W4AA 1HA3A 2DCUA 3GJ7A 1Y3AA 2WWWA 5GJWC 4YMTA 2W2XA 2VEDA 3QXCA 4ZKDA 2ZXUA 3M0EA 3F0TA 2XB2A 2NO1A 3K70B 1E3MA 2QSZA 3Q72A 1GG2A 2IF0A 1KDRA 1TTTA 5DLQC 1NLZA 1S9HA 3QENA 1XWIA 4MA4A 4DLTA 5KNDA 1CU1A 2ZRJA 1UBEA 3E70C 3Q7PA 4QNRA 2ZR7A 3R8FA 3SI7A 5CB8A 4Q7MB 1JXOA 3DHWC 2GXQA 1NMYA 2P0EA 2HLDD 2IYWA 1Z47A 4JL6A 4C0BA 3AVUA 2N1BA 2CCKA 5EXPA 5LD2C 4H1UA 2PH1A 3Q3JB 2A5GA 3A1TA 1P2SA 1UPTA 1S3SA 2AL7A 2PJRA 3B9PA 3KKNA 1ZNYA 3BB4A 1EFUA 2D3WA 4MUBA 4TMXA 5H8WA 1IOZA 3L43A 2AWNA 1Z0DA 2FMXA 4L16A 1KNQA 4LV6A 5DISB 3OAAA 3U3OA 2QUZA 2QT0A 3A6PC 2DYKA 2GXUA 1W4RA 1GRQA 3KZ1E 3QOFA 4RSGA 2WJHA 4LC1A 1H8ED 3KXKA 5AJYA 4Q7LA 4Q9JA 5CDFA 1VCOA 5IK2D 3TR5A 5F98A 1E0JA 1DO0A 2J0SA 4BFTA 1E2LA 1N0WA 1KI1A 3T1TA 3BXZA 1TMKA 3DEFA 3TUZC 2WWGA 3EASA 1XXHA 2V1UA 4H1VA 1ZRHA 2CK3D 4C30A 4A82A 5HPYB 1Q3TA 2P67A 821PA 2VP9A 1YHNA 3QKRB 1JB1A 3MAAC 2MSEB 4I1UA 2ZRCA 1WDTA 1EESA 3MWKA 3QF4A 2C99A 4B3CA 5KPJA 4KFUA 1OV4A 4R71A 1AS0A 4CEJB 3GLHB 4OQLA 4AYTA 2AX4A 2H5EA 2ZIAA 4O0MA 4U00A 1E9AA 1YZLA 5B57C 5D3MB 1MRNA 1E2HA 3IHWA 4W7SA 3MRSA 1LY1A 1W48A 1T8UA 2W6IA 4RCYA 2ZREA 2BEJA 2ZI4A 1MABA 4CT4B 5C2JB 5DI3B 1P72A 1GRRA 3E1SA 2GXAA 4DT1A 1SHZA 2W58A 1DAEA 4V03A 4GL2A 4ESHA 4N0DA 2CNWD 2P2LA 1RIFA 1ZW6A 2IS2A 4Q4JA 1KY3A 2OXCA 4MYHA 2F43B 2BMJA 2JASA 4P4SB 1GL7A 5C18A 2O8EA 3I72A 4KSCA 3QPUA 2X19A 1HQCA 3ZDQA 4LCBA 2WVJA 3AVYA 5DYGA 4DVGA 4ZIRB 1CJKC 1G7RA 1N3BA 2OO7A 3VKHA 3GEEA 1RFHA 1OIXA 2YV5A 4TSFD 1F48A 3FPAA 1UKEA 2Q3FA 3KQLA 2GVDC 4WIAA 2C9CA 2PX0A 1DTSA 4O3MA 3SFVA 5BW8A 4HI0E 1FL9A 4LHVA 3KQUA 4FCWA 5EXSA 1EXMA 1DAIA 1YVDA 4O2RA 3PEWA 4DC9A 1YZNA 1P5ZB 1UBGA 1US8B 4IDNA 4A15A 1HQYE 1HY3A 3RVBA 4RKEA 2QGZA 3O8DA 1NY5A 2JLXA 2WMOB 1DE0A 3KXLA 2D62A 2XJ9A 3KFXA 4JBWA 3CIOA 4A92A 2JJ1A 2VRWB 3P4XA 1SXJA 4HAVA 4LJAA 1U2RA 1KI4A 4V0MA 2ANBA 1U99A 1Z06A 1HE1C 1XTQA 2X2EA 5FPHA 1N0VC 4B71A 5HKKD 2AXNA 1KO5A 4XWKA 3HYTA 1Z07A 4Q1DA 5KDLA 1E4YA 2HCJB 4OQFA 3U60B 3DOFA 4NYMR 2XITA 1FNMA 4QC2A 3ZZ0A 2IYSA 2PLRA 4D0LB 4KV9A 2Z4SA 1PV4A 4HUQA 3OZXA 5CK4A 1GKUB 1P3JA 1Y63A 2X1VA 3KB2A 1W47A 2ORWA 4CDGA 3JVVA 621PA 2OEPA 1W0KA 2V7QD 5SZJA 4PR0A 3W3ZB 3QKUA 5KSZA 1KYIA 1ZINA 4FWIB 2HV8A 2ODBA 5EXXA 2R6CA 5EZ6B 3T15A 4EPYA 2ZSAA 3LFUA 4R9UC 1XCMA 3CX6A 4KSBA 4KBFA 2WWIA 3DMNA 2CCJA 1AS3A 2ERYA 3I8XA 1LB1B 5JZVA 2ZE5A 3EPHA 4KVAA 4A0HA 4JLKA 2F6RA 3AKCA 5TMPA 2YC2C 4L9WA 3K9HA 2IWHA 1XXHE 2C96A 2MSCB 1CBUA 1I4LD 3S1AA 2QPTA 3PR1A 3B1XA 1LS1A 3CNOA 1ELOA 3VU9B 1VCIA 1Q20A 1XTIA 1G64A 3PUZA 2HT1A 1KMQA 2IX3A 1E98A 3K9NA 5CJ2A 3ZYCA 1NBMD 4DIDA 1GVNB 4ZDKA 4C2UA 2UZ3A 1FP6A 4Q1EA 3EA0A 3RWMB 4AURA 3CX7A 3EG5A 2QZ4A 3IIKA 4RJLA 1AK2A 4AYWA 1IQPA 4ABYA 2V55B 1U94A 1QVRA 2P3SA 2F1JA 4A0FA 5TARA 1X86B 3WMGA 3WXMA 3CF2A 3PEUA 4MQBA 1KBFA 1D9ZA 4EQ6B 3NDPA 5JEDA 1VCMA 2R65A 4II7A 4P4TA 1BMFA 3T1OA 2CLSA 2ZS8A 4HLUC 4F4IA 2YHSA 2JIZD 2ASEA 3K0CC 3T5DA 4BGDA 1Z0IA 3I5YA 1T4GA 4Z1MD 2QBYB 5DSZA 2PZGA 2REBA 4PC2A 1H65A 4EFMA 3AQ4A 4MDFA 3NBXX 2WAYA 3PQCA 4LSGA 1ZYUA 2F7SA 5EXTA 4C7OB 1FTNA 2C8VA 2DFLA 1LTQA 3H2YA 3SS8A 3K9LA 5DN6A 1ZM2A 1COWD 1W49A 5HCNA 2W6JA 4B3FX 3P20A 2R62A 2J0QA 3VX4A 5HCIA 3SHWA 1KO4A 2QTFA 5EE9A 3ZZTA 4GZMA 3NHBA 2OE2A 1KGDA 4PC6A 4EPVA 2GEVA 4LX0A 1UEIA 4F38A 4OKSA 2VP5A 2H16A 3H0KA 4DJTA 3UANA 4B3GA 1D2NA 4PHFA 1JPNA 1SXJE 4GZLA 4M53A 3AKEA 5FUWA 4MGIR 2JA1A 2WV9A 1Z22A 2DFKB 2FOLA 4NYMQ 4TMVA 1KZ7B 1SVWA 3KJHA 5CIWA 2C5LA 4IOMA 4KAXA 3AVXA 4PAMA 2ZI6A 3K0CA 3O8RA 2D2EA 2CCGA 3IBGA 4FMDF 2OBLA 3GLGA 4M21A 1ZC4A 1BIFA 3L0OA 4RD6A 1EK0A 3ADCA 3EX7C 1BYUA 1R2QA 4PPQA 2ZAMA 1E32A 1FW6A 3REFA 1LW7A 4OL0A 2WPDA 4C2TA 3AVQA 3GLIA 4JS0A 1G1MA 1G5PA 4I1SA 3QKSB 3CO5A 4PC3A 1EFCA 3EC1A 3NC1C 1P7CA 121PA 3U6KA 5HZKA 3CLVA 4WBSA 2X77A 4XD7A 5TVKA 2PMKA 1E2KA 1G21E 3L0IB 4XOIA 1SKQA 3AF2A 3MCAA 4DLRA 1UBFA 1FX0A 2LKCA 3OFNA 3BOSA 4A4DA 1RKBA 1XRJA 5IDVA 3CH5A 1XU4A 3B78A 4DSUA 4NL4H 1Y8FA 2ZJ5A 1Z83A 5CB6A 2PT7A 4M1OA 3TQCA 1SHKA 2CLDX 2V3CC 4LOAA 1W2HA 3HU3A 3A58B 4TLCA 5AJWA 3LBNA 4NH0A 1G3UA 4DCTA 4HZIA 1XXHB 2G83A 1YRAA 2WIAA 4TL6A 4E09A 5K8UA 3ASZA 3PG5A 3FHTA 521PA 2ERXA 2DHRA 3QF4B 4HB4A 5LD2B 3DPUA 3K0EA 1IJFA 1TEXA 3U3JA 4E5UA 3QVUA 2CHQA 4KBGA 1Q22A 2V6JA 2FA9A 3ECCA 4M1MA 5JECA 3WNBA 4KITB 4CZ2A 1RJ9A 1MABB 2OFWA 4BECA 2VBCA 1NI3A 3VKWA 1CEEA 1XEWY 4DT1B 4JBXA 5ANRB 4LJ9A 4RD0A 1E9DA 2B6HA 4P0TA 4CEHA 1Z0FA 3OEEA 2E9SA 2BMFA 4Q4JB 3TKLA 1MO3A 3RS2A 5FL7A 3DL0A 2KE5A 3ZS9A 1D6JA 3SQXA 4NKRA 1G19A 2R6DA 3NBZC 1WRBA 2R44A 2W00A 1E99A 3C5HA 1IY0A 1CR1A 1ESNA 1RE0A 1D5CA 2J0UB 3IPXA 1KK2A 1E2NA 2QMUA 1G8YA 2HUPA 3EC2A 3VNUA 5JS8A 3FDIA 4US2R 2GA8A 4B44A 1PZNA 1A2BA 1XEXA 2BJVA 3LD9A 3CUEF 2TMKA 3AVOA 4K46A 4OK6A 2BIFA 3NIBA 3V4FA 2A5JA 3SE0A 4WZAE 4Z51A 1M2OB 2AK3A 1VG9B 4EAQA 2QORA 3B1YA 5JBQA 1GSIA 1G4AE 1R5OA 3EZ7A 1JEEA 5K8TA 2V1XA 4PANA 4LJYA 3RYTC 1QRAA 1OXVA 1XD2A 4DDTA 3A4MA 2NMVA 3EARA 1UADA 4A8JC 2HEIA 2VHCA 1AA9A 3QSYA 1T0JB 1SXJB 2ZRNA 3OAAD 5JSZA 2E1RA 3TUJC 4Q9HA 4Q9IA 5C1BA 3W8RA 3C4JA 2XSZA 3FWYA 4IRUB 2IK8A 2DFNA 1M7HA 3LLUA 4KJZA 3GLGE 5JCPA 2WSSA 5J4HA 1MO5A 3UGDA 3BFVA 1L2TA 3AP3A 5FUVA 2BDTA 4PFSA 3OIYA 4B3DA 1N5LA 2VHQA 1MO4A 3GLIE 2VHUA 2BVNA 1KO7A 1OIVA 3KXIA 3KJIA 2REXB 2WHXA 4DLYA 4E03A 5K8IA 3RABA 2QMHA 4IJMA 4LRWA 5DI3A 3N2IA 4AG6A 3KKMA 4CF7A 2GILA 1N6LA 3KTAB 4PO1A 2OG2A 3EPKA 1G5RA 3FB4A 3SNHA 5JSZB 2HXSA 2RHMA 4Y0VA 1SVLA 1Q57A 4B43A 2XXAA 1MRSA 1KK1A 3W9YA 2F1HA 2F43A 2G88A 4YMSA 1W1WA 4TMKA 3TSOA 2N46A 5JWRA 1AQYA 4IEEA 1GUAA 3GQBA 4PTLA 2W6ID 4JYCA 4ZIRA 1HE8B 1Z6XA 3LQRA 2ZRFA 2OFXA 3DKVA 3PENA 1MO6A 1W2GA 1W0JA 2ODEA 2ZJ8A 1IJEA 3S1AB 1OYYA 1IHUA 1GP2A 1M7BA 4I1OA 3CNNA 4ITRC 5DIFA 3RRMA 4A8JA 1OH7A 3QXJA 3KX2A 4Q66C 5JFGA 1E2IA 1A2KC 2IEYA 5LPNA 3LY5A 1ZM4A 2PEYA 3HU2A 1S1MA 4ZV4A 2FE4A 4D25A 1XMSA 2ZQ5A 3IQXA 1SVIA 5BXQC 5EJEA 4WXPA 3Q5EA 4F7WA 2GZAA 2FFBA 1DAHA 2WJVA 2ENZA 4Q1BA 3W3AA 1JR3A 1SVKA 4PQYA 1IY1A 1G18A 4KLZA 2WSMA 4GRAA 3W34A 1XNJA 2D4HA 1UM8A 2DY1A 1JQJC 3CF0A 1YZKA 2H18A 2GCOB 3VR6A 4C9BA 2P6RA 4D26A 5E7JA 3ZQJA 3PCRB 2YOGA 5JHHB 2XEXA 1ONBA 1YR9A 3X1DA 2GCNA 1G8PA 1KDOA 3CRMA 2AKYA 3TK1A 2R2AA 3BAFA 5DH9A 3AP2A 1TU4A 5L8VA 4WZ6A 2QRZA 5J4KA 2IEZA 4QL3A 1Q1QA 4TZ6A 2OBNA 2JJ1D 3BH7A 3NKVA 3VAAA 5EZ5A 1W46A 3TVDA 3GFOA 1EFRA 3GLFE 2QT1A 4L8GA 2MMCA 4MH0R 4EJSC 3A1WA 1KKLA 4EIWA 1TF2A 2J7KA 3NG1A 1OLOA 3IKJA 1VIYA 5JEEA 4OJQA 4XVQA 1KOFA 5FBLB 3GJ3A 5DE3A 4BZQA 2ZR9A 3Q7QA 3BS4A 3QBVA 4ZDIA 2YWEA 3C16C 2BKEA 3THWB 1ZIOA 3CH4B 5EP3A 3THXA 1W7AA 2ZITA 1W0KD 4NMMA 1NP6A 1FAQA 1N6HA 1RRGA 3SJZA 5JHGB 1OXXK 5JJKA 2XZPA 3QXSA 1PLJA 4LDJA 1P2TA 5B2ZA 1A82A 2RGXA 3LRPA 2NPFA 3VU9A 2J1LA 1XBTA 1RRPA 1OW3B 5FOWA 1QBKC 1IY2A 2RB4A 1SVMA 3UK6A 3TGPA 4PC1A 2ZYUX 2R9VA 4GSYA 4Q4LA 4ACAA 4AD8A 3MFYA 3Q5DA 4BLOA 1QG2A 2ENNA 4HYYA 3TW8B 3TW4A 3GLGB 1KSGA 5F9HA 4PAOA 1YU9A 3UATA 4ZCIA 3T61A 3QXHA 2G0NA 2VTKA 1TUEA 3OESA 3L8ZA 3GLIB 4HDQB 4NYIQ 4R2IA 2D7CA 2GTPA 4HAYA 4CT5A 3CKLA 2GF9A 4G5RA 4MITA 2WTUA 1B0UA 5FTMA 4EJSA 4D80A 2R8RA 4JVMA 3TR0A 3UWOA 1FFHA 3ETLA 1GFIA 5A4JA 4GPTA 2VF7A 1FX0B 2ATVA 4BFVA 1G9XA 1W44A 2G9NA 1CRQA 2NO7A 5DHFA 5HZHA 2CJWA 3EA5A 1NN1A 1G7CA 4FMCB 4HDOB 1J7KA 1DVRA 2QN6A 1Z2AA 3CWZA 1MR3F 4KYIB 3SFZA 3FMFA 3UXMA 4H9GA 3LW8A 4IDPA 2GWHA 5TY0A 4BFUA 3R9XA 4QBHA 2VP2A 5SZIA 1BMFD 2PCLA 5EP4A 3KUCA 2XTNA 1YKSA 3VKGA 5SZHB 3EZFA 2QG6A 5KDOA 1XZPA 1H8HD 1HYQA 2RGBA 5LDDC 4G3XA 3LNCA 1DARA 2VL7A 3K53A 5BWMA 1JR3E 4PZLA 1WB9A 2ZS7A 3E5HA 4PSVA 3THOA 4G01B 1E1QA 2ODNA 4IOLA 6Q21A 4JLVA 2OESA 2A30A 5KUTA 4URZR 2FSFA 5JI2E 4G1UC 1RJ9B 1FARA 3C14C 2GKSA 4Q21A 5DN6D 5AR1A 3THYB 2AD1A 3U7HB 3BK7A 3CXLA 2W6JD 1L4YA 4B2IA 1DG1G 1T9HA 1VMAA 3G5UA 4CEHB 2ZU0C 3CRVA 1QHXA 5H68A 2O5VA 1G6OA 1OXTA 3EPJA 4HDCA 4JVLA 2W2TA 1XMJA 1WP9A 2O8BA 4CW7A 2R6AA 2ZI5A 3UG6A 3FMOB 2FH5B 3QKSA 3AVWA 1QF9A 4QJ4A 2RH5A 1L8QA 5J4VA 4TT3D 2WJJA 3BERA 2QE7A 3LBIA 1LFDB 1WA5A 3B2EA 2ZR0A 2JLSA 1QVAA 2GK7A 3IIMA 1Z6TA 3C7KA 4BWYA 3I4LA 2CHGA 2BM0A 3SBDA 3GLFB 3UEJA 5UKDA 1G7TA 1XEXB 1WCV1 2I1VB 3IDQA 3X1ZA 4BASA 1K6MA 1RW4A 4LPKA 5KYKA 3FKSD 4S2EA 4OI1A 3RRZA 1E9RA 2NPIA 5FOSA 4KCGA 3BB3A 2WWYA 3RHFA 4M8NE 1XD2B 2AFIE 2DPXA 4LYFA 3QBTA 1XJ0A 4RCZA 3X1XA 4Q1CA 4QHTA 2A2ZA 2QMEA 4JLNA 4L4UA 4XD7D 3RSLA 2CL7X 2ZSBA 4BFWA 5F3WB 2OZEA
chains in the Genus database with same CATH superfamily
2QN8A 1V0JA 2RFLA 4LBYA 1NQXA 5KSOA 3QY9A 2OECA 2Y92A 4TZKA 3O9MA 4FVTA 1VGRA 1K2VN 4X5OA 4PHTA 5B3JC 1RTTA 4OA8A 4ZN6A 3M6MD 3P9IA 5BPHA 1WDWB 2NO9A 1E0DA 1PDWA 4A6PA 4BPRA 1FU4A 3HV0A 4X3PA 1BAPA 2XUJA 1K89A 2AMVA 2C54A 1EEXB 1S2GA 3EVGA 5BRNA 3NX4A 3CZ4A 4W5RA 2I55A 1NVWQ 1MOZA 4R5HA 4DQVA 3W77A 3N2YA 1XJWA 4YJ2A 4KACA 2D1FA 1H2RS 2RB5A 3JD3A 3B20A 3P2OA 5DT9A 3RRFA 2JANA 4BX8A 1GLVA 5K8CA 4BNNA 1EWKA 3EIUA 3WQBA 1GA6A 1SUIA 4J91A 5K0CA 2BFFA 1AXGA 4P83A 1QNLA 5C7IO 2YCBA 2NUBA 3L1HA 1CZUA 2BJHA 1I24A 4FYVA 1G41A 3HJHA 5A02A 2FXIA 1CHDA 1ESCA 3PP8A 4J8PA 3HWSA 1X6VA 2QP9X 4BL5A 1O96B 2ODAA 5C8YF 5ADHA 1KMHB 4S1VA 2VDWB 1I30A 3FHLA 2AWOA 4WV3A 3M33A 3I09A 4IDEA 1MAUA 3VOSA 5EIHA 4QOJA 4ON9A 3RVNA 5TJHA 2QP3A 3UGKA 4F84A 2DFDA 3G6KA 221PA 4XWTA 2QNIA 4BU1A 3TQHA 5BNZA 2H07A 1LF0A 5BN4A 1TZKA 3B6ZA 3WYGA 4D5GA 3C48A 3C7CB 4GGOA 1HT1E 5L6LB 2H2FA 1X1CA 5DNEA 3TTXA 2ZJZA 1P7PA 4ACBA 3REOA 3EJWA 4N5DA 3WRYA 2O3JA 2K6GA 1E9CA 1GZUA 1Y8RB 1IBSA 2PD4A 1KMAA 3ZHQA 1M2OA 5G3YA 1U0NA 1QAMA 3PKJA 5JQGA 3FZGA 3HBLA 5F3RA 1NBIA 1E2BA 2V7TA 4BKQA 4W8GA 1SG9A 2WIKA 1ZVQA 2HO5A 4TVKA 3ZV5A 4E31A 5E1OA 1N7JA 1PSDA 3ZE0B 4UXIA 2GCPA 4M7OA 2FWBA 3D31A 3ZCRA 3PFKA 3RFXA 3AU8A 3T5PA 1FDVA 4FILA 1YB4A 1JWLA 5KNCA 1W59A 3C6XA 1QH1B 4QRIA 5JDIA 5LKRA 1JR2A 1IM5A 2WTNA 3P96A 4DAOA 2LBPA 2FDXA 1WMSA 2OQ2A 3VVBA 4ZYTA 5FP0A 3N70A 4NX2A 1X2EA 4LHZA 4RPHA 4H4EA 3WGHA 1MEEA 1SN7A 2WJWA 3HR7A 4J9UE 4ENWA 1NZFA 3IEKA 2FR0A 1TIPA 2HNAA 1XYGA 1KI6A 3VR5A 4F4CA 1RWQA 1N6PA 3THRA 5DVZA 4LSWA 4YAWA 16PKA 2Q3JA 2Y93A 4FGKA 3SICE 1DQRA 1E3DA 4Y6QA 1A9QA 1PFQA 3E6AA 2PMWB 3KTAA 4PZCA 3QJYA 2PFGA 1LVUA 5JH7A 3FIUA 1XQXA 3WWEA 4N4AA 4X7PA 3C6ZA 1HI9A 2BFBA 2I71A 3D6FA 2AG0A 3FZQA 4YT8A 2GJ8A 1ZUNA 3HADA 2GPTA 3E7XA 1ECPA 4DJ5X 1EM8A 2IYXA 3FJ1A 4ZI7B 1VC2A 2AYXA 2F3TA 5E1DA 3MMPA 4YV7A 4DUYB 1SCNE 4Z5XA 1RC1A 1AMUA 3DTVA 2OCXA 2QPAA 4OI4A 3UAOA 4RE5A 1FK8A 1ZCZA 1BGVA 2DM6A 3GFRA 3V7WA 1LC0A 1XALA 2J85A 1P2GA 4NEHB 4AY2A 4LJ5A 4GOLD 1AKMA 4I2VA 5FTJA 1E59A 4X66B 3PK0A 2Q4RA 4GI2A 5L3QB 2OUKA 2F3SA 3QU5A 1BCRA 4FW9A 5AQEA 5EQDA 5ALPA 4O02B 4K05A 4ZVQA 5T67A 1P44A 2OSVA 2VNSA 2WIBA 4Q9NA 3U31A 4B85A 1NKTA 2YW2A 3Q7TA 2WP8J 4LI0A 4QA9A 4IJ6A 4BNMA 1XVVA 4DM4A 1D04A 1CY8A 1SKAA 3DA8A 4QD3A 3R76A 4B87A 1JEQA 2G5PA 1PVOA 3P2MA 2EU8A 3IKLA 4KZPA 2D1RA 3D8TA 1K4MA 2CXSA 3G0OA 5IYZF 2WRZA 4Q7KA 2AZDA 8OHMA 1WPQA 4U6QA 5K0JA 5KVAA 1AQNA 5JTUA 2JFUA 2P0YA 5IJAA 1X1TA 2V58A 3HP1A 3PVSA 4PYQA 3GFVA 4BNDA 3BZBA 2X13A 3AJ8A 2ORED 2P9HA 1PYDA 2GCOA 1N3YA 4HMOA 1LU9A 3ITKA 4ZMRA 5DO9A 1KHTA 1LKZA 1Y5LA 1BHO1 1Y5RA 3FNEA 2VPIA 3INRA 4EJSB 1M0TA 4EZIA 1G9SA 1RYNA 2FOXA 3IXQA 4BB0A 3GFGA 4CCWA 4QOGA 4MS3B 3GFTA 2VP4A 1M67A 1ZNWA 5BUQA 1GGKA 1I7PA 3ET4A 3SHOA 1WXEA 5B12A 5CDUA 3ZWVA 3S29A 2CJWB 3EMVA 3WVNA 2C2GA 2NTNA 3RC3A 4FSDA 5BSWA 5BVHA 1BDMA 2C4UA 4YXWA 2PE5A 1WQ1R 4S12A 2HXYA 1LPAB 4QYWA 5IJXA 1C4KA 1ZD5A 3OPYI 4XB2A 2Y6UA 2XT0A 2C88A 3H9CA 2WJ4A 3R4CA 3CPSA 3DBRA 2SGDI 4E08A 1J7JA 1J00A 1ANKA 4RQBA 1BO6A 1L3IA 5CIQA 4LQCA 3L92A 1HMPA 2BUSA 2OXEA 4GSKA 4YAUA 4OJMX 5H16A 2J0EA 1Q2XA 5FPKA 4IX9A 3AR8A 3DO5A 2AJCA 2C57A 1VKOA 3T3EA 5T4FA 4IS3A 1I1HA 1QKIA 3V1LA 3DXYA 4HGPA 1IIBA 1RBMA 1Q84A 1T36B 3THWA 4PZZA 3FXAA 4LRYA 1NOKA 5CT4A 1O9BA 3T3MB 1V1HA 5EE5B 2MOKA 5LUBA 4DQ0A 1GL9B 3LNTA 4UULA 2CJPA 3DHNA 3RK4A 3TJQA 1R8YA 1V95A 2PD3A 2ZB8A 3G5TA 3AFNA 4FFVA 1AQ6A 2GPBA 4EHJA 5LDDC 1FZTA 2PLFA 4UKDA 2VKQA 3FMGA 4G2TA 1GGMA 2E4VA 3I32A 1BMOA 4ZANA 2B1JA 1NULA 3FYDA 4PYIA 1NM5A 2FQ1A 1JQKA 4Q4AB 4URWR 5ER9A 3SS9X 2JGAA 3T7CA 4HNVA 3R5XA 2FI1A 2AGVA 2X76A 1JECA 4BE7B 2V54A 1JB9A 3HDQA 3PRYA 4HQNA 1APBA 1C4XA 1PS9A 2O0KA 4FHDA 4WJKB 2R84A 3UAYA 1BKSB 3EIOA 1T9CA 1RLMA 1E58A 3H6HA 1MAVA 1TECE 4QVGA 2E7ZA 5LZ7A 3O4JA 2GTIA 4N0QA 4TVOA 5ALJA 5DYTA 4GVLA 3L0DA 4YYZA 2YMPA 2NU7B 3ZNQA 1TT5B 3BA1A 1Z73A 3DLCA 2W4IA 1FMTA 3A8TA 4UQPA 1OX4B 3ZVNA 2WD8A 2GUGA 3BUSA 1XA6A 3EEBA 1NW7A 2QXYA 1WW8A 2CXOA 4PYOA 1FP2A 2CLLB 4JK3A 5E9JA 2XGJA 3L0ZA 2OG1A 4O6VA 4E1PA 4YRGA 4KNYA 4QPDA 3B85A 2BGRA 1NVVR 2IHTA 3FPJA 4QUAA 1R6TA 2NUTB 2VTVA 3EXEA 5ENDA 3TCKA 1TQ8A 3RG2A 3CTMA 4QXOA 4YUZA 5DBIA 5FBRB 1M75A 4R1PA 4ROSA 2IYOA 2C95A 2M2IA 1MAAA 4M22A 4PRZA 1CIJA 1CTQA 5TQ2B 1YUNA 3UGIA 1ZAKA 4GDMA 4P1ZA 5ESDA 2OV1A 1FZQA 1DMSA 4KHZA 4J43A 4JEIA 4IXMA 4R98A 4UUQA 4FEYA 1IY9A 3LTNC 2EQBA 4U9IS 1M34E 4CEIA 4D4HA 2PGDA 3T7JA 2CYCA 1MT0A 4GC9A 1LBTA 3L1UA 4OAOA 1WV0A 1YFZA 1IUOA 1T34A 1ZJZA 4DKJA 3DE1X 1O94A 1ULSA 1VKHA 4GOJA 4QOSA 4YJ2B 5ALTA 5DYIA 3S55A 3U16A 1OMUA 1DTWA 3KXDA 4CJXA 3BXGA 2AKEA 3K96A 3LBHA 3PFNA 4QQRA 4CDRA 3U81A 4M89A 2ZPUA 2FCRA 2WQ6A 3ZWAA 3ICCA 4B81A 3K94A 4ND8B 3D6TB 2PUHA 1ULTA 3NNSA 4TN1A 1Q0ZA 3CVWA 1YE3A 1A5TA 2A0KA 3PPXA 4URFA 5D87A 5HK9A 1NVXQ 2IHBA 2ONYA 1E1QD 4I1PA 5IKXA 1YZHA 3GH3A 1VJCA 4E2YA 4Z4CA 4F91B 1FS4A 2I6GA 1NVEA 2IDKA 3IQZA 3EZNA 3ST7A 5EZSA 3O4IA 1OUMA 4G0XA 3IUYA 4O8CA 4JJZA 3JYOA 4M87A 3WWOA 3PD7A 5BUZA 5E7IA 4UU7A 2Q1WA 1MKYA 2B25A 3FWKA 2ZRLA 3EYAA 2QNRA 3OA0A 4N3NA 3KIPA 3ERCA 1Y37A 2HHCA 1NR7A 2P5TB 3NH9A 1QHIA 4BAUA 1NKVA 1FXWF 1AKUA 3G2QA 2OD7A 4MVJD 2QD4A 4RQAA 3Q9NA 5J2UF 1CP2A 4HAWA 3OCUA 4Y2SA 1JHRA 2B4KA 4YHBA 3LPDA 3KQWA 4XZ3A 3TSAA 1U1CA 3JAKA 3LQYA 1CUVA 1TQDA 3HWRA 1TUSA 2OP1A 4BO6A 3EN0A 5I47A 4POAA 4B3BA 4R6XA 1EH5A 1UBJS 4M1SA 3AI1A 2UUAB 1JJFA 2D2IA 2HNBA 4D0NA 3UJ7A 4I5IA 3RHZA 1FUKA 3K5IA 1NMXA 1QUFA 5DXFA 1KPHA 1LRKA 4P5PA 4QU8A 5LFAA 4RS3A 3IAFA 1LRJA 4HDSA 4RD2A 2AFHE 4U6SA 4YMIA 3RS9A 3UIEA 3Q40A 4DHWA 1MOSA 3JPWA 5EUCA 4HJRA 4YO8A 4DEXA 1EWQA 4XJXA 2XUQA 4HK4A 2PA3A 4YNBA 1T6XA 3U2QA 5CCXA 3ANSA 4NBUA 2WFMA 4JBYA 1DUSA 4DCGA 2VJNA 1ZUWA 1M8FA 3AUTA 4HDNA 1Z7BA 4W8HA 1KI6B 3WK7A 1CY1A 1FFSA 4KR6A 1PLLA 1W3SA 1CNEA 2G77B 3M6XA 4I8XA 4YDSA 4BFXA 4MI6A 2CUNA 3H1GA 5LR6A 1FUEA 1QV9A 3E5MA 4N9WA 4Q7EA 5E0KB 2IPAB 1LK5A 1UXIA 3S3TA 3EIQA 5CTJA 2FWIA 4B7ZA 4YJHA 1DQZA 1O97C 4WRRA 2A0FA 4RULA 2AYYA 2BFBB 1O0SA 4BNFA 1ZUNB 5IYZA 3INGA 2H1OA 1EM8B 3MTEA 5HCUA 3VR3A 1RZ3A 3Q8KA 3ZVKA 2POQX 2YOHA 4REQA 3BTVA 2ONJA 3FYUC 2IPXA 1J1IA 3VTZA 4BS9A 3R7BA 4AC9A 3DTVB 4DSZA 4LUCA 3GMTA 4M9XA 1PGOA 1OPXA 4C0SA 4HBGA 4PSUA 3BEOA 4J94A 5FBQB 4B6DA 1JKIA 1X80A 3MHTA 1YRLA 3I2IA 1GZ5A 4B4VA 3T7KA 1DEAA 5C8YA 4MROA 2HHLA 1BCRB 1EIZA 1PGPA 2V98A 2XOKD 4ZVLA 1D2RA 3FKQA 1SIOA 1BX3A 2HV9A 4WNCA 2WWTA 4KK4A 3ES9A 1Y3DE 4OCZA 2RIRA 2RHDA 4LFBB 1NN3A 4AJNA 1K7UA 1N5IA 3LIPA 1JEQB 4OM7A 2J4FA 4QNNA 4CL8A 4JKOA 3ZK7A 2ELIA 2E4XA 2HJHA 2DT5A 2HPZA 2YY5A 1XTJA 3C3MA 2V1CA 3JZMA 4IVPA 3NBFA 4RVUA 2UZIR 3HB1A 1ZIPA 4BOYA 1TPZA 4E1AA 3D5TA 2ZZNA 3S6JA 4OHVA 1GNPA 3KC2A 3N75A 1K1EA 1CSOI 1HFJA 2PT5A 2QJOA 2JBAA 4K9SA 3T5DA 2IZ0A 2FSVA 4G89A 1QVVA 2Q3MA 1HT3A 3NHMA 3ZK9A 5L9AA 3W5VA 3DOIA 4MQLA 4QBFA 5FAXA 1KK3A 5C46F 1XX6A 3IOYA 4TYNA 4GZ6A 2IX9A 4N3CA 2GHRA 3IILA 1PVDA 3IDAA 1R00A 3KUUA 3U0VA 2P6NA 2PZKA 3B5JA 4J2OA 3JQFC 5BVHB 2ZVQX 1G3RA 2A5FA 3O4HA 3BORA 1EFAA 3USZA 4EEZA 1P39A 5IT9A 3ZKWA 1HUQA 4OVOA 3IP6A 1GV0A 2DULA 2XCTB 3CZMA 1OXUA 4TYYA 1OY1A 3LCRA 4COKA 4BLSA 3QX3A 2G04A 1D03A 1RLOA 1Q0UA 3SQNA 2P4EA 1Z8FA 1CNFA 3DE5X 1LF5A 2P0AA 3KOXA 2QAGA 4K9KA 1JSCA 1GYPA 4JJ7A 4YRSA 4YMVA 5AFSA 2CBGA 4WMLA 1ADJA 4LF4B 3K5HA 4DUGD 2RIJA 2XB9A 1JLKA 1XDGA 2XADA 2C4VA 1NIJA 1ONPA 3QUBA 3SX4A 4B5LA 3EXFA 1XQWA 2QR5A 3G7NA 3GEHA 2VNJA 4KODA 2CMHA 1HURA 2WU0A 3NU1A 1EWRA 4RMIA 4AWAA 2BMDA 1E4VA 3UYLA 1HFWA 4ZT6A 3FY4A 3NFYA 1DUIA 4UMFA 3FWNA 5H3HA 2DB6A 2A7XA 3MB5A 3O91A 4LJ7A 4FOSA 1QLWA 2GAIA 1DLIA 4YUVA 3T5TA 5KMGA 1U1FA 1L6RA 1Y42X 2HK6A 2YWBA 3OEWA 2OENG 1BNCA 4OH7A 3BHJA 4OP1A 1XTRA 4MUJA 1UFQA 4YVFA 3SMVA 4IFBA 1ND6A 3LLSA 1H9CA 1U0LA 3AZOA 2OLJA 4UNPA 3C0KA 4MCJA 5AWFC 5FKJA 2GZSA 1RJEA 4YONB 2QN1A 1NXQA 1QR6A 4UNIA 2JLQA 3AEQA 4QOEA 1A7UA 3K8QA 3WDKA 4OJYA 3Q6NA 4I5EA 3G5AA 1DINA 1JEJA 4QJ3A 2WU1A 2WG0A 2QQ5A 1X9GA 5B6JA 2HA5A 3E35A 1DUVG 1XTZA 3B1KA 2GMWA 1BVYF 1YR2A 1SCDA 4HATA 5C81A 4UAJA 1TVKB 3OJXA 2FFHA 1L5SA 4KLNA 4EGQA 3IDFA 4JH0A 3PYLA 3TOSA 5GVRA 3VMFA 1VLMA 3OUUA 2NGRA 1ZNQO 2P6MA 4TS9A 5TIIA 1OKKA 2B21A 4X64B 7REQB 1W5EA 2I6FA 1ODSA 4OJTA 1U3VA 1WBJB 1IXYA 5JRDS 1QTNA 5CCMA 2ZQYA 3L6RA 4WEQA 3ASVA 3B60A 3F96A 2CWDA 3HKDB 2WF6A 2IXGA 2XY4A 4UEKA 3H4IA 4JP3A 1QOQB 4TXHA 4LRTB 4L4RA 4KIWA 4MUNA 1R6VA 5CBKA 2RHBA 4L75A 5JNVA 4P3XA 2GLXA 1S8FA 4E15A 3VC7A 4OV6B 3E15A 4N3GA 3EXEB 5E6SB 1D2AA 1YS6A 2PRIA 2MIIA 4TLEA 1AKRA 2VZ8A 2QX6A 4TOIA 1JHOA 1PSWA 2F1IA 1PQUA 3H83A 4NATA 5CVCA 3K8YA 3FPCA 2FSHA 3WLJA 1A8HA 3H18A 2P9YA 1X9IA 3ILSA 3H17A 4BE9A 3PXAA 2O9JA 4FLFA 4ZODA 4YBZA 6ABPA 2AXQA 3WXBA 1K7EB 3GJRA 1Q14A 1UZLA 1GLNA 1ZRMA 4C3ZA 3TBHA 4IEIA 1KGSA 3ZLUA 2C61A 1WXIA 2FVYA 3C87A 4M0LA 4BCCA 2YHUA 3OE7A 1OTXA 4CEIB 3A37A 4GX2A 1Y7TA 5AM1A 3CLRD 2IRWA 4Y1EA 5FBWB 1F5NA 3EAQA 2BGLA 1KS9A 2NTYC 1NONA 2PWAA 3K0AB 4LGMA 1JMYA 2DWPA 3AZPA 1M1XB 1H85A 4ED9A 3H9UA 1Q50A 2X5XA 2PSSA 4EW3A 1S4QA 3B4VC 4LZWA 4FWTA 1BXRA 3F6RA 5BSGA 2LV8A 4L0MA 3MJRA 2D0OB 3QFFA 4ZCLA 3WLAA 3CLUD 1ZK2A 1REQA 2FWRA 4CU5A 4YCJA 1XHFA 4H3HB 3RVDA 2FWPA 4RFVA 1QGYA 2PX2A 4IG9A 1N4DA 3G1UA 4GSLA 3GT3A 2C2XA 4FHEA 2CHEA 4D43A 3K1JA 1UBCA 4GLJA 4LHYA 2UUCB 2HWWA 4BNLA 4GUAA 4CMEA 4IKEA 2N47A 1ZEJA 5H4HA 3WZMA 4NV0A 1F3LA 1FMFA 3CCFA 3RQSA 4OI0A 2Q8NA 1G8HA 3EGVA 1U4OA 4JELA 1UK8A 5FXMA 3WL5A 1SU6A 1N6OA 3VKGA 2B4QA 2WK1A 3FTQA 2XIJA 1DELA 3GBPA 4M2LA 4TSKA 4QKQA 3R7WA 1E62A 1K3FA 3A2MA 1QTQA 1RJDA 3AF5A 4KC0A 4FYXA 2M98A 4K9NA 2H8KA 3E8MA 1EVKA 1ZGAA 4NSNA 5AHXA 1A1VA 4EVRA 3TLEA 4NCAA 2BFWA 3ZE2B 5K5EA 4MR7A 2I4NA 2SKDA 4RHFA 1AE1A 2F8SA 3KK0A 4DMUB 1A7JA 2I65A 3VDRA 3ZIAA 3ZWXA 3L46A 2WFLB 2FP4A 4QUHA 1Z17A 1EFHA 2CMGA 1CX9B 1XDZA 4Z3DA 3GA7A 3WL3A 2SGQI 4R9SA 4LZLA 4EMUA 3OOEA 3KT8A 3MT0A 1WUIS 3O7MA 3WBFA 1K6IA 2R5NA 4CQMB 1I2ZA 4MINA 3NI2A 3WHPA 1PJBA 1WMEA 1ZN8A 2C9BA 4IBOA 1SCIA 4MEBA 1FLNA 3DMTA 4HDSB 4DS3A 4P8RA 1JF8A 1W0CA 3UKOA 4HDKB 4ND7A 1U5KA 4RA6B 1UAAA 2YZNA 3C70A 3Q1KA 3GJXC 3VPBA 1XMIA 5IW8A 1XTKA 1ZRNA 4WBNF 4EJMA 4U7FA 3KQSA 2EFDB 5JG7A 1Z26A 1CUJA 5CNJA 4LMPA 4DL9A 1JDPA 3VTAA 2XGMA 1QORA 2GPWA 4BWVA 3OLZA 4LECA 3H8VA 4HDNB 1SGQI 1EMDA 4OO3A 1T3ZA 1R74A 1XQ6A 1WXFA 3CJQA 4R2XA 3W2EA 5BRAA 2Q3BA 3T1HB 3K2EA 5LQRA 3TZLA 1HL7A 3L1VA 5HDBB 2Z6VA 2FW0A 3KQHA 1IBRA 2JGLA 1VMIA 4QWMA 4YJHB 4XTRA 4OBWA 1E79D 5IZCA 3CVUA 1E7QA 4FIZA 4Q9AA 1V1JA 4KR7A 1EX1A 5ADWA 1ISFA 3OX3A 2DLDA 5E0OA 2WB4A 4JASB 4YQFA 2BEKA 2FTKE 1GCIA 2JZCA 5ITWA 2P4HX 1W36D 2AG1A 4WCVA 3AVPA 2GAOA 3HB7A 2G6BA 2BUBA 3MYYA 3PEYA 1GL6A 2QYOA 1UC5B 1XZBA 1X80B 3O90A 1IQUA 3FWPA 4DJEC 1YULA 3RVPA 4O25A 4LXQA 3DOCA 1QP7A 1RXUA 4GZ3A 5C8YB 1XLUA 1YJ5A 4QFMA 1Y4ZA 2NU6B 3DXXA 3I2KA 4X95A 3ZJYA 4C21A 3KD2A 5KSYA 1QJCA 1YOVA 2QVCA 5FI0B 1PFWA 3F4BA 4OKNA 2XWJI 2EKLA 4OX9Y 4DWJA 3PDNA 1N75A 1WGCA 2Z6UA 3EUEA 3LYUA 1RYFA 3HNOA 3GRAA 3H6KA 3KUKA 4C05A 4JY7A 2K9HA 1HDXA 3GPBA 3RBZA 3FMVA 5TLSA 3ISVA 3VHRA 3ZNOA 1CUEA 1OV6A 1GY8A 1WKCA 4NBLA 3I61A 1B14A 1JKFA 1KSFX 3NB0A 4ND3A 3QW4B 3AHGA 4FLMA 3RJZA 1GSOA 1XK7A 1Y1QA 3AUAA 3PDIA 3RS4A 3TX2A 4JJ4A 2GJAA 3OXFA 2JBAB 2ROQA 1TOTA 1VZ2A 2EBUA 3IC5A 3NJ8A 1B42A 1MC5A 2FCAA 1M5TA 2VYCA 5D1NA 4HX2A 1E64A 1JDSA 4ZCPA 1NHWA 2VLIA 2MJLA 4LQLA 4OU4A 4UU0A 3STWA 4INJA 5F2EA 2RAPA 1PBNA 3L01A 4MI9A 1L9KA 2VH1A 4MKHA 2V53A 4DSOA 4OB7A 4PGGA 2AMJA 2C2BA 1U3TA 2VHJA 2X5NA 3JR3A 3N5CA 4JHLA 1K86A 5FULA 4A6EA 2JLYA 2WMNB 2LIVA 2B9VA 2GK3A 3S2IA 4GI3C 4GBED 1Z5GA 1T2DA 2QKYA 3OC0A 3A6HA 1QIJA 4XLZA 4ZVPA 5J5CA 4DBVO 4EHIA 2UVDA 3TDNA 3UF0A 4DN6A 4EPWA 1ZPDA 4MQ6A 3DDWA 1JHMA 4FI3F 3B8EA 2GJ4A 4EJ6A 4W6ZA 1EGMB 5SV2A 4IIJF 1U90A 2KPOA 3GEBA 2J3KA 3QU2A 5J8FA 2QAGB 4QBGB 4UARA 2YNMC 3H5WA 5AW4A 4LF8B 3NC4A 3MFQA 2CXXA 1RBYA 3NTUA 3X2SA 4EGAA 4URXR 4LY9A 1A04A 4AF7A 4D74A 3ZVRA 1DPGA 1T9GS 3GH1A 3BH6A 5DHAA 4AO7A 4DB4A 4KYTA 3EXFB 1TJNA 3TLCA 1C3OB 5AW2A 2R8EA 3CRW1 4AJJA 1K92A 1DQSA 1RXCA 4ZPJA 4KV7A 5H1YA 3DDOA 5TGZA 3UAWA 1R5NA 3FYHA 1GZSA 5JSQA 2XTAA 1H2WA 5BWNA 2PKEA 3NRJA 4IDBA 1YXMA 4ILKA 3DDNA 4PG5A 3U4QA 5ERYA 3WBKA 3BMQA 3VSAA 1WUKS 5B37A 3R7SA 3MTJA 3WHKA 4TRJA 1TJ5A 5BV8A 5C5EA 4D79A 1GPWB 5TVGA 5L3VA 2DWOA 4EFNA 3VNVA 3I5UA 1O87A 1ADBA 3DE0X 1FFWA 3I6IA 4QM6A 2VYVD 2CHFA 2ZYDA 2ACWA 2JF0A 2JH9A 1N2OA 1CZKA 5KO2A 3P71T 3AJ9A 4ENQA 1U2QA 3AK4A 2B5VA 4ZJPA 1EQAA 4RV5A 3I34X 4D6YA 3GUHA 3OHMA 3WNCA 5KU1A 4WZBE 3AB7A 1DC7A 2EJCA 1JIJA 2QRKA 3WY9A 3LVFO 3Q3EA 1J0XO 1DPFA 2CFOA 5IYZB 3DD5A 2VDRB 4DSTA 4ZRNA 1ESMA 3NEJA 4EABA 3G9UA 4K28A 4EHLA 3TFWA 2WICA 1LI7A 2C59A 1CXZA 2CUZA 3F8TA 2ONZA 3Q0IA 4CG0A 2BSXA 3T3DA 3VUFA 4DCSA 4N6GA 1XZDA 1QK4A 1F8UA 1JR3D 3LOQA 2FJUA 3LA6A 1CVRA 4U3JA 3PLAE 3X0DA 1GZDA 2X22A 2HMYB 4CMJA 1H4QA 2BELA 2GR9A 3GHYA 1TTPB 1SR8A 5CXQA 3WB0A 3HUEA 1P60A 3RFFA 3VKVA 3GP3A 3F3KA 2JGJA 5ENZA 2L17A 1WCWA 5G0SA 5JCZA 3GFQA 4RMJA 4MKIA 5B4UA 3E2IA 4CKBA 2PEZA 3KL2A 1F3OA 3MLAA 3ORYA 1NW6A 4YGXB 4C7JA 5AVXA 3MWEA 1JLSA 2AN3A 1I1QB 1E61A 2XGGA 1DG3A 3G5MA 2ZM5A 5EUQB 3EXG2 1XVAA 4YJGA 3EW7A 3I04A 4C0JA 4IHJF 3PS9A 4C3VA 2ZRIA 3AW8A 1H8HA 5A05A 4NFSA 4IKOA 3A3NA 3OLVA 1O95C 2AFRA 1Q2UA 2NUAA 2NU9A 5DCWA 3R5BA 2BFEA 1NUTA 3O73A 3SBEA 5I48A 2BC9A 2FPMA 3FDXA 2JLUA 2VJMB 2XCRB 1EB8A 3G79A 1NBEA 1ORHA 3BH0A 2WNSA 3A36A 4N41A 1E6KA 2CUKA 4GOKA 3H16A 1SQ0A 3Q0TA 4QYSA 1BH2A 2AH5A 3KQOA 4DCUA 3QOYA 5GWXA 3I0MA 3TIVA 1M1YA 3LKBA 3TJRA 1JQAA 1KPGA 3INNA 3KJFA 1QMPA 3EWAA 3QPWA 3A1SA 4J0EA 4O3FA 4RGBA 1GAQA 4PLPA 1I6LA 4HQOA 2XYHA 1GL3A 3G8DA 4F46A 1REQB 5K0FA 5KYWB 1TGSI 3ZY4A 2C4NA 2V7XA 4ZOLF 1PJ4A 3ZWYA 1CWUA 3AUSA 4G41A 2IGBA 4HEQA 4KR2A 3EXHC 2CXRA 2X9VA 4TXLA 2E49A 1M1ZA 2NZWA 2IEBA 1DKPA 4QU0A 5LKAA 1M2KA 1PTKA 1W5BA 4GI1A 1LDYA 1LC3A 1SBNE 4RUKA 2XODA 4HRYA 1I5RA 5DCLA 2JLCA 2ZSFA 3FOZA 3P5BA 2O2ZA 4RXMA 4B3HA 4C43A 5DNDA 3D7RA 4AJHA 2JNWA 2JIRA 3MGCA 5BP7A 1RMYA 1SPXA 2JLAA 3CCBA 1PU2A 1X4SA 3DQZA 1HOXA 13PKA 2HJRA 3QUTA 4QELA 4MDHA 2EYUA 4INAA 4O1MA 4YRBA 1M6VA 3ICEA 4BPBA 5TQ0A 3H5IA 3TNJA 3FPFA 2OFOA 4CI0B 5ILGA 4IGFA 3M82A 1I0LA 2GPJA 4MR7B 5HFNA 1T29A 1AZWA 3C8MA 1VLHA 3BJIA 2VHWA 4MO9A 2CFIA 1KHHA 2Z30A 3MNFA 3G9QA 3HUFA 2ZDGA 3OM8A 3IALA 4IVQA 4LN1A 5BSTA 3SBXA 1U1IA 5K6TA 2E6UX 2B69A 2QAIA 1KJIA 4MLDA 2HCBA 4TKUA 1R5BA 1EZZA 4NYJR 3JASA 5KAPA 3L41A 5BPFA 5BXYA 2PUBA 2FMHA 3IJEB 2CNNA 5K8LA 5CLJA 1RFLA 2BN4A 2V5VA 4TTRA 3SG0A 4CM8A 3TGLA 3QBDA 3C1AA 1EFTA 5H4GA 2OLKA 2VF5X 2Y8EA 3LGSA 3LM8A 3X1WA 1SURA 4UTZA 1TA9A 5I9SA 3KJZA 4XB6B 4Y6PA 1NFFA 1OI7A 3ELBA 5A06A 1S1CA 3GG2A 3HHEA 3ZCXA 3I4CA 3E3LA 3HJTA 2V7BA 2YVUA 3EMDA 4GVPA 3W1VA 2UYQA 2A3RA 2QLJA 2FEPA 4INOA 1A72A 1UKZA 3VXKA 3R6DA 1VE5A 3VR6H 3O21A 4DCNA 5JSUA 2VWQA 3I01M 4PZYA 3I1IA 3UKDA 1OWPA 1ZJ5A 2R8YA 2IJGX 3K20A 2ZBGA 3I04M 4D8WA 2MWMA 1N7IA 2G17A 3DMDA 2V6FA 2R7MA 1G42A 2NYAA 4GPBA 5CJPA 2IXDA 4L9AA 5AOAA 2HDNB 4L6IA 3RKRA 1A5ZA 2R8PA 3QE2A 3WWDA 5EKTA 4WY8A 3MSCA 5FPSA 1P9GA 3SZ3A 2N42A 3LYAA 5ESWA 3L8YA 4FD3A 1G5QA 3BREA 3MCZA 1E9VA 2QMZA 5B7QA 5ERXA 2XQFA 1E6WA 1EB9A 2IDZA 2GQ0A 2J33A 3I23A 4RVOA 2PG3A 3FVVA 4GKJB 2JHPA 4HDMB 3JATA 4J0HA 4PSKA 3F7OA 1QP0A 3AUFA 4L5JA 4UATA 4C4YA 2PGNA 1LS6A 3DNPA 4C4ZA 5FOXA 3ROKA 1W29A 1OZGA 4L9MA 2TMDA 1YOVB 1VPEA 1WUTA 1XNQB 2RKBA 5CCLA 5K3EA 3EZXA 1N0HA 3QX8A 2CEAA 1PGJA 3UK0A 3GRRA 4RORA 3WJ1A 4AKIA 2WINI 2EFJA 3LHDA 3L8EA 4NZYA 5DP2A 2FEMA 3PXCX 5KOHA 2QI9C 5AESA 1JJVA 2HU2A 4MHSA 3SGLA 4E1BA 4XOUA 1AK9A 3N8NA 4HWRA 1BOFA 2XD4A 5I9IA 1QHYA 1QQBA 3I9FA 1UH5A 4M9SA 5J2UB 3VR1A 3PDIB 2REOA 4HXFB 3R5FA 3DOOA 4IGEA 4N40A 2LWIA 3VV2A 4CR8A 4EUFA 4BP8A 3WX0A 2HHHB 3CC8A 3DYBA 1OI4A 1N1DA 3A1UA 5CGZA 4AAYA 1OU4A 3PX2A 4DCCA 3ZUPA 3CR7A 5E7MA 1RYHA 4BRSA 3TLZA 1DX4A 3G02A 4BVEA 1G98A 2VHTA 4YC7A 2C2OA 3L4SO 4CM9A 4RJTA 1USUA 3G2KA 2A7QA 4OHXA 1EUCA 1NYQA 1KYQA 3NHUA 3Q11A 3DDZX 3SNKA 4CV0A 3SU8A 2VYQA 3V1UA 5KKCA 3ADPA 4XYMA 1J2RA 1P29A 3RFVA 4BNZA 4LHEA 4YMUA 1YVRA 3KUDA 3TRJA 2C4KA 1CDDA 3WRVA 3U5ZB 2C9OA 1WKBA 2R00A 5AK3A 3CPEA 4P3KA 4YLGA 3ILVA 3S2YA 3F5SA 2ISSD 2D1SA 4TMZA 2PZAA 3AV3A 2AI3A 3DT6A 1VHLA 3IGFA 1AGPA 4PNPA 3ND9A 2WDPA 2ZBPA 5AKXA 4Z0NA 2V7QA 3VZQA 3GZ4A 3TD2A 3QKRA 1CY7A 1D8AA 2F1OA 3B7PA 5IVDA 3HI6A 1KE1A 3ZG6A 5AVZA 3J7AC 1K2WA 3L6DA 1R8SA 3RBVA 2AMYA 3R9WA 1X15A 1LVGA 4XVUA 2GJKA 1CR0A 1ORWA 1W581 1YQUA 2Q4BA 5AW8A 1I33A 1VG1A 1JBKA 4MVCA 5FTKA 1JR4A 2FKAA 4B31A 5TMBA 5D2CA 1KEZA 1Y80A 2IIQA 4CF5A 3AVTA 2H7XA 1UWLA 5D3MA 4OHCA 3TOXA 4BE4A 3IR7A 2WUEA 1JDUA 1WXHA 2XNDD 3CNHA 1UQRA 3NT5A 4IV0A 2QIOA 3FVRA 2XT9A 1RXVA 1LPNA 5AJXA 1QQAA 4IHAA 5JJLA 3RIXA 1IN6A 4DKXA 4EB8A 3JWPA 5HNKA 3U4QB 4PAQA 3L40A 2CVQA 1AKEA 3BMQB 3DMRA 4JFAA 2FN7A 2J6CA 4I6GA 3VV3A 3ZXSA 5HR5A 1AK1A 1GZVA 4MHTA 4R7ZA 3DDHA 3DM5A 3HPQA 4C6RA 5FPPA 2OD9A 3G6WA 4YCDA 5JWOA 2YJ4A 1WV1A 1RCTE 1Y3FE 3CXUA 1FDOA 4P4SA 4LE1A 4IHQA 5AKJA 2YN0A 1PYOA 4UEWA 2Q5IA 4ZQCB 1RCFA 4IV8A 2RBEA 1NBMA 1R0BA 1U7ZA 3AF1A 1DBVO 1T1JA 3DGFC 4PRLA 2WJAA 3L8MA 3RSLA 2FPLA 2C03A 3IB3A 4DHEA 5EP2A 2E5RA 4BO1A 1T5BA 4OHFA 2BGUA 4C4SA 4BATA 2YZGA 3DWIA 3LBFA 4M1QA 2FPIA 4ZDWA 4RAOA 2EWVA 2TMGA 2RKOA 1N6KA 5B4VA 3SAJA 4LHWA 3WGVA 4E4YA 1XA3A 5I7VA 1OWMA 2WD7A 2PKRA 4QXMA 2XOEA 2NZ8A 4LWPA 5AJVB 4FJ2A 2VEOA 1NBWB 2WILA 1Z56C 2XUAA 1XLTA 2YQ5A 1XZKA 1B7GO 3QEOA 4I99A 2BTQA 5FFMA 5BUCA 2MSDB 4R16A 5JYEA 1Q7GA 1P0IA 3TO5A 3B3GA 5DGXA 4ZCMA 3KZVA 4E5DA 2EJWA 1OFGA 1QQ6A 1K4YA 1T4DA 1U0JA 1NP7A 2P9EA 3K31A 2CWFA 2WMDA 3KEOA 3NBYC 4H31A 4P31A 3S2EA 3ADDA 1YZTA 1JPJA 2UVPA 4K03A 3BIOA 3DMHA 2ZTSA 3MTDA