2UZ3A

Crystal structure of thymidine kinase with dttp from u. urealyticum
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
207
structure length
190
Chain Sequence
IGWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKISVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIKFFKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDINE KINASE
publication title Structures of Thymidine Kinase 1 of Human and Mycoplasmic Origin
pubmed doi rcsb
source organism Ureaplasma urealyticum
total genus 51
structure length 190
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2uz3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2uz3A01
1KZ7B 2SHKA 2DWOA 1J2JA 4YC7A 1IY1A 4YDSA 2NPFA 1Z22A 4MYCA 1XX6A 3CONA 3AVPA 4GT1A 3KKNA 2FN4A 2HEIA 5IK2D 4GMDA 3KKPA 2ZRMA 2UZ3A 3BH6A 3AKYA 3SYLA 1NRJB 2CLCX 5DH9A 1SXJC 1YQTA 4B3BA 4XSGA 3NEJA 4M1YA 3GLFA 1LS6A 1E2DA 2ZRBA 1KBEA 3L8YA 4KVAA 2YC2C 4NMMA 2WIAA 4QBGB 3T12A 2JLUA 4HB0A 1JXOA 3PUYA 3GJ4A 2QSZA 1OXTA 3ICQB 3ZGXA 4DUGA 3R8FA 1PLLA 1XNJA 3EPJA 2JLVA 1UADA 5FUWA 3TRFA 2P5SA 2NO0A 1Z0KA 4RD0A 1XEXB 3JVVA 5CJ2A 1E9CA 5CJPA 5G53C 4RZXA 2OG2A 4Q9JA 1JR3E 4Q02A 1GTVA 1QRAA 3NIBA 4IVPA 2O8FB 3EPLA 2FV8A 2YWEA 4KFUA 4YQFA 1G16A 4DEYA 1CU1A 2AWOA 2BV3A 3B1VA 1IN5A 1Q3HA 3X1ZA 2PLRA 2O5VA 3GFPA 2FF7A 3O8CA 4D82A 1G4AE 4JT2A 4D80A 1K8RA 1ZRHA 3BB4A 5J4HA 4NU0A 2WBLC 2YWHA 2O0KA 3CX6A 1IN8A 1VHTA 4PHGA 4RZ2A 3TR5A 3KJHA 2YVUA 3T61A 3GP8A 3K0CA 4LHZA 4U5XA 2V1XA 4TL9A 1N6NA 2ELIA 1R2QA 4RZUA 3SDZA 1ZD8A 1FW6A 2ATVA 4DSTA 2FFAA 3QJYA 2PL3A 2H8KA 3EC1A 1Q1BA 3FFBA 3RYTC 5AUPB 5J40A 3BJIC 4P4SB 4IVQA 5DN6A 1YR6A 3K0AB 4KAXA 5FR2A 3TMKA 2VO1A 4EFMA 4OQLA 2QAGC 2QU8A 1YRBA 3DZ8A 1FX0A 1U8ZA 2A5JA 1SXJE 4H1VA 5EUQB 2ZQ5A 3KKMA 4D26A 4I1VA 2W83A 3WXMA 1ETUA 1II0A 2GAAA 4GZLA 1KNXA 2P2LA 1E2NA 1JECA 3G82C 1W46A 4EKDA 2F3TA 2Z6VA 4QGHA 4BLTA 2RKOA 1DAMA 1YJ5A 1GP2A 3K53A 4JLBA 1P72A 3ZVLA 4ZO4A 3ZVRA 5H1YA 1IOZA 2W58A 2AR7A 2WJVA 4FMBB 5BYJA 2FPMA 3R7WB 5F9HA 4PHHA 3CZPA 2C2HA 4P4TA 2C96A 4NKRA 1H8EA 2JIZA 1TUEA 2H16A 4HUQA 1G291 4B34A 3I72A 4EPXA 2QE7D 4GZMA 4Q4HA 4RVCA 4E09A 1UDWA 5B58C 3U44B 3U7GA 4QHYA 1XTRA 3WHLA 1I2DA 2GCOB 1BIFA 3ZD6A 1OF1A 1SVKA 3GMTA 2QSYA 1X1RA 1GG2A 3VAAA 4KI0A 1S96A 2FSGA 1EFTA 4BZQA 1I4TD 3QKSA 3VHXA 3VFDA 2GK6A 3C7KA 1KZGB 3LRPA 4MGIR 1M7BA 1SGWA 3QXHA 2C5LA 1Z8FA 1G21E 2D62A 4HAXA 4PTLA 2VIIA 4EPVA 2AK2A 4DIDA 1S1MA 1NVUQ 2REOA 3KUCA 3QPVA 2ZYTX 1ZCAA 4M1SA 4BRUA 4M21A 4A9AA 2ZR9A 3SBEA 1G18A 4MQBA 3B9PA 3TLXA 1ZNXA 4MH0R 1T0JB 1R8SA 2R44A 3VR1A 1A4RA 1UFQA 2LWIA 2WMNB 3B60A 1SKYE 3ZIAD 2D2FA 4Q4JB 3LY5A 2RHDA 3EZ6A 3IKJA 3A1UA 2MSDB 3I4LA 4QM7A 1YR9A 2ZRDA 4Q9KA 1B23P 3IQXA 1RFLA 2PX3A 1R4AA 3UIEA 4P33A 3CF2A 4JIMA 5FH9A 1G7CA 3AH8A 1E9AA 2F1HA 4A1FA 4MRPA 4P4UA 2JLQA 4D0NA 1E2GA 2ZJ8A 4Q1AA 4P0TA 5B57C 2OE2A 3P1JA 3C15C 4BFVA 4KLNA 1XMVA 2AX4A 4Q4AA 2J87A 4NYIQ 4QJ3A 4C2TA 4IEIA 4DSUA 2J7PD 3KQHA 1FP7A 2O8DA 3I1FA 1SVLA 2OUKA 3CW2A 3L0IB 3Q3JB 4HB4A 3BXZA 1TF2A 3IUYA 2CCGA 4RD1A 5SZKB 1SQ5A 1ZNZA 1Z0JA 2ERYA 2IYUA 1N3BA 2ZSBA 5EXSA 5FOSA 1JQLB 1Q12A 5HKKA 2GHIA 3NC1C 4DKXA 2VRWB 4LV6A 1DS6A 3B13B 4IXMA 1GRNA 1KO1A 4B35A 1CJKC 2FX3A 4M9QA 4PAMA 1TTTA 3PR1A 1ZIPA 2FZ4A 2YWGA 3CM0A 1K5GA 3X2SA 1FUKA 1XDBA 3CWZA 4A2PA 1G9XA 4YXWA 4PQYA 4B2PA 5LB4A 4V0ME 5L3QB 3SFVA 2RMKA 2ODBA 2HJGA 5KYKA 5CYOA 5J4VA 1NBMA 1M1YE 1KNQA 1NVXQ 1A2BA 4LJ5A 2A3RA 3ADKA 4EJSC 1DADA 2BBOA 3RANA 4LHXA 3E2IA 2H92A 5JSZB 1E4VA 3VTKA 1OHHD 2ZJAA 2R6DA 4GBMA 3I32A 3TNFA 5KDDA 3ICEA 1Z83A 1UM8A 2ZAMA 1W44A 2E73A 4A36A 1TU4A 4PXAA 3DL0A 2KI5A 3M6AA 1ZM9A 2XNDA 2WMOB 2X19A 1XXHB 4C0LA 5JHGB 5G3ZA 3KQLA 3IIKA 1XJCA 3EX7C 1MKYA 5JS7A 1XCGB 3PUXA 2N46A 1N6OA 3CX8A 4PPQA 3EZ7A 1A5TA 2QPOA 5CK4A 1Z2AA 4BEJA 4B2IA 1L4UA 1P62B 3QKUA 1AK2A 1JEDA 3A36A 5EE9A 3RS7A 3SBDA 4QNRA 1MRNA 3RRMA 2PMKA 1CIPA 2JCSA 1MOZA 4Q7JB 3Q5EA 2KWIA 2OFOA 2Q0HA 1ZJ6A 1N5LA 1ZD1A 1HY3A 2IXGA 1P9WA 3AVXA 4DVGA 1N0WA 2GF0A 2ZI3A 1GRQA 1E2EA 4G3XA 3VMFA 1CR4A 1RIFA 5E7IA 3TE6A 3E1SA 4NYMR 4W5HA 3V4RA 4DDUA 4ARZA 4URUR 5DLQC 3S1AB 3AEZA 5C2JB 4DB4A 4LHWA 1UKYA 3MUFA 2H17A 3A1SA 4IOMA 4LK2A 1HH4A 4DLXA 3M4YA 4KVGA 1TPZA 2JJ2D 3ETLA 4V0OA 5JHHB 2CNWD 3DM5A 1G64A 5FTNA 4EQ6B 1G7RA 2V1UA 3E70C 5KPDA 1XEFA 1OV4A 3GJ6A 3IEUA 1IHUA 4L9WA 3T1TA 3L43A 3KZ1E 2ZS7A 2GDJA 4G5OA 5AWFC 4D25A 5L3SA 5FTKA 3LVQE 4D4KA 2FPLA 1E1QD 3GLFB 3SOPA 1E9EA 2BC9A 3ECCA 3BBPA 3F5FA 1TX4B 3LD9A 1W2GA 1ZNWA 4LJ9A 4II7A 4AYTA 3OE7D 5JI3E 1FQJA 1P3JA 5AUNB 1P61B 3RSLA 3TR0A 2BCGY 5TVKA 1TEXA 1KI7A 3AVQA 4NYIR 1T3HA 5JRZA 3GLGE 3RWOA 4ERNA 2Z4RA 4E22A 2QTVB 4J0QA 1TL7C 2CXXA 2WICA 2QM7A 1NIJA 2JLSA 3I5XA 1GZSA 5IK2A 4G1UC 5FPYA 5A4JA 1NJFA 3MWKA 1OIXA 4PANA 1W2HA 5JI2E 2GKSA 3RS4A 3SC3A 4FWTA 1KMHB 3QNUA 1TBOA 4IKEA 1EESA 5AJVB 4NTZA 4Q4LA 3CIOA 1NG9A 5K8IA 1R0YA 4YONB 5LBIA 3HU1A 4OKSA 1NSFA 4M9SA 5BN3A 2DFNA 1KDOA 1NMYA 4KSBA 4G0NA 4HZIA 1WCV1 4TT3D 4A6PA 5DI9A 4ESVA 1J70A 4U02A 2NQ2C 4BFXA 2AKYA 5DE3A 3AGPA 2NIPA 4OK6A 2GXSA 2QUZA 3ZJYA 1ZBDA 3AVVA 4PQFA 2R2AA 2P65A 1HEIA 4JLVA 1VHLA 1FX0B 2GAOA 5TB5A 1J8YF 1L4YA 3CRW1 2Q3MA 2X8AA 2GA8A 3B6EA 1WQ1R 2VHCA 3DMDA 4XIGS 2KBEA 3LX5A 4CEHB 2PCLA 1YZKA 1QHSA 2PZGA 1YZGA 3LFUA 1SVIA 3FPAA 2AKAB 4O2LA 1G3UA 3R9IA 2ZRNA 2ZU0C 5GVRA 1JR3D 3UWKA 3A8TA 4WW0A 4Q7LA 1T8TA 1VYUA 3U5ZB 3AF4A 4OHYA 1AZTA 1G6OA 2WKQA 2AK3A 1JPNA 2EW1A 4TZ0A 2JEOA 1TU3A 4AKHA 2OBNA 3CX7A 4P4SA 2W6ID 2GVIA 3IGFA 3K0AA 4TL6A 4UNNA 1SHKA 3CF6R 4HDCA 4CT5A 2EFCB 1ESNA 4HUQB 5JRJA 4BLQA 4BFWA 4Q48A 3K70D 4HLCA 4RD4A 5EP4A 4I1UA 3QXJA 4UXJA 2ZU6A 2HT1A 1BKDR 3O47A 2QGNA 1Z0IA 4PC6A 4C9BA 1OW3B 3EWAA 2O8EB 4B3FX 1R79A 1X8LA 4I1SA 1GNQA 2VEDA 4OI2A 1NLFA 4D0LB 3QKSB 1CJTC 5AR1A 4CZ2A 5FOWA 2XZPA 3RRZA 1EG7A 2ZSFA 1E96A 1KY3A 2E1RA 5IRCD 1GM5A 2VHJA 1SXJD 4JVLA 2A30A 1VIYA 3NHBA 1Z08A 1XTSA 3KB1A 4PSKA 2QMEA 1G17A 2EYQA 1V43A 3IPYA 3AVTA 1DOAA 4GRAA 4F91B 4LJ4A 5D3MA 4Q9IA 2BJWA 2ORIA 3SFZA 4MITA 3GFTA 1R0WA 1OYYA 5KOYA 3FHOA 2GCOA 4HZUB 3Q7PA 2ANCA 4MDFA 2J59A 3V9PA 1J99A 1KDRA 1G19A 4TTPA 2ZAOA 4LYFA 4DLUA 2XSZD 4WXRA 2WSSA 2QY9A 3MLEA 4FWIB 5FUVA 5JWHA 1H8HD 2HJVA 5DI3B 3BD9A 5EE0A 2FEOA 4JBWA 3MWJA 4WZ6A 2IK8A 1II8B 1S9HA 4L5BA 1YHNA 3E5HA 4FKDA 1IXSB 1EX7A 1UKZA 3PUZA 3AKCA 4XVRA 2ZI5A 1AKEA 2Z43A 3A37A 2EQBA 3ND8A 2F1JA 4LV8B 2PT5A 2JA1A 2NZJA 1EXMA 1NY5A 2DB3A 2Z83A 1PJRA 3LWNA 4Q4AB 1WRBA 3AF1A 2OCAA 3VKWA 5ANRB 1ELOA 1M2OB 3EA5A 3KXKA 3DHWC 3LBIA 1R8QA 5DISB 2J46A 4HLUA 1NL3A 2RGEA 2PEZA 1LV7A 2OSBA 3QOFA 3PUVA 3ZZTA 5CK5A 4URXR 1P60A 2IS2A 5KSYA 1MO3A 4ASUA 4DJTA 2FZLA 2PZFA 4Q4JA 1KI2A 621PA 3SHFA 3I73A 5CIQA 2QQEA 3DO6A 4MYTA 1J8MF 4LBZA 1K5DA 2CLDX 3DPUA 4HLDA 5CITA 1X8JA 4DCVA 4QGFA 4QBFA 1HQYE 3R9XA 2OAQ1 2BJVA 1XD2B 3R8CA 3OFND 3AF3A 4NP6A 1XWIA 3L8ZA 1G8GA 1G8YA 4B73A 5A0FA 5CB6A 2J7PA 1Z6YA 3VX3A 4F92B 3KJGA 4C2UA 2DBYA 1RW4A 1OIWA 4HB2A 2ZYUX 5LPNA 4QRHA 3EIHA 4GI7A 1OH5A 1E0SA 3OEED 2Y8EA 2NO7A 2GBLA 1WP9A 1Y8FA 3TGPA 1HTWA 3QUSA 1Z47A 1U0JA 5GJCA 4B33A 3TAUA 3T5GA 1XTKA 2C99A 3H0KA 3W5JA 3A4MA 1CXZA 1E2LA 1TNDA 3HWSA 3TSZA 4NCKA 4M1KA 1JJ7A 1M8PA 1DAGA 1KK3A 1JBKA 2Q21A 1KI3A 3SNHA 5FBWB 1PTQA 1DEKA 3C14C 2WHXA 2RGXA 3L0SA 1E79D 1L2TA 2D06A 3H1TA 2ATXA 1XMIA 5HTKA 2CCJA 2CK3D 1ZMXA 4N0DA 3MJRA 3TUZC 2BCJQ 1GKYA 2ECKA 5TDHA 2EFEB 2N42A 2IW3A 4UJ5A 4ZCMA 1AS0A 1Z3IX 3FFAA 5CDFA 1VTKA 4KV9A 2Q9CA 2IYXA 4FCVA 2ZRGA 4US0R 4WOPA 1CTQA 1SVWA 1B0UA 1W36C 4MA4A 4A0FA 4GOKA 3IPXA 1AIPA 1GOTA 4BWYA 4S35A 1ZYUA 2BEKA 3W6OA 1ZINA 1XXHA 3NBZC 2B6HA 2ODWA 2OXRA 4ARZB 3UGIA 1TQDA 4EPWA 2GRJA 5DYGA 3RAPR 1KDPA 2VSOA 3UEJA 2ZRHA 2XZLA 4JLNA 3W90A 4CEIA 3C8UA 4LHVA 3B2EA 4RJLA 3U7EB 2AWNA 2IXFA 4TSFD 2ZRCA 3K9GA 4TYWA 1Z06A 3IHWA 4KFTA 1NLYA 3NBXX 4KSCA 4B44A 3KQKA 5L3SB 4ZDIA 4I99A 2QZ4A 2ZRPA 3RSOA 5L8VA 2OAP1 2D7DA 4B6EA 2ZPTX 2C78A 2H18A 4LBVA 5GJWC 3TK1A 1UKEA 4DLVA 5F98A 1N2CE 2WWFA 1XTQA 1OLOA 1NI3A 2KSQA 3FKSA 3S1AA 1BO6A 4Q19A 5HZKA 4DLSA 2J0QA 2JJ2A 4KBGA 3CRMA 2CNWA 1Y3AA 3GJ7A 4JS0A 4FN5A 1M6NA 4FMDB 3UFFA 5E7MA 4AG5A 1KI6B 2C9OA 3K09A 3TUIC 1OT3A 4EQ6A 2F7SA 1F48A 1OKKD 4B6FA 2ODEA 2WWXA 4E5UA 1G3QA 1PV4A 4KXFB 2WJIA 1C1YA 3CZQA 3SYKA 1G8PA 3KKQA 5FR1A 3X1XA 5JS8A 1NSTA 3TIFA 1E1QA 1JALA 3FWYA 2ZI4A 2BBWA 3DKVA 3OEHD 1EWRA 4FMCB 4XD7D 1GVNB 1VIAA 3QE0A 2G3YA 1KI8A 1WMSA 3B9QA 1NIPA 3OE7A 4TQUS 3GJ8A 1FMLA 2G6BA 3CR7A 4M1TA 3WP0A 2JJ1A 5KTYA 2BBSA 3P26A 4I1OA 1R5BA 2YOGA 1D6JA 1UBGA 2ZJZA 4RY2A 1R6BX 3OESA 5EE3A 4JKIA 4URWR 4F38A 2OBMA 2OEPA 4MYUA 1RFHA 4B71A 4D4JA 3QVVA 2ZUDA 2MMCA 1UDXA 2IYWA 4B76A 1NKSA 4F4IA 5FPKA 5LD2B 4DXAA 3NDBB 3CNNA 2EWWA 2NTYC 3D8BA 1KMHA 3AQ4A 2WSMA 2YYZA 2QL6A 2J5XA 3CPHA 4PC3A 3HP1A 3BK7A 1T9HA 3RS0A 1NVWQ 3K8YA 2O52A 2NPIA 1E9DA 2H57A 3K0SA 3LBNA 4D81A 3QIAA 3CBQA 4HAWA 2OCPA 2BVNA 2QP4A 2WM9B 1MH1A 4KBFA 2GVDC 1LF5A 1P9RA 3HJNA 3CR8A 5KDLA 3U6KA 3L2OB 4R9UC 2J1LA 3ASZA 1QZXA 2CHQA 4N3NA 1G5RA 1ESMA 2NO1A 3ZQ6A 1KSGA 4LRWA 2X1VA 2QTHA 5UKDA 5E3HA 4NH0A 4A0GA 4A8JB 1P4SA 3EW9A 3NBFA 1IN6A 1QVAA 3KDSE 2ZJBA 4G01B 3K0FA 2J7KA 4IW3B 5EZ5A 3LV8A 4IOKA 4Q01A 1U9IA 4CYMA 4NCJA 1S3GA 2R8RA 2EFGA 4F7WA 3LX8A 1GKIA 4AYWA 4CEHA 3WBKA 2GJAA 4AG6A 1KJZA 4LSGA 2XOKA 1FNMA 1BMFA 2WIBA 3EASA 1YR7A 4IDNA 4HI0E 3GJ3A 5TXGA 2AL7A 2W6JD 5BXQC 4KU4A 2IA5A 1JR6A 4KO8A 3JVUA 1D2MA 3FB4A 4OK3A 2WOJA 1VYVA 1W4RA 3NHAA 1HYQA 2J9RA 2RB4A 2W00A 2ROWA 1GDDA 1VMAA 1F3OA 1OSNA 2JGNA 3GQBA 2ZVPX 1S0UA 2MMGA 3QG1A 2IUUA 1E2HA 4YLGA 4E03A 1D2EA 2W6IA 1FTNA 4ZKEA 1G41A 1W0JA 3GEIA 3PUWA 2A9KA 2BWJA 3P20A 3W5IA 1DG1G 5DYIA 4AKGA 2ZYVX 2KJQA 3HPQA 4HATA 4PO1A 4O2RA 1OFTA 4D2IA 2QROA 3IBGA 4AKIA 5D3MB 4F93B 1KYIA 1G5TA 3EG5A 2GVZC 2R6CA 1LB1B 2FSIA 1FUUA 2O8EA 4OQMA 3H86A 2P67A 1Q1EA 1AA9A 4GNKA 4NCHA 5EQTA 4CVNA 4LJ8A 4WZBE 1NMZA 3PXGA 1W47A 3DVLA 3N2EA 4RFSA 1AGPA 3U7FB 3PVSA 4XOIA 2XTMA 3U3KA 1SXJA 3A1WA 4Q7KA 1Y63A 4NYMQ 4LI0A 1VKJA 2ZRFA 5KPJA 2AD1A 1O87A 1ANKA 4TLAA 5AK0A 3UMSA 2OV2A 2VP6A 4X8LA 4WIAA 2CLSA 3QY0A 3AP3A 3GD7A 1XRJA 1CR0A 2FGKA 2NG1A 3QVUA 4O25A 2ZSEA 4UJ3A 4UNSA 1XJQA 3I8SA 3LW8A 4JLOA 1QVRA 4HZUA 2D74A 3NG1A 4Q66C 5B64A 3GLIE 3T1VA 1U8AA 2WPDD 3L82B 1UEIA 3QBVA 4LY6A 3CB4A 5H8WA 2J0VA 2LCFA 4UXHA 2RGGA 2QA5A 3AF2A 4GL2A 1EX6A 2JLZA 1CJMA 4IDPA 5DI3A 2WAXA 1EFCA 3ZD7A 1II8A 1ZM3A 3QI2A 4LC0A 3DOEA 4H1UA 2DYKA 4EFLA 2F6RA 1W5TA 2I1QA 2OXCA 2HT6A 3BE4A 4GPTA 5H68A 1E9BA 2WWWA 2P3SA 2JLYA 3I8XA 5JJKA 1G7SA 3LNCA 1IBRA 2FPKA 4PZZA 1KK2A 2C03A 1GIAA 3THYA 1P2TA 3N70A 4QJ4A 1JJVA 5KO2A 3IEVA 1E6CA 5M04A 4JLDA 2JAQA 3GLHE 4JVMA 2ZRLA 1CULC 2PEYA 3FMIA 4PZYA 4US2R 4XWAA 2IUTA 4RCZA 1OH6A 4XTRA 3OAAD 3NH9A 4NE2A 4C0JA 1OFUX 1E9RA 3GEEA 3UGLA 1E2QA 4KYIB 2C9YA 3BOSA 1A7JA 1C9KA 2MSCB 3H2YA 1XD2A 2OZEA 3PCRB 2BMFA 3T15A 1IM2A 2ASEA 4BLSA 4O3MA 2XX3A 1OXSC 2W2TA 3LQRA 3UG6A 2UZIR 2XTNA 2RH5A 1PTRA 2VP4A 2V7QD 3OEEA 4IFBA 3VR3A 4AWXA 3OIYA 3FHTA 3BGWA 2RGCA 3I61A 3J81k 3U6BA 4PAQA 2GEUA 4U7DA 3SHWA 1KO5A 2YC4C 3BFKA 4BQSA 1KJYA 1IY2A 2AN9A 3KJIA 3VKHA 3THWA 1PUJA 4IHQA 1UPTA 5FBLB 2AFHE 3AKEA 4JKYA 4A82A 5C4GB 1E1RD 1IAQA 1KI1A 1N5IA 2IYSA 2FFBA 4PFSA 1JQJC 5E95A 3FOZA 1S1CA 1R5OA 2HLDD 2IXEA 1XEWY 2DHRA 1W0KA 1Z5ZA 2HV8A 4BZPA 5J4YA 1Q0UA 1Q1QA 1T91A 1ZIOA 2ZI7A 4QGGA 1RE0A 4CEIB 4Q47A 3SJCA 2XB4A 2ZJOA 4N1AA 1XCPA 2VQSA 4KFRA 3AVUA 2ZJ2A 1X3SA 5LD2C 821PA 4H9GA 4IDHA 4V03A 1TADA 2ZEJA 3GJXC 1E2MA 4OI1A 2I4IA 3ZS9A 4AY2A 3FYHA 1BS1A 1PLJA 5DHFA 4V0MA 5EE1A 1G8HA 3P32A 1Z2CA 4DIEA 4DDVA 3C16C 2P5TB 3MG9A 1Z6GA 1LFDB 5EUMA 1V5WA 5JCZA 1UJ2A 4LC1A 4OI0A 4MRSA 1ZM7A 4JT4A 1XF9A 5KSOA 1XBTA 2A7QA 2HYIC 4QC2A 2YHSA 4KHZA 2HUPA 3U60B 4Q9LA 5FOVA 5FL7A 2J0SA 2IF0A 3OHMA 1C4OA 1D2NA 4U00A 2B21A 5G40A 2CE7A 3QKRB 3CO5A 2O8BB 3JZMA 1AS2A 4JSYA 4YMUA 1XZPA 3LXRA 3QG5A 1W4BA 3TQFA 3VR5A 2GXAA 1OIVA 3BH0A 3TVTA 4C3ZA 3LXXA 2VLIA 1S8FA 4HAUA 2AFIE 2ZJ5A 4LJ7A 3BRWD 3UG7A 4QM6A 1EWQA 1MABB 2H1LA 1SZPA 5KU1A 1E4YA 4TQAA 2EVWX 2PMDA 4TYPA 4DB2A 2XGJA 1KI6A 1EFHA 1M74A 2FNAA 3REFA 4V0NA 1UBCA 3SJBA 2I3BA 1Q57A 2GILA 5FOUA 1RRPA 3BC1A 5DO9A 3TVDA 4R2HA 2QMOA 2DWPA 3OEHA 2QNRA 4XD7A 1BYIA 2VF7A 2IF2A 4JVSB 4GP7A 3TAHA 2B8TA 2W2XA 4BEBA 5A5GA 1CR1A 2VPPA 1VG1A 4ZI3A 4RD6A 1OYWA 2VHTA 3TQCA 1RJ9A 3UANA 4DUGD 3MWYW 1YRAA 3U4QB 5L3RA 4GSYA 2HXYA 1Z6AA 5FUXA 1NKTA 2ZUBA 1W5SA 3MGCA 3U2QA 2YV5A 2KE5A 2CVHA 4ACBA 2ZXUA 3AVOA 1D9XA 3LVRE 1OXVA 4PC1A 4YDHB 4Q18A 4QGAA 3ZZUA 1QHNA 4LYHA 4DCUA 4I81A 4NYJR 4WAUA 3U7HB 2Q9AA 2VH5R 1W36D 2WJYA 1GILA 1DTSA 1GL6A 5JFGA 1N0VC 2DFTA 1KO7A 1DAHA 1VCOA 2B7BA 2V54A 2XTZA 4RFVA 1N6IA 4A2WA 2YKGA 2ZE7A 3K0FB 3NDPA 1YVDA 4IFEA 4Q9HA 3KJEA 1R5NA 5JLJA 2IL1A 4WVFA 1AJEA 5DIFA 5E4FA 3LW7A 2G77B 1S4QA 3CF0A 1D9ZA 4OHXA 4YMWA 4M9XA 2ZI6A 4ESHA 3NH6A 3I62A 2RGNA 3TSOA 4XWOA 5EE5B 4ON9A 2YINC 5FPHA 1SKQA 1P5ZB 2IUSA 3ADCA 3RS3A 5JECA 3M0EA 1CRPA 3B1ZA 5DN6D 1LNZA 3QBTA 1QG2A 3RC3A 3SEAA 1MO4A 2C04A 4A8JA 2V3CC 3ZVNA 3K9LA 421PA 1WDTA 3NBYC 4M2LA 2FJUA 2OLJA 5EP3A 2GCNA 4GP6A 2VSFA 3K70B 2GXUA 2ZSAA 4LUCA 3GJ5A 3PIRA 2WZQA 3LA6A 3QF4B 1TAGA 3ZYCA 2I1VB 1XP8A 3BH7A 1P2VA 2GBLC 3I3SR 4TMTA 1FFHA 2IYZA 3UATA 2LKDA 5IDVA 1X86B 4B3XA 1U98A 3SS8A 2DWQA 2PCJA 1CS4C 1G3IA 2HXSA 3EAQA 3NVAA 4RFSB 4ZCIA 4PAOA 3SN6A 3QENA 4W5WA 2CHGA 2JDID 4C0SA 2GWHA 4F4CA 2ZR0A 2EWVA 1OB2A 1SXJB 3VR6A 1NP6A 4TN1A 4BFZA 2A5YB 2VF8A 3CPJB 1CJUC 2OO7A 1W1WA 2CMKA 2JIZD 4PPNA 2BMEA 4MUBA 3ZQJA 1GL7A 4RD2A 4TTQA 4LGMA 3W8RA 1UBFA 1RRCA 2QE7A 1EK0A 4Z51A 4JVNA 1M7GA 2YZ2A 2RGDA 1ZP6A 2VBCA 3MCAA 4ZIRB 4CF7A 4JYCA 3BB3A 3CKLA 4ZKDA 1XU4A 1GFIA 3WYFA 1S3SA 5EXTA 4C4PA 1CBUA 1GITA 3VNVA 1FOEB 5JJIA 1HA3A 5IHPA 1DAEA 2WAYA 4CDGA 1AQUA 1GNRA 2FE4A 2JLRA 2J45A 2L0XA 3PEYA 2R6GA 1E9FA 1ZUHA 1AN0A 3PQCA 2V8OA 4MKFA 4M22A 1E2FA 1CEEA 4NDZA 3B1XA 3CNLA 4L9SA 5EP1A 5LDDC 2C98A 1UAAA 2ZRIA 3CH4B 4G5SA 4Z54A 1KKLA 4CEJB 3K1JA 1MT0A 2OM2A 3WNCA 3KXIA 5EP2A 3AB3A 5D3QA 5ELXA 4TMKA 4PQRA 4DBLC 1HT1E 2PX0A 3IILA 4B32A 1WBBA 4F4JA 3G5UA 3TBKA 4TL7A 3ZIAA 2F9MA 2WPDA 1E32A 3THYB 1E99A 1UEJA 1FL9A 4B43A 2R6AA 2BDTA 1E0JA 3Q72A 2FFHA 3GCGA 3W6PA 1JPJA 3LH5A 2JJ8A 4UNRA 4PR0A 3SU8A 1Z6XA 5GVSA 4KCGA 1LF0A 4C0AC 4UXIA 2QAGB 3VX4A 4PC2A 2QP3A 4W7SA 3RWMB 1DO2A 2FNFX 5HCNA 2D7CA 1N6PA 4R2IA 3UMRA 4QBHA 1SKYB 1IJEA 1Q22A 2WWIA 4DCSA 1XEWX 4AC9A 3X1YA 3WY9A 2J3EA 4DZZA 1X8KA 2GJ9A 1GL9B 5K8LA 5EXPA 3KTAA 3V4FA 4EAQA 5BWMA 3K09C 2FSHA 1KBFA 3KUDA 2WTUA 2DPXA 1T3SA 2H5EA 3THXA 2ANBA 3UEYA 221PA 2REXB 1QF9A 1SVOA 5HKKD 1A2KC 4DWJA 4FMDF 3FMPB 3U3OA 5J5CA 1Q44A 2C77A 4Q5IA 1F6BA 3PEUA 1R0ZA 3NTUA 4LYJA 2GEDA 4WBSA 3THWB 1G3RA 1P7CA 4DLTA 1IONA 2JASA 2KB0A 2VL7A 5CLQA 521PA 2CL0X 3UPUA 3DZDA 4RKFA 4FMCF 1N6KA 1XXHE 4QG7A 5G3YA 1NBMD 1NVVR 2DFKB 4LX0A 4CW7A 2V7QA 4TMZA 3X1WA 1E2PA 2PBRA 2ZTSA 2XZOA 5DHAA 3WHKA 4RCYA 1XA6A 2QMHA 3TJZA 4DRZA 2O0JA 5TARA 2ORVA 2BKUA 3UK6A 5FTJA 1QHHA 1CKEA 1OHHA 3VU9A 5FUYA 1U2RA 4OBEA 4FCWA 5B30A 1DAIA 4L16A 3CLVA 2R62A 2XNDD 4MUAA 6Q21A 3U3JA 3B8HA 1DELA 1M34E 3DEFA 3Q9LA 1WE2A 2O8CB 721PA 5JWRA 1IN7A 1VYTA 4M1WA 3SI7A 5FFMA 1PVOA 3TH5A 2QBYA 4R71A 3Q5DA 3U3RA 5KNCA 2XNSA 3MMPA 4FW9A 1FQKA 2XJ9A 3EA0A 1YZNA 1VCMA 2ZREA 4M9ZA 4ZV4A 4TZ6A 3K0CC 3U3MA 1XMJA 3SJZA 5FOTA 1J90A 3TSWA 2JLXA 3R9WA 4AIIA 1XB2A 5FBVB 1FMJA 4MKHA 4DLWA 2IYQA 4TMVA 3DKPA 3OIVA 5KDOA 1TF7A 4ZPXA 3QPWA 1OXXK 2XAUA 1T5IA 1N0UA 1Z07A 3SR0A 2NMVA 4DCNA 3LQQA 5FPSA 4D4LA 3P4XA 1U9IC 3H4MA 2GXQA 3EXAA 1U81A 3GLFE 4JL5A 4MGZR 3ND9A 3L0OA 1SHZA 1KMQA 1PUIA 1AZSC 3ZS8A 1F2UA 2B92A 5C1BA 2GNOA 3B1WA 2G0NA 1P73A 1ZD9A 1D5CA 1TBNA 4JLJA 3FMOB 1FNNA 4GDFA 1FARA 1ZAKA 2EFDB 1N6HA 2W0MA 2WKPA 1H65A 3AUXA 1ZU4A 4IVRA 5KUTA 4DLRA 4BE7B 3QSYA 1XD9A 5L3VA 3QKRA 3EPHA 1COWD 2O8BA 4DC9A 1XPUA 4R7ZA 1QHXA 4HAYA 3AF0A 1NN0A 1HQCA 2PZEA 3RNLA 1N25A 1GWNA 1ZW6A 1K6MA 1RJ9B 4JJKA 4PHTA 5E7JA 5CB8A 4NCIA 2ZM5A 1KKMA 3B1YA 2XJ4A 5TV2A 2IYYA 1MABA 1QHYA 4EPRA 1HE1C 4TYYA 2BM1A 1RVDA 4D4MA 4KYUA 3IDQA 2V4ZA 4L8GA 1RPZA 1AKYA 1U90A 2EYUA 4C30A 1G8FA 1KY2A 3V00A 4EJSB 2NZ8A 2F3RA 2QG6A 3QPUA 4NL4H 5EZ6B 2V6IA 1I2MA 5JJLA 1EFUA 1KI9A 1Q1ZA 2CE2X 1T4GA 3TW4A 1AM4D 2E9SA 1J7KA 3AVWA 3VQTA 2FDCA 2IWRA 1Z0DA 4BPBA 3P4YA 2XITA 4Q21A 3KQNA 4LBWA 1QHGA 2ODNA 2X2FA 3PITA 2B7CA 3BB1A 4HSEA 4Q1DA 2EU8A 2PH1A 1AGRA 2OT3B 1TEVA 2FH5B 3GLGB 4EDHA 1NY6A 3U4QA 4Q1EA 4HB3A 4KITB 3CRQA 3P27A 5SZJA 4C0KA 1TUIA 1YZQA 3HR7A 5J47A 4TT3A 3W9YA 1G20E 4UQOA 3K0EA 3W3ZB 1LTQA 2GZAA 4Q1FA 3C4JA 4WA7A 1MO5A 2AXNA 3CUEF 5F9FA 2ZS9A 3A4LA 5BW8A 4UKDA 2Z4SA 4MRVA 2OFWA 3T1OA 2QT1A 4ZDWA 4Y0VA 4ACAA 4BFTA 4TWZA 1A1VA 1JXMA 4OI4A 2FEMA 2QQ0A 1GAJA 2QPAA 4GFDA 1KDTA 4X8HA 3HYTA 1DARA 1P6XA 4ZDKA 3THOA 1XFAA 4B3CA 1A82A 4L4UA 5GADl 1N6RA 1QG4A 2IT1A 4LV5B 5HCIA 1W48A 3IO3A 4PSAA 4A4DA 4Z8XA 1F2TA 1TMKA 4BFYA 1KO8A 2F43A 3GEHA 2Q6TA 1JNYA 1NLZA 3AKDA 4V0LA 1JR3A 2ZYWX 1D8TA 1WB9A 1KO4A 3CRVA 1PZNA 3FHCB 3BAFA 4US1R 3D7MA 2ZANA 4QNMA 4R98A 1GKUB 3F8TA 4C0HA 4Y0AA 1E9SA 4OQNA 1II9A 1YKSA 1ZUIA 3DMNA 4K81B 2OCBA 4MRRA 2QEQA 4FIDA 1IN4A 2F55A 2IBMA 1T0HB 3A1TA 4OQFA 4Q1BA 4X8MA 3FE2A 1W4CA 2ERXA 2HCJB 5HPYB 3PENA 3QF4A 2ZRAA 4AI6A 4GMXA 3WMGA 4IDQA 2NGRA 1S9DA 2VHUA 3PG5A 3ZVMA 4M53A 2WJGA 1XPRA 2A78A 3NWJA 1G7TA 3JZAA 2UVQA 3A1VA 4JL6A 4URZR 4B75A 2PJZA 4LOAA 3WNDA 2A5GA 2NO9A 4CRWB 1I4LD 1WF3A 2DCUA 2JDIA 1NMXA 1VDZA 2HYDA 1N6LA 4OHVA 4HAVA 8OHMA 4QHSA 3UMFA 4LDJA 3O8DA 5JZVA 4C0QC 1SVSA 5FPTA 4ZCLA 4BLPA 1E69A 1E0KA 1KJWA 1ZNYA 3RVBA 1Z29A 5CM8B 1TF5A 1XPOA 3NXSA 4W9MC 2ENZA 1HT2E 1YR8A 4G5QA 3WMFA 3D31A 3QXXA 5C4MA 4JJZA 3DDCA 1KGDA 4Q00A 4ZIRA 2BBTA 4QL3A 2IYRA 4AURA 4AK9A 5TMPA 4EPTA 2WSSD 2ORWA 2XSZA 4JLKA 3CRRA 5F2EA 1KI4A 2QP9X 4DLYA 5IT5A 2IHYA 2F1RA 2OILA 1H8HA 2PT7A 2QI9C 4W5JA 3VHLB 1MR3F 1HUQA 3HPRA 5CYPA 1OFHA 3QEOA 5CLLA 1OE0A 5FL3A 4M1MA 1WA5A 5FOXA 2F9LA 3B5JA 2J0UB 3GJ0A 4B3DA 2EFHB 2CDNA 4QXAA 4PC7A 4V0KA 1DAKA 4CEJA 2Z0MA 3ONWA 5AJYA 3AGQA 3A58B 4LHYA 4IOJA 2NO6A 4E07A 1OH7A 2WV9A 3VNUA 2OHFA 3EZ2A 3BERA 3RS2A 3O8RA 4ASUD 2P6UA 3KTAB 3RS5A 1SULA 1EFRD 3MSXA 4QFMA 4A92A 1NBME 3LAWA 5AJWA 1U0LA 5DNYB 1DG3A 2YNMA 2P6RA 1GNPA 4XH9B 5BQ5A 4BLOA 2C9CA 3THXB 1HURA 3QXSA 4C0BA 2A2ZA 4BFSA 2VSXA 3ASYA 4IRUB 1KK1A 2CHVA 4Z1MD 3OZXA 2CJWA 4MGKR 5FTMA 4YMVA 3ADBA 3BJIA 1MV5A 3A4NA 2X77A 1NN1A 4QKQA 3OFNA 4POAA 5SZHB 2QAGA 4OJQA 4DSNA 4XVUA 4DT1A 5FI0B 3GLIA 3OF5A 5JWOA 3DM9B 4O0MA 1LVGA 2ZR7A 2IWHA 3Q8XB 2IYVA 1E2JA 1OPXA 2ZSDA 4NYJQ 4OK5A 2OFXA 2G9NA 4FXPA 4CGZA 1P2UA 4LZZA 4B2LA 5TY0A 4A0RA 3DOFA 3LDAA 3LLUA 2V9PA 1YU9A 1QHHB 3VU9B 2RGBA 1XZQA 4MKIA 4EUNA 1CJVC 4OQXA 3AP1A 4BZXA 1XCMA 1G4UR 1CLUA 3PV0A 4JYBA 5IF9A 4X8OA 5FBRB 1KAOA 4C7OB 2D4HA 1TQ4A 1Z0AA 2DY1A 1T8UA 2C8VA 1E79A 3VKGA 5GJVC 4BASA 1GRRA 2IHBA 3PEWA 5AJXA 2XXAA 3KB2A 3KX2A 1BH2A 2QBYB 2CK3A 2VP5A 4G5RA 1E98A 3GLHA 4TMWA 1FP6A 3LO5A 1VG0B 2GESA 5FI1B 4AD8A 1TQ6A 3W3AA 4URVR 4NCNA 1ZUNB 4HLQB 4HAZA 1L8QA 4KLZA 1OXUA 2G0TA 5C18A 2FGJA 3KFVA 4WXPA 4EIWA 3KQUA 3RC8A 1NN3A 3QEJA 4OL0A 2IEZA 1IQPA 5BYKA 5CM9C 2Q3FA 3AVYA 3B78A 4BFUA 1W49A 3RRYA 3FTQA 2DFLA 2O8CA 3AUYA 4M4SA 2ENNA 2QAJA 1JAHA 1P2SA 2E87A 2QN6A 2AXPA 3N5CA 2WOOA 2RGNC 4QHTA 2PLFA 4BRWA 4TLEA 1DVRA 1F2UB 5K8TA 3U61B 4JL8A 4XSHA 1P75A 1VPLA 1XJ0A 1E2IA 2OBLA 1LS1A 3MAAC 5P21A 4JBYA 2WVJA 3WP1B 2XB2A 4JMPA 1E3MA 3MRSA 2RCNA 3K9HA 4OYHA 4TSFA 2QORA 5H70A 1OB5A 1G1MA 3SZRA 2FFQA 4A8JC 4PPFA 4FINA 4QJ5A 2Z5FA 3KY9A 2YJTD 2CVFA 3RLFA 4B6DA 4RZ3A 5G41A 1CRQA 4ZDJA 3FKSD 2IS1A 1ZVQA 1IXZA 4JLPA 3QQ5A 1R0XA 1YE8A 4BECA 5J4KA 1US8A 4BGDA 5JCPA 1E2KA 4AYXA 2Q3HA 2GZHA 1KAGA 4IDOA 1Q21A 2QTFA 1CR2A 1OKKA 2ZIAA 3EIEA 2G88A 1U94A 2ZETA 4HDOB 2VP9A 3HR8A 1COWA 2J41A 1XD8A 3FDIA 1TQ2A 1SVMA 2H7VA 4GOXA 2N1BA 4KODA 121PA 2BMJA 3Q85A 3REGA 3CPEA 1NG1A 3LLMA 3UKDA 5JEDA 3G0HA 2JJ1D 2ZI9A 2DR3A 1CP2A 2WJHA 3T06B 4PO8A 2D3WA 1QBKC 2HDNB 1RRFA 2W0SA 3F0TA 4NHOA 3MD0A 3N2IA 4TTRA 3FGNA 4I4LA 1N5JA 4KJZA 4NPHA 2AHOA 1ODFA 2MSEB 3AM1A 5HE8A 4EJSA 3T34A 5B2ZA 3HDTA 4ILEA 1W36B 4M1OA 3K9NA 3T35A 2ZE6A 3ADDA 4EPYA 2VYFA 1EGAA 1JEEA 3ZZ0A 5KSZA 4KFSA 2VHQA 2CEAA 1HE8B 2TMKA 5HR5A 3NKVA 2V55B 4XTCS 1NJGA 1I4DD 5AJZA 2JATA 3GLGA 3R20A 3NEYA 1U0HC 4HLUC 1F2TB 1XEXA 3FVQA 4NZYA 1XMSA 4A6XA 5FBQB 2IX3A 2ZUCA 4LWZA 1FTSA 2F43B 2BEJA 1DO0A 5CIWA 1WXQA 4JBXA 3O8BA 1Z28A 3M1IA 4LJAA 1LW7A 2O8FA 2G1KA 3WBJA 4MKGA 2RAPA 4LCBA 4P31A 3C41J 3PJRA 4JSTA 4EFNA 2GETA 2RHMA 1KTVA 1LY1A 4DHEA 1NVVQ 2BM0A 1FPMA 2F1IA 3ZLJA 4JLAA 1DPFA 5LB2A 1VG9B 3IIMA 1IJFA 3T1QA 3VR2A 3W8NA 3WYAA 3SJAA 2XOKD 2QGZA 2WKRA 1BMFD 3HU2A 3UXMA 1IXRC 4OHWA 2IEYA 2W6JA 4IEEA 4PO9A 2CCKA 2YWFA 3IHLA 4PHFA 3A6PC 2A5DA 1KSHA 1E94E 1G5PA 3W6NA 4WZAE 1VG8A 4D0GA 4DEXA 1M7HA 2IC5A 4UNPA 3NC0C 3BORA 1S2MA 4IXNA 4M0LA 3T5DA 1W0JD 3KFXA 2X2EA 2IS4A 2QRZA 4OJKA 3C5HA 3UGDA 4L15A 2YUUA 4A15A 1H8ED 1R10A 1U8YA 2R6FA 3B7GA 4TLDA 3X1DA 4B74A 4Q4HB 2OLKA 2IS6A 1NF3A 4RD3A 4MYHA 3IIJA 4YMTA 1YZUA 1DBSA 4V02A 2G1JA 4UNQA 4IJMA 2ZE8A 2ZITA 3HU3A 1BOFA 2KBFA 2BIFA 2V6JA 1N5KA 3L0PA 4TLBA 4DCTA 3SQXA 4CT4B 2WJJA 3BIFA 4Q7MB 2ZROA 4B48A 1HV8A 5JEEA 2NOAA 5FTLA 3QF7A 1ZM2A 3LBHA 4OHZA 3MFYA 4MGYR 2BKEA 4N0EA 4IOLA 4PZLA 1JB1A 2OESA 2IYTA 2QM8A 3R7WA 3D6TB 3Q7QA 1IY0A 1QHIA 4DSOA 5J4LA 2BOVA 1MO6A 2ZRJA 1YZLA 2VTKA 1F5NA 2GJKA 3WYGA 4HUTA 2R65A 2R9VA 2AD5A 3F3YA 5C46F 1RYFA 3IO5A 1ZU5A 3U44A 1DAFA 2Q9BA 3WMEA 3AV0B 1XTJA 1XTIA 3IBYA 4M8NE 3SQWA 2GTPA 3MJHA 1KOFA 4XVQA 4TYNA 2REBA 4K46A 1GSIA 1F60A 3MWLA 1RYHA 2P6NA 3EARA 4HYYA 5F3WB 4B3GA 2CJWB 1KHTA 3W34A 2ONJA 5BN4A 1X6VA 3GFOA 4S2EA 2O0HA 4XJXA 3TUJC 1E0AA 3AP2A 1ZM4A 2J0UA 4LJYA 5HZHA 3PEVA 3I5YA 2ZS8A 4HDQB 4Q1CA 3RABA 2HF8A 2D2EA 1OJLA 3CH5A 4DT1B 3GLIB 2IYLD 3EPKA 2O8DB 4MRNA 2B8WA 1T3LA 2GZDA 3EC2A 3FKQA 1G6HA 3BS4A 1UBEA 2QENA 4LBYA 1EFRA 2ZJYA 2FMXA 1DE0A 3I92A 2A5FA 3WRXC 4L9MA 5EJEA 5GJBA 4ITRC 4CIDA 2FG5A 5KNDA 5SZIA 4DDTA 1JI0A 3KL4A 2BMDA 4Z1MA 2CBZA 2QT0A 3EIQA 5CDFE 3IQWA 4P3YA 3OAAA 1L7VC 3H84A 4Q03A 3GPLA 4NONA 4TYQA 3ZH9B 1U99A 3ZDQA 4XWKA 2VP2A 3QKTA 1RKBA 1JAIA 2ZVQX 2WWGA 5BN5A 2WWHA 5KSPA 2XXAB 1NN5A 3TW8B 4YXWD 4TL8A 1FZQA 4DDWA 4PSVA 1RC8A 4FCTA 2FSFA 3TKLA 1FAQA 2QMUA 2QPTA 2RGAA 3C5CA 5AUQA 4B47A 5AUOB 2FA9A 2GF9A 3GLHB 3HYRA 1T5LA 1VECA 5EXXA 3CXLA 1PLKA 4FD2A 4HEJA 1OFIA 1BYUA 3QXCA 1Z63A 2JLWA 4NBSA 1ONBA 1ZC4A 2GJSA 4A2QA 4GOJA 2GK7A 2VRWA 2GCPA 1Q3TA 2YOFA 1NNEA 4Z8YA 4LJ6A 1OH8A 4A0HA 3B85A 2FWRA 3OIUA 1UKVY 5DSZA 4AKEA 4C7OA 1E1RA 1KSFX 2YOHA 5KNBA 5L3QA 3D3QA 1ZC3A 2G83A 4YMSA 4FI3C 2HLDA 3WRYC 2P0EA 3WNBA 3UWOA 1VCNA 1W0KD 3KXLA 3RDPA 4DLZA 2FU5C 4BUJA 1VCIA 4PX9A 1O3YA 4QBIA 5JSZA 1Q20A 3CWQA 5HE9A 4RKEA 1KIMA 3OIWA 3EWSA 3BFXA 4JLMA 4JZKA 1QDEA 2UKDA 2VA8A 1G3MA 2GJ8A 3SE0A 3B82A 3EZFA 3EZ9A 4D6PA 2VP0A 4TQ9A 3CNOA 4LPSA 1RZ3A 1UF9A 2C95A 2XEXA 2CL7X 1CF4A 4QOSA 1GUAA 4MDEA 4URYR 1WBDA 2ZE5A 1AQYA 4RSGA 1ZCBA 2K5UA 2W2VA 3BWDD 2LKCA 4TLCA 4G5GA 4PPGA 2CL6X 3FMFA 3VR4A 3KKOA 1Z0FA 1US8B 3PFIA 3BFVA 5FL7D 1W4AA 5JBQA 5K8UA 2ONKA 1T6NA 2HCBA 1R7RA 1P9NA 5DGXA 4BLRA 2DB6A 2ZRKA 2QRNA 1X1SA 3RHFA 1Z6TA 4ABYA 1KK0A 3RRNA 4ZI2A 2WWYA 2GEVA 1W7AA 1KSJA 4LPKA 1MRSA 4P32A 5KHOC 2OCYC 5JMTA 3K70C 2PJRA 4LYAA 2HF9A 3SYNA 1RRGA 4TMXA 1AS3A 1YZTA 4K8OA 2FOLA 2BHRA
chains in the Genus database with same CATH superfamily
1KZ7B 5HXAA 3MGBA 1L7RA 4FJ1A 4NE7A 4OVOA 2BUCA 2DWUA 2PBZA 3E59A 2G71A 4YDSA 4CL3A 3FVVA 1Z22A 4IY1A 1KERA 1KAMA 2W4QA 3B6MA 3BYZA 3L7OA 1BH6A 1R4MB 3KKNA 5BVGB 1XQ9A 1WDMA 2MINB 1KMNA 3KKPA 5JHWC 1C9JA 2UZ3A 2VWHA 4RORA 3AKYA 3VYUB 3F97A 4GXNA 3SYLA 1PG0A 5JW6A 2ZB3A 4B3BA 4C43A 1VM6A 2QS9A 4M1YA 4C3UA 2ZRBA 3L8YA 1U5BB 2BFFA 3T12A 1W88B 2WIAA 3DBRB 2NUPB 1QAOA 1RSZA 2DPYA 1TVKA 3GJ4A 1ORIA 2VDLB 1FUEA 1VLZA 3ITEA 3M6LA 4H15A 4J2OA 5HGJA 4BCBA 1XNJA 3C3KA 3GZJA 1QRSA 1Q50A 4ILKA 2Q5IA 2XA1A 3EMVA 3PD1A 2EWMA 4J03A 4O2AB 3I01A 3U3ZA 4ZEXA 1X13A 1YBAA 2P2SA 1AE1A 1XEXB 3JVVA 3HVHA 3R5JA 4QYIB 2GD2A 4RD0A 4ZT2A 5FA5A 4ZQCB 3D9QX 4YRCA 3U1BA 2QVGA 1X7HA 5G53C 1TVCA 2OYRA 2VJBA 2G08A 3NHZA 4Q9JA 4KXLA 2IVZA 1UBRS 3V4SA 3DTNA 2O8FB 1JEQA 1JT9A 1N4DA 4CM9A 5CBPA 3FD8A 3EIXA 3K5IA 8GPBA 5M5BA 4BXOA 1G16A 4QNNA 4DEYA 1EA5A 3P5SA 1Q7BA 2H7CA 5LU9A 2BV3A 3T9BA 2X5OA 2EKZA 1IN5A 3HQ4O 2Q5OA 5EZYA 1P5HA 3CZMA 1OTYA 1ZK4A 3LE8A 3X1ZA 1J0CA 4BLWA 3O8CA 2FF7A 3MS7A 2OGUA 5JBNA 1C3JA 1YQUA 3GAMA 3QH4A 4R0NA 5HZGA 1SG6A 3WK8A 3BRCA 2Q9UA 1ZRHA 1JHXA 2X5XA 4TRNA 3DWFA 1C2TA 2GKRI 5GP1A 4CTMA 4ZJZA 2HNBA 5J4HA 3R5TA 1K7UA 1PZXA 3CX6A 3Q6IA 5EIBD 4RZ2A 4OQ4A 5DLDA 4AG3A 1HKUA 3H16A 3K0CA 4G4JA 4LHZA 4PR3A 1TUSA 1LW6E 4C7MA 4YEDA 1E4EB 1QX4A 4GKJB 2ELIA 3LFHA 1R2QA 5K0EA 2ZIEA 3OX1A 2ATVA 2YV1A 4DSTA 5CLGA 5SY6A 2XWQA 3RYTC 4F3RA 5J40A 5G0VA 4CIXA 9WGAA 4GWLA 4AM8A 1JG6A 1YR6A 2I6UA 2NXWA 1AO0A 3AM3A 1EBUA 4M7OA 4A24A 2JCGA 3PKZA 4YRQA 3OZWA 4UOEA 3KSMA 4B1FA 4WADA 3HADA 1E5XA 2WFMA 2QN9A 2ZQ5A 3EPRA 4WFIA 1IOVA 2F64A 2WJZB 2Z8YA 4JDUA 4ZXPA 3TX2A 4D26A 4P3XA 3IP7A 2H0RA 1ETUA 4LQ4A 2Z3WA 4XYMA 4DCCA 1QE5A 2GFQA 5IU6A 1E2NA 1JECA 2ZVDA 3PUIA 5FA6A 3FJYA 5L95A 1W46A 4FGSA 4LISA 2DG2A 5A2QA 3RAFC 1GD1O 3K53A 1JHZA 2BFDA 3PZBA 4DR4B 2HRZA 4HWSA 5FOQA 5H1YA 1PNOA 2CDAA 1N0HA 2QX7A 3GVCA 4FMBB 5BYJA 1WTAA 2GZ3A 3GDGA 3R7WB 5F9HA 2Y9PB 1MC1A 3HCRA 4FYMA 5CJJA 1WL8A 1SOAA 3VOAA 5KJCA 2WCYA 5ENDA 3D8RA 2JIZA 2DOKA 2H16A 2YJ4A 2BKVA 4HUQA 4AX4A 1XNRB 1YULA 1XZHA 2DM6A 2IVFA 2YASA 3KQQA 4D98A 2QE7D 4E09A 3D6HA 3FBGA 5CAEA 2GCOB 3ZD6A 1OF1A 3GMTA 1MG5A 1X1RA 1XMPA 5BNFA 3VAAA 4KI0A 5K0CA 2IHNA 1S96A 1Y8RB 4BZQA 4BZWA 3D3EA 3QKSA 1NQAO 3DCYA 1LBIA 3IVXA 2WIGA 3SP1A 2H6EA 3C7KA 3EXIA 1SZCA 4C0XA 3EFHA 5G4LA 1MHTA 3V8EA 5C80A 2HMVA 5AJHA 3EVTA 3FUUA 1SK9A 3IQIX 5BN4B 1WHTB 4FS3A 3KUCA 3QPVA 1F8GA 1ZCAA 4M1SA 4C21A 1G5QA 2V5UA 2UZ1B 3IP9A 5C52B 3SBEA 4JR0A 3F6PA 4D6XA 1LPMA 1U7OA 2GI4A 2R47A 3B9PA 4J0EA 1URPA 4D74A 1RWPA 4MH0R 4BNYA 4CDMA 4U6QA 1T0JB 1R8SA 1WXWA 2P4SA 1FJGB 3I9NA 4RPHA 1A4RA 2V9ZA 2LWIA 2ODPA 2WMNB 3EOZA 3JYPA 3QEMB 1SBHA 2WI8A 4PBTA 3HUDA 4YP5A 3TRKA 4Z9FA 3GW8A 1W6RA 1D4AA 2OD1A 2ICAA 2YZ7A 3LY5A 5KVQA 2C3YA 3I4LA 1QUFA 2MSDB 1YGYA 2JK1A 4QM7A 1KY4A 4Q9KA 4KRGA 3JD3A 1AC5A 2XB6A 2C4KA 2PX3A 5C5EA 1SIWA 1XTZA 2GASA 4N7JA 4P33A 5FH9A 3N87A 2TMGA 1K06A 2CKMA 3H1BA 1RS0A 1G4HA 3QYAA 4EG7A 1E9AA 3OQOA 1WCXA 2OAEA 4ZU6X 6AT1A 2P9YA 1E2GA 5DM0A 1KZ6A 4P0TA 2G40A 4R3NA 5B57C 3P1JA 4BIIA 4P3KA 3LIIA 4BFVA 5AOBA 4F2GA 5CA0F 2XRZA 4KLNA 2FEWB 4HR7A 1XMVA 1ZW1A 2AX4A 3KC2A 4JC4A 4MW9A 5FWYB 1LLUA 2XUKA 1UXGA 3OHPA 5BN5B 4QJ3A 4C2TA 1Z2PX 5C1PA 1Z8NA 2VPQA 4GPBA 3NV7A 2UVPA 3GGOA 1Q9BA 4MB2A 4HFRA 2XVMA 4JYMA 4UASA 2O8DA 3I1FA 1SVLA 3CW2A 3L0IB 1Y3BE 3Q3JB 1GTMA 4RJ2A 1SCUA 3BXZA 4GRDA 1NQXA 1MNAA 5A6VA 3IUYA 3Q8KA 2CCGA 4E1RA 2Y0BA 2Y0DA 4N7BA 1DS3I 2DSNA 5SZKB 5I7SA 4FFWA 1ZSNA 3MWEA 5LOVB 1FLAA 2OCIA 3IIIA 4LNAA 1TAQA 3AEYA 1KRXA 1ILWA 2PIAA 1RI4A 1Q12A 3H87A 2WDPA 3HFRA 4YAFA 5IAJA 3VI3B 3G8YA 3KPUA 1U1CA 3B13B 3K6JA 2HMSA 4LJLA 1CJKC 4XQ0A 3WWOA 3M89A 4EO4A 4UAJA 4ZQFA 3PR1A 4OA5A 2ACVA 1ZIPA 3G9XA 2QMZA 4MAFA 5JS6A 3CWZA 1UZNA 4AZ3A 2WE7A 1CPYA 4B2PA 1I6MA 5MDHA 2JLAA 3E7DA 1SWWA 4TVKA 3OPXA 4E11A 6ABPA 5HF9A 1FS4A 3CVJA 4ZVTA 3G2JA 2G4LA 4BEWA 2Q0SA 3HJUA 4KQCA 2WHRA 4IIEA 4LJ5A 4O2BF 3ADKA 5B6PA 1B2RA 2FETA 2R5WA 2ZT5A 4UHBA 2A0XA 5HQJA 3D7NA 2VZLA 2GFIA 3FYCA 4LHXA 1E4VA 2C1EA 2YVQA 1JMKC 1OI2A 3FNBA 3GUCA 1THZA 1C0IA 1HWYA 3E58A 3G2OA 4MQ6A 1EUCA 4NV0A 2R6DA 3VTKA 3F6YA 3Q1KA 1YZVA 1Z83A 4X63A 1ZCJA 5K51A 4BX3A 2J3HA 4N01A 1IE3A 1G5HA 4KGXA 2KI5A 5L9AA 2QSUA 4NLLA 4E15A 4MWOA 2WMOB 3IVCA 4XIFA 4C0LA 4WERA 5IT4A 2W7TA 3HL4A 3MINA 3AL0C 1BE8A 3H13A 4JP3A 3TTXA 1XJCA 4H0CA 5SY4A 4U3JB 1QS0B 3RHZA 1XCGB 2ZKIA 1VP3A 3AIKA 3OX3A 3EZ7A 4HL6A 1L5KA 1NW6A 1JU4A 1UEXC 3GDOA 1CF9A 3KSRA 4GI2A 1Z2AA 4BEJA 3V2GA 2WJWA 1LC0A 4EY8A 1X7WA 1AK2A 3UUEA 1AKRA 3DOHA 3RRMA 4DV1B 3ZG6A 3QA3E 4KXNA 4LRTB 4MARA 3TLAA 2BEVB 3U7QB 2JCSA 4EJFA 4Q7JB 3RSGA 1YS1X 2KWIA 4HQFA 1O9BA 2AJDA 5AHOA 1HLDA 4DIFA 3LBAA 1TZMA 3A4TA 5DBGA 3UAYA 1M34B 2AFHA 5KBYA 1P9WA 3QM1A 2ZI3A 3QLVA 1B14A 5F51A 2W70A 2UXBB 4GH5A 2BGRA 4GUDA 3RQIA 4G3XA 3KLBA 3FHJA 5DGCA 5E7IA 3TE6A 4JJ7A 1PW5A 2WYVA 4M0UA 1VL6A 3CUVA 5CCMA 1SD1A 4U9UA 1GPJA 3DAYA 3U4DA 4IX1A 5JADA 3H0EA 4MIOA 2CHUA 3DKKA 5EJ4A 2PUFA 1SXHA 4PG4A 4ND2A 4WDRA 4ZU1X 1HQKA 4EARA 3J80A 1G60A 3D0OA 4PNHA 5DYYA 4LK2A 1HH4A 3U17A 5JHHB 2BRUA 1WR8A 5E2IA 3B48A 1MEOA 4KPFC 4EQ6B 1GZ6A 5C9ZA 1XEFA 3GJ6A 3GX1A 1KL7A 2AFRA 3JCZA 4IHJF 4L9WA 1MNQA 1SCBA 4H1HA 4EUEA 3KZ1E 5E1DA 4G5OA 5AWFC 3WLLA 1ZJJA 1AUXA 4XUDA 3MFQA 1K97A 2JGLA 2B30A 2Z2ZA 4D4KA 1NM5C 3ELDA 3SOPA 1EP2B 4P7BA 2B5VA 3ECCA 3SM9A 3BBPA 3F5FA 1TX4B 2UVOA 3NT5A 3LOUA 4II7A 4UVEA 5AM1A 1RQXA 4AYTA 3OE7D 1Z2OX 3WGKA 1FQJA 5JI3E 2FPPA 1J6UA 4N48A 3NW9A 3QYFA 3AFGA 5AUNB 3AJDA 3JASB 2VA9A 1C4XA 1W1UA 3ELBA 4PLCA 5TVKA 4NYIR 2C9DA 4U63A 4E22A 4DGSA 4BCCA 2C5HA 2J07A 1RPTA 3SVTA 3T1YB 4K9PA 4Q3LA 3GHHA 4P82A 2JIPA 2QM7A 3Q9NA 3U39A 5E3HA 4OP1A 1IN1A 5D84A 1L3IA 3I5XA 4N12A 1GZSA 5IK2A 4YREA 9MHTA 3IALA 1WP4A 3MWKA 1M2GA 4TS1A 5DLYA 4PANA 1YB2A 1W2HA 5AW1A 5CBPB 3UB2A 4EJ6A 1BMOA 1KMHB 2JGJA 2H0QA 5K8JB 2JZNA 1H5QA 4IKEA 1U2SA 3L41A 5AJVB 1K7FB 3P9CA 1ULNA 1YI1A 1D7AA 1FP2A 1UBKS 4OQDA 4OTZA 4HLNA 4B8WA 5K8IA 1H2RS 3ZV4A 4UPDA 3NKFA 4NMXB 4BQEA 1OLSA 3KDAA 4M9SA 4D4HA 3SFTA 3AU9A 1P5RA 5CDSA 1KDOA 3V3KA 3AYZB 3D2CA 4DADA 3LK6A 3G1TA 1AUVA 1VCHA 4IP0A 2PVCA 3GK3A 4ESVA 3H5TA 5KYYA 5J2UF 2G70A 2W4MA 1P1RA 2PXAA 4C07A 3KQVA 5DE3A 1FC0A 1SO8A 3K0HA 3N59A 1RT9A 3W05A 1NC3A 2QUZA 5AXBA 1SUSA 3UMGA 4B6GA 3AVVA 2Y1GA 4V3CA 5DB4A 3ZY2A 2XDQA 1UHAA 4W1PA 1PEAA 3M83A 3CRW1 2GPJA 1H3NA 3B6EA 2GA8A 2ZTLA 3DHVA 4IO0A 4KO4S 2H63A 3DMDA 1ZHFA 2ZYGA 4Q9NA 4GMHA 1IDN1 4XIGS 5CH5A 3PDHA 4A16A 1HFKA 1RMQA 4ESEA 2VYND 2PZGA 1I3CA 4CFSA 1JDTA 1QCYA 3KAPA 5EXEA 2AKAB 5KX5B 4MKRA 2ZRNA 1X7ZA 3HBAA 2PRKA 5A06A 3B89A 1DDOA 2CMFA 1Q16A 2GPBA 2JHPA 3DTYA 3QOXA 2RI0A 3DC7A 3B6ZA 4D9KA 4CLOA 1I14A 3CUWA 2BFDB 3LTNC 3HB5X 1V4BA 1AZTA 2Q4DA 5ILQA 2M6KA 1G6OA 3EYWA 3HYCA 4FYWA 2AK3A 4FOPA 4FOTA 2EW1A 2FHPA 2JEOA 4EKYA 5CD1A 4P4SA 1CR6A 2W6ID 4R2WA 3WQRA 2W8BA 4RMHA 4L0MA 3PNQA 2NTVA 4I9NA 2WTXA 4KNVA 5DYNA 4EVRA 4CMBA 4HDCA 2DF8A 4R1TA 4QWWA 4HUQB 2OXTA 3AFOA 3TJMA 1EVYA 5CCLA 3I01M 2Z58A 1UMCA 4NJEA 2CMGA 4JZYA 2GN2A 5EKDA 5KC9A 3S6JA 1PDWA 5CAEB 1G8KA 4EYGA 2HT1A 5FI5A 1BKDR 2O8EB 2VZ0A 1OW3B 1JTFA 4ITUA 3D8UA 1Y0BA 4B3FX 4PZ9A 3ZJVA 3IDFA 4CMAA 5CFQA 1NLFA 3IXQA 3QKSB 1CJTC 2WEKA 3BL6A 4LA4A 3ZTYA 4LF4B 4XDYA 4CU5A 4KVFA 1IQRA 1D6NA 4FR5A 5BR1A 3EXIB 5HYVA 2C2OA 3CLUC 3RRZA 4YRNA 5BYAA 1M10A 4M8KA 4JWTA 5IRCD 4JYZA 3QBJA 3IMCA 3A6HA 2HKIA 3MMZA 3NHBA 2YWCA 3B6JA 4G8JA 3UB3A 2YV3A 2EJCA 2QMEA 1WUJS 1G17A 2W98A 3MT0A 3R9KA 2OECA 4EY4A 4GRAA 2WAAA 4LJ4A 2ORIA 5LQDA 2VS1A 2DKVA 1OYYA 1TC2A 3P9KA 4N3BA 3FHOA 1DKOA 2G9ZA 4HZUB 2ANCA 4CR6A 2FR1A 2V53A 4ZVMA 1KDRA 2WU0A 4WZAA 3ZHYA 5CCBA 1UWKA 1G19A 5CCXA 1GYPA 3W06A 4DLUA 4K28A 1KYTA 2XSZD 4WRRA 1I3LA 1XZGA 4KIFA 4X90A 1GLVA 3MJSA 2QY9A 3MLEA 1PK9A 3PB3A 2I2WA 5FUVA 2BMAA 4FWIB 3BD9A 1J49A 2Z8ZA 2FEOA 5FOXA 4WZ6A 3INTA 2IK8A 4AO7A 2CNLA 4ZHQB 4FKDA 1IXSB 1EX7A 4L8LA 1PR9A 3PUZA 3AFNA 4XASA 4CM3A 1EWTA 1QYWA 2ZB8A 4RKQA 4HY3A 3DUFA 2IV3A 4UW9A 4CI9A 3EB9A 1ZXLA 2Z83A 4MQLA 4RL4A 3V46A 4TVSA 1YV9A 3B3FA 1DI0A 1BWRA 3AV3A 3KQMA 4O1MA 2OCAA 7AT1A 5ANRB 1M2OB 3RASA 3CVVA 3LBIA 3NT2A 4U4AA 1O4WA 2UVPB 1Y3CE 3A4IA 4YJHA 3DOCA 1MX5A 1YRWA 1U1IA 2PEZA 3IOMA 3ZZTA 3WRWA 1Q19A 1LI4A 1K0UA 3A9WA 3QFSA 1E92A 4F5YA 4URXR 3SDSA 3TXXA 5KSYA 2IS2A 4YRJA 1P4HA 1E7SA 1YD7A 2HSZA 2WTEA 3IC5A 5K3FB 4EW6A 1JFSA 3MWEB 1SA0A 2QTMA 4R8VA 4E7OA 2QQEA 3DO6A 4MYTA 5JO0A 1K5DA 4Y2SA 2WVGA 1Y33E 4HLDA 4F5WA 5HRUA 2SGEI 3DR3A 3O3NB 4DCVA 4KN8A 3R7NA 1HQYE 3FJ1A 4HD8A 4RYDA 2YUIA 3OFND 3PQ5A 1O08A 2GD6A 3K31A 3KUUA 3FUWA 3PIIA 4LYGA 3AF3A 2HAEA 2WHQA 3D8NA 4OO3A 3ZC3A 1U7XA 5A5EA 1FRZA 1W34A 5HKLA 5PNTA 1QGAA 2Z4TA 3G8AA 3I12A 3Q15C 5T67A 4B73A 4CMEA 4DPMA 5A0FA 3KOWA 5EIEA 2J7PA 4YP9A 2P4HX 4LE1A 4HNQA 1PZEA 3HN2A 3EBOA 4FYVA 4HB2A 4BNZA 4QRHA 4GI7A 1KZYC 1XA3A 1OH5A 1E0SA 2OGSA 3PR2B 2A59A 4R2JA 4YLEA 2IHJA 2J0EA 2NO7A 4H3SA 1PJ8A 5D5HA 5EQJB 3VR3D 4GS5A 5EMLA 4CF5A 3L0BA 1HTWA 2JFHA 3N2ZB 5EHNA 3JR7A 1Z47A 3R8XA 3WAKA 4M38A 3H9EO 3TAUA 4JUFA 1ZEJA 3CJQA 2C99A 4XYEA 1D2CA 1PUXA 2YN4A 1ADJA 1E2LA 1MJ9A 1JG7A 1TNDA 3M6VA 4WH0A 1GXSA 2WQ6A 2NXNA 2FRXA 4M1KA 1YDHA 3OOYA 4LXHA 2IU4A 4R6WA 3T6KA 3WLPA 1JBKA 3W9UA 4UATA 4ZYWA 3BX1A 4YDQA 3I4FA 4J0KA 4BB5A 2RGXA 5KVAA 4EABA 2D06A 1DBPA 3UHJA 3MINB 2NZUG 3LOPA 4D5GA 1QPBA 3RU0A 1T5SA 1PI3A 4U2EA 1TEZA 2CK3D 1PNQA 2RJOA 4EELA 2HK6A 3V8MA 4B46A 5IANA 3BMNB 5TDHA 4D02A 5JAPA 1SKUA 3KM0A 1Y89A 3CT4A 5LQSA 2ZJ1A 3FFAA 5CDFA 3C45A 5KNDH 1DWPA 2QW1A 1C3OB 3MTAA 4KV9A 4XDGA 3ZCXA 2IYXA 1RDFA 1GO2A 2BGGA 1C7ZA 1NVAA 3F74A 4KACA 4NBNA 4US0R 4WOPA 1CTQA 1B0UA 2XA2A 4G5HA 2HB6A 4RYLA 5ALZA 2GBCA 1CHDA 1UIMA 4KN9S 4ODIA 4YCDA 5LCXA 5BP7A 1KE2A 1CEQA 2QY6A 3BVPA 2CZGA 3BGSA 1CT4I 4OP2A 1AXEA 4CETA 2Q2WA 4YASA 3PNOA 2MU1A 3EK2A 4NF2A 3TW0A 2BGWA 2BTEA 4LRQA 4MVJH 4E46A 1N9ZA 3W2EA 2DX7A 1N34B 2NU9A 1JHQA 3LVBA 3MWDA 5DNUA 5AVWA 1QM5A 2FPOA 4JLNA 2GEKA 2XUHA 4LFAB 1PQUA 4RJLA 1J5EB 2IXFA 3GHYA 2ARKA 3OT4A 4YS6A 3FYUB 2HLPA 3IKVA 1IZ9A 1M2EA 2Y1DA 1NLYA 2YJNA 4GC9A 4KSCA 1QTRA 1Y1KE 3KQKA 4YJGA 1KMMA 1WQ4A 2D0IA 3I45A 3PJGA 4MQMA 3SMQA 4ZDIA 3EDMA 4UBJA 3INGA 4KQGA 5L4NA 3OU7A 2RE8A 2K4MA 2ZVJA 3OCUA 4PAWA 2R7KA 4LBVA 3HK2A 3KIPA 1ZI6A 3LGXA 4IIXA 5F98A 4QDKA 4QOGA 2WT8A 1F4PA 1ORRA 1OLOA 2Z3ZA 3AW9A 2FPPB 3BHNA 3S1AA 1BO6A 4NS4A 4PLPA 2ODQA 3F3KA 4I8XA 1IYZA 1LUAA 1QQTA 2JJ2A 3GT7A 4QUBA 2HJWA 5A6SA 1Y3AA 1E9VA 4U7PB 2JH8A 3UFFA 3ZX4A 4K6HA 3K09A 1YAHA 5AOAA 1EDZA 3SVLA 4QE3A 1E7YA 2F7SA 1Z74A 1C1HA 3NOXA 2ODEA 2NU1I 2WWXA 4E5UA 4KXFB 1NBIA 4EZIA 3X1XA 3KKQA 1JEAA 2ST1A 2WP8J 1E1YA 4HXFB 1G0NA 2AGVA 3TIFA 1UZUA 1ZLYA 1HT3A 1E1QA 1JUDA 3AR7A 3HJAA 3LZDA 2BMVA 2ZI4A 5GAJA 1WXHA 1W5BA 1M2VA 1CGJI 1EWRA 3HEAA 3I6MA 3C1AA 3OEHD 3PNVA 3AG5A 4YGYA 1GVNB 1VLVA 4V2UA 2XUGA 4WNIA 4MUJA 3GJ8A 3FPSA 3K5PA 2G6BA 2JFQA 4RLHA 3CR7A 3EQ7A 4SGBI 4GR4A 5LN1A 3TF5A 3IBSA 4NAHA 5I7FA 3CZCA 4I1OA 1R0SA 4IXWA 1WZNA 1T5OA 1UBGA 2GPAA 2ZJZA 2NM0A 4RY2A 1IPEA 4KBYA 3OLQA 2VYVA 5DN9A 4F38A 1RACA 2OEPA 4QDTA 4YBRA 1FSFA 5KYYB 3LHDA 3TOBA 1C1DA 1RQLA 3KXPA 1ZJZA 1O2DA 1MC8A 2MMCA 1GZDA 3KTDA 1JGTA 1XTBA 5H3CA 3BFJA 2IYWA 2P6AC 3FFWA 4B76A 3Q7IA 2VG8A 1F20A 4ZCSA 2P8SA 1XAHA 2DBRA 2VUIB 5J9FA 2WD7A 3D8BA 1VA5A 2XNJA 1Y82A 2WUWE 4QA9A 4MJXA 3OU2A 3E8MA 4Q6BA 2J5XA 5AK3A 3ZDDA 3GRZA 5KTOA 2AIRA 4MP6A 5TR9A 3RS0A 4CR7A 3K8YA 2FXVA 3TOAA 3N8GA 2OZPA 3PWZA 5JSQA 5GONF 1DJQA 5T41A 4EM6A 2OCPA 4CV0A 1Z73A 3AZOA 2BFOA 4C1NA 1RXYA 1DPGA 4NBWA 1X0VA 1MH1A 1OY1A 3TIIA 2QIPA 4G1EB 2GVDC 5IJ0A 2PR2A 5G1OA 2V45A 3TXYA 3HJNA 1I0LA 3CR8A 5KDLA 3WGNA 4R9UC 1NLMA 1QZXA 2CHQA 2PWAA 1G5RA 2VJAA 2JVJA 3QYPA 1USKA 2QTHA 1IHYA 4QJBA 5UKDA 3VZSA 3ZI7A 4DF3A 2NNWB 3DLIA 2HA0A 3DH0A 1IN6A 5F7ZA 4WLOA 1EK1A 2ZJBA 1TC1A 2W8BB 2JCBA 2ZUVA 3MILA 1JF8A 5EZ5A 4BO4A 4IMRA 5BWCA 1XF1A 1BA3A 3D4IA 4MLPA 1BAPA 2R8RA 3KU1A 3CINA 1V8PA 3F7MA 2GVNA 5ELLA 1MH9A 4D8XA 4Z53A 3VR2D 3PX3A 3WBKA 3CLSC 3GIDA 1M8JA 1N9GB 3C3DA 4F46A 3FY4A 1OA0A 4LSGA 4F8JA 1FNMA 1BMFA 1NJ8A 3IXLA 3OCJA 3D2LA 2PLAA 1AV6A 4PNPA 3GJ3A 1NXUA 4N8EA 2AL7A 1T4MA 2W6JD 4GD3Q 2IA5A 3MELA 1AHHA 4MVJF 1EGQA 2J9RA 1XG5A 4YB8A 1RYEA 2NU6B 2O8VA 2NYUA 2CUZA 2EC5A 2JGNA 3GQBA 4HYTA 4MROA 4RY0A 5AI6A 1E2HA 4F12A 1FDWA 1E5TA 1FTNA 2SICE 3W2TA 4DCOA 1W0JA 4XM1A 5JNWA 3PGMA 1N57A 1L3CA 4CKBB 5JDIC 1WXDA 5DYIA 5EPUA 4CQJA 3OHSX 5TMEA 3R5AA 2FOIA 1A1SA 5J2TB 5KJFA 4AKGA 3DPIA 4GM0A 4NNOA 1Z8HA 1EVZA 4PO1A 4PWZA 4D2IA 3AHHA 2W93A 3D7LA 4RQAA 2DUMA 4OFXA 1PJQA 3OJLA 1IEXA 3IBGA 3OJEA 4MWBA 5K0TA 3E2MA 2HSGA 2QRVA 4WKGA 4F93B 1G5TA 1GTJ1 4IPTA 4DJDC 1NQOA 3Q6MA 2W42A 1DIBA 1FUUA 1HLPA 4WZAB 3P0HA 1AA9A 2HCTA 1GRCA 3O82A 3M8KA 2I03A 4ZOLF 3PXGA 4PN3A 1W47A 1GPDG 4RFSA 1Z36A 3WLQA 1QRTA 2N47A 2XT6A 4CQLA 1Y3HA 1F9AA 2F17A 2HU2A 2XTMA 1RJDA 1CY1A 4JJ4A 2IIVA 4MS3A 2BM9A 1Z16A 1SXJA 2AG1A 3A1WA 4MEJA 4QAQA 4XE5A 3B3GA 6NULA 4LI0A 4GXTA 3GBSA 1VKJA 2NQ8A 2ZRFA 3DUFB 3HJTA 5KPJA 4KGZA 1IJBA 3CQ9A 1Y8AA 5JC1A 3TL2A 5JYCA 3VNBA 5A3JA 1CR0A 2NG1A 1H3EA 3DAHA 4O25A 4UNSA 4WCVA 5NLLA 1U3UA 1XJQA 3I8SA 3N86A 1SGEI 3DYBA 5B64A 3CV3A 3GLIE 2RHLA 3DA8A 2AE1A 2ECOA 2WABA 2BD0A 1H2EA 2J9GA 3PU6A 2AC7A 1MEEA 2WF5A 3K1YA 3EGXA 3SIRA 2J0VA 2LCFA 3UWPA 2VAMA 4PLHA 3Q7TA 2H1OA 1SCNE 3LQKA 3NRCA 2JLZA 1CJMA 3KZVA 3T7JA 1EFCA 2ZCUA 3L4EA 1ZM3A 2V98A 5K3BA 3DOEA 3QE3A 3EODA 1PVVA 3I9MA 1P3DA 3SHQA 1TDJA 1N2EA 2I1QA 2OXCA 2Z95A 4GPTA 5H68A 1DQZA 1UXKA 2VRCA 4NFLA 3ZGYA 9ABPA 5LQMA 4KR0A 4RIEA 4B3SB 4IICA 1QO0D 3GMSA 3C4QA 4WJZA 2ZT7A 1ADYA 3H8SA 3UMJA 3KD2A 3PNBA 3UC5A 4YRSA 1C14A 5CB4B 2Y1OA 1QPZA 4NICA 4QOEA 1SUEA 5FJJA 2WMYA 3MJEA 3VZCA 3FYDA 4RMNA 3GEGA 2VHZA 5U4XA 2JD1A 5KO2A 3BJMA 1MTZA 5M04A 5KNDD 2MR6A 3GLHE 4JVMA 2OYSA 3E0XA 2PEYA 4YWJA 1MLDA 5IYZF 2X5NA 1PJAA 2JZOA 1W0CA 4FKBA 4RCZA 4EOGA 1OH6A 4IEFB 3OAAD 4IV5A 4MQ5A 1J8QA 1PKXA 1OFUX 5LQNA 1E9RA 4Y9SA 5H9WA 2C9YA 4YACA 2C2YA 1A7JA 1U1DA 2MSCB 3HXKA 1XD2A 3KPVA 3PFWO 3IAFA 5BV8A 5IHXA 1DT5A 1IM2A 2XMQA 2ASEA 3G0OA 2GKGA 5CFNA 3Q40A 2QTGA 4EMSA 3EG9A 1N3YA 1ZI8A 4O3MA 4P53A 4G0VA 2XX3A 3ZD9A 1SR8A 4JVOA 4HGZA 4QTTB 3JWHA 2B0UC 4MVJD 4KE8A 2CLEB 1PTRA 4I1IA 4O63O 4ZK2A 2ZAYA 4IFBA 2Y0PA 1WMBA 3OIYA 4BNMA 3FHTA 3F8WA 3BGWA 2RHWA 1E7RA 4D9JA 3U6BA 5EKXA 3GOHA 1KF0A 2GEUA 3OT1A 3H9JA 3PRJA 1X1AA 1GGKA 1YJCA 3M9LA 2CB0A 3T99A 1L6RA 1KJYA 3BMQB 2FKNA 2CHEA 2HMAA 3KQSA 5EJIA 4ZVUA 1WCIB 2XKAA 1ODCA 3PA8A 4RV9A 4F4DA 2AN9A 2NVUA 4LDQA 3TZKA 2IITA 3Q3GE 2QX8A 3U16A 1PUJA 5IBPA 3D8SA 5K1ZA 1QWOA 1VB5A 4KXUA 5FBLB 3ZTWA 3BCSA 4YIHA 3L84A 2PKRA 1CB0A 3NC4A 4KMMA 5U1PA 2X8LA 1E1KA 1TFUA 2ZIVB 4PLZA 3GRRA 3WLMA 1JQJC 2EGHA 1P31A 5E95A 2AW5A 3HE3A 1X3LA 3CGWA 4C06A 1E3JA 5BR8B 3MZ0A 1OWPA 3T9CA 2YWJA 1XEWY 1WEKA 1WDKA 3MWDB 1W0KA 3CN7A 3N2NA 4QXQA 2E37A 3S27A 5J4YA 5KTRA 4FONA 1V0JA 4HJXA 1P0CA 1PJSA 1YBVA 2F8MA 3MC1A 4HYEA 1V11A 4O4HA 3QX9A 1PR0A 2VXCA 3L6BA 4YT5A 5C8ZA 2R6R1 2VQSA 3HDHA 3STYA 2J67A 1YWGO 2O7RA 2I2DA 3ZK7A 1GN9A 4H9GA 2ZB7A 3JSXA 3KVYA 2ZIZA 2O2HA 5CVEA 3AINA 5F4ZA 4OI1A 4Y2TA 2I4IA 5LBUA 4D8YA 3FIJA 1BS1A 1PLJA 5DHFA 1JSZA 4H2DA 1OVGA 4LOIA 3TS1A 4MP3A 3CS3A 4DDVA 3OQNA 4ETWA 1LFDB 2E5RA 1JNXX 4ID3A 5B3JA 5JCZA 3VPXA 4W5OA 1MIOA 4WMLA 3D5QA 1T8PA 1XF9A 4CM1A 2IH2A 3USCS 4WFQA 2QL9A 2VPWA 4QC2A 2Q1WA 3LK7A 4Y18A 1W35A 5A6SB 1G8AA 1ZIXA 3N76A 1QH1A 4A5SA 4BKRA 1T8YA 4OLFA 4Q9LA 3IAS6 4JU9A 5FOVA 4DA9A 3V1MA 3U4GA 2DERA 1F7UA 1QX3A 3L77A 4LSMA 3TEJA 1ATIA 2FLWA 1V1RA 1N7JA 1T0PA 2C8LA 4WD3A 1ESZA 3S1LA 1AUQA 1GGVA 3S70A 2GIVA 3CO5A 3X44A 5AVQA 4G0WA 2PXCA 4B6OA 3QG5A 3VR5A 2JRCA 3G5MA 4WXHA 2RH9B 3TCXB 2FP3A 1M2VB 4KXWA 4ZYTA 5K3EA 3TVTA 4C3ZA 1CCWA 4WY8A 2Y1EA 2YJGA 3QEBZ 2RARA 1C1XA 4B4KA 5HTOA 5GWXA 4NULA 4DG8A 3DZBA 3M81A 1Z15A 1G55A 1YK0A 2OV8A 1NZJA 4LJ7A 3UG7A 4QM6A 5ITZA 2X4GA 1UDBA 1JG2A 1V7CA 1QIIA 1IB0A 2OORC 1U2PA 2YXBA 1SZPA 4I4NA 3ZCVA 3K7EA 3OZSA 3RVDA 3JQBA 4A2CA 4FN4A 1SGRI 3ESQA 4TVOA 2PMDA 3T0GA 2HIMA 3ID6C 1X7YA 1YBHA 1EFHA 3TWOA 1K89A 3REFA 1I4EB 1C1DB 2P9HA 5CTJA 4Q93A 2Q8QA 2H4XA 2SCUB 3NCTA 2D6FA 1O94D 4YI5A 2ATCA 2DHQA 1L5SA 2PHZA 2DWPA 3DHEA 1Y6JA 2GMWA 4OAPA 4I5EA 2JW5A 3VR0A 5K05A 3HL0A 2D7JA 2VPPA 1VG1A 3E3AA 3OTWA 4JJFA 4ZI3A 3TQCA 4QARA 1RRMA 2DFDA 2UYQA 4XFJA 2I4RA 5C1IA 1VL0A 4TQGA 3QWBA 4X7BA 5L3RA 4JI4B 3WADA 1V5EA 1Y5LA 4ZFNA 1AUOA 3KEOA 5ALGA 4W5TA 2FW9A 3C39A 4BB6A 4CG2A 3JU3A 1EZ1A 5ALJA 3P8ZA 4Q18A 4WOJA 1YQEA 1BWPA 4NYJR 3UT5A 2Q9AA 3S2SA 2AT1A 4AVYA 3MXTA 3D6FA 5ARDA 5SICE 4XQ9A 4YTEA 3VZRA 1KH2A 3HXPA 5TPZA 1BU5A 2DFTA 4FNOA 1R9GA 3L49A 5KAPA 2B7BA 1G8SA 3ROMA 1MX3A 2YHAA 4A2WA 2XA9A 1QGYA 4IFEA 4W5RA 4XD2A 5AKKA 1NUUA 3M1LA 4ID9A 2IZ0A 4B45A 1AJEA 5E4FA 2XKJE 1GPAA 3DO5A 4P0PB 1UCFA 4BMDA 2G77B 1S4QA 2JXDA 3E1KA 4UUQA 5E3JA 5FJIA 4MKXA 4YMWA 1KY5A 2PWZA 5AW8A 4PSDA 4UAVA 1JLKA 4KMRA 3TRIA 4IQ8A 2CWHA 1M1NA 3JQ6A 1Y7TA 5FPHA 1P1CA 2OVOA 1YMUA 4X1KA 1SKQA 4P80A 2JFYA 5BW4A 3ADCA 1KFEB 3CE9A 4QTUB 4BE4A 1HR0B 3ZY5A 5A3RA 5A9SB 1Y5NA 1FP1D 1UBLS 3T7CA 4JEHA 3W6UA 4JHXA 5DN6D 1LEHA 1C3VA 1JVBA 4Y3UA 4F97A 3SEAA 2V6BA 2C04A 2IEDA 1DQYA 3OOSA 3GJSA 3ZCSA 2HU5A 2PS1A 1W4LA 1WDTA 3B3AA 4GVXA 4Z9AA 3RU3A 5IX8A 2ZDHA 1ZESA 3PWSA 2B0JA 2FRVA 3K70B 2PFGA 1T5BA 3FCSB 4ZA2A 3TOVA 3WS7A 3GJ5A 1OXKB 4WLFA 2W90A 1AXRA 4J6FA 4L8WB 3LG2A 1TAGA 2HD4A 2I1VB 1UPUA 2QRVB 4RKYA 4ROTA 1D4OA 2C2MA 3SOZA 2X42A 5I01A 2PA0A 1V1MA 3DE2X 4Y7DA 2Z57A 1PJBA 4I1YA 2ORYA 1LR8A 4YUXA 2PVPA 3IDAA 4DNCA 1SK8A 2HXSA 4OEHA 4RFSB 3V8BA 1Z7GA 4D0RA 3O74A 4PAOA 4CQLB 3SN6A 4W5WA 4CQNA 3JQAB 5HK8A 3EIUA 4IG4A 2W22A 1L1QA