2UZ3A

Crystal structure of thymidine kinase with dttp from u. urealyticum
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
207
structure length
190
Chain Sequence
b'IGWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKISVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIKFFKNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structures of Thymidine Kinase 1 of Human and Mycoplasmic Origin
pubmed doi rcsb
source organism Ureaplasma urealyticum
molecule tags Transferase
total genus 51
structure length 190
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2uz3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2uz3A01
4JLDA 2O8DA 3U6KA 5H70A 4JYBA 1GL7A 4IVPA 1H8HD 2P0EA 4US2R 2B7BA 3CPHA 2BWJA 4W9MC 4A8JC 2J0UB 3HU1A 3ADDA 1KZ7B 3D8BA 1G64A 2YC2C 1AGRA 1SHKA 2XTMA 3B5JA 3PENA 2FG5A 3NC0C 1V5WA 4ERNA 4MYUA 2QPOA 2C78A 2JLQA 5JJKA 2HUPA 1WBDA 1XD9A 5CIWA 3IBYA 4X8HA 4F38A 3U44A 2CCGA 3UGLA 2MSCB 4R2HA 1U0HC 4QM7A 1OB5A 1KMHA 3B9QA 1E4YA 1E9BA 1KJWA 3B1YA 3LXRA 3ZD7A 3IBGA 3MRSA 3P32A 4C0KA 2OFXA 1ZIPA 2WPDD 2AK3A 4BFWA 1F5NA 4CT5A 4DT1A 1OH7A 1GSIA 4KODA 5CB6A 3RS0A 2C04A 2GA8A 1NN0A 4KLZA 5JI3E 3CONA 1CR0A 3I8XA 2A3RA 3AUYA 1IBRA 4L16A 2PX0A 2VTKA 2OLJA 1XTKA 1XEWY 3PQCA 5TMPA 3VHXA 1IJEA 4PHGA 3QY0A 2Z6VA 5DI3A 2FSFA 3HU2A 3MWLA 2FSHA 2F43B 2UVQA 2ZETA 4O0MA 3RS2A 5AUNB 1JI0A 1YRAA 4V0NA 3LWNA 3QKSB 5AWFC 3DMDA 2VRWB 1XF9A 3LO5A 3CH5A 2WJVA 4KITB 2QE7A 3HDTA 4I1OA 1RRFA 1II8A 3K0CC 1NVUQ 2CHVA 2CEAA 1CIPA 1BKDR 4KU4A 5F98A 1NN3A 4A0RA 1UDXA 4TMKA 3NBFA 4P4UA 2J59A 2ZYTX 1Z63A 4OQLA 4ITRC 4Q9HA 3ZIAA 1GRQA 2XNDA 3P20A 1G4UR 4M2LA 4PZYA 2YOHA 4Q9KA 4BRWA 4PSVA 2QP3A 2ZPTX 2KI5A 1TX4B 5HKKA 4Q01A 1CRQA 1ZUNB 3EPLA 1U8AA 1WB9A 3DOFA 5KNDA 3EASA 2Q9AA 1GDDA 1CBUA 3ZZUA 3AUXA 3QBTA 2OLKA 4D4KA 1FL9A 3Q5DA 1CJTC 1HA3A 4EQ6B 1VG8A 1E2JA 3T15A 3CPEA 4LC1A 4JLVA 2HT1A 3M1IA 2X8AA 2ZR9A 1ZCBA 2QI9C 1UKZA 1R0ZA 1G19A 821PA 4HUTA 5J5CA 4LV5B 3QF4A 3U61B 1XTJA 4F7WA 1Z22A 2WJGA 4JVSB 4A0GA 2BBWA 3LVRE 4YMUA 1RE0A 4S2EA 4B47A 3PJRA 4U5XA 2PLFA 1RJ9A 1TL7C 1IONA 2JASA 4CEIA 3KXKA 5BWMA 2WAYA 1OFHA 2XSZA 1XXHE 2ZSAA 2DWOA 1BO6A 2JLYA 2DWQA 1YR9A 2PMKA 4LJYA 5HZKA 1G3QA 1DAHA 3RS7A 3K1JA 2DPXA 2IUUA 1NVXQ 3I92A 3ASYA 3P1JA 5CDFA 4NYIQ 1VIYA 1MO4A 4QXAA 2ZJOA 1P72A 1R5BA 4DWJA 1KI6B 3CB4A 1VIAA 3W6PA 2REBA 4OK5A 3RSOA 1G8YA 3TLXA 4AD8A 2O0HA 4TL7A 1TEVA 2CHQA 5H68A 4NYIR 2WJJA 4NKRA 1UKYA 1T8TA 4LYHA 3TQFA 3OIWA 1E2KA 1TBOA 3EPJA 1NLZA 3NG1A 1R0XA 3FPAA 4DLVA 2WV9A 2D74A 2BJWA 4L8GA 1BIFA 1P6XA 3R8FA 1TF2A 4HSEA 1S0UA 2N1BA 3AF0A 3THYA 4Q7LA 1NSTA 4PSKA 4WIAA 3AVTA 1J8YF 2F9LA 5HZHA 3NH9A 3K0EA 2V4ZA 2QE7D 1FAQA 4DCTA 3RLFA 1CJUC 1EFRA 2ZSDA 4FMDB 2P65A 1V43A 1KDPA 2D4HA 3VTKA 3W5IA 1Z06A 1CXZA 4KFTA 2XZLA 2KBFA 4YC7A 1XP8A 1XTIA 2WWHA 3ZIAD 3QNUA 2R65A 2XNDD 4MGZR 1XJQA 3UWOA 2GVDC 3OFNA 4OYHA 4KJZA 1TQDA 1S1MA 2G83A 2WWYA 2GJ9A 5HKKD 1DAMA 2GBLC 2OAQ1 4CT4B 3AF3A 1E2GA 4B3XA 4WZAE 5CITA 2XXAB 2O8FA 2W2VA 1W2HA 3CRRA 3SDZA 4FD2A 2AN9A 3QPVA 2QEQA 1KBEA 5FFMA 3A6PC 5KTYA 5FUYA 2G0TA 3UK6A 1EG7A 2ZEJA 2ZJBA 4P4TA 3GJ6A 4HUQB 1ZC3A 3T1VA 3VAAA 1N5JA 1WCV1 1G8FA 1G8HA 4BECA 3RVBA 3R20A 4Q9JA 2PZGA 3DL0A 5JS7A 2CCJA 1D2MA 3BFKA 5DH9A 4A2WA 4I4LA 5BN4A 4PFSA 2IF2A 3KX2A 1FFHA 3Q5EA 3E2IA 3UANA 1N2CE 5TY0A 2XSZD 1JJVA 2XB2A 1RYHA 1U81A 4LBYA 3GLIB 2R44A 3GJ3A 3TK1A 5EP1A 1Z0FA 2IK8A 2FH5B 3KKPA 3KFVA 2J1LA 4XVQA 4E5UA 3WP1B 3WBKA 2RGGA 2ZRLA 4ESHA 1LVGA 5GVSA 3L0IB 2WWGA 1G3RA 3I4LA 1S96A 3AGQA 2V7QD 4B2IA 5KSPA 1NN5A 2BMDA 1FX0A 4TLEA 1DARA 3D6TB 3JVUA 5FOTA 3LQQA 3U3JA 4TYNA 1E2MA 3Q9LA 3NKVA 4LDJA 4GP7A 2AFIE 2A5FA 3QBVA 1W5TA 1P73A 2BCJQ 8OHMA 1R7RA 1U0LA 1SKYB 1E9RA 2PEZA 1ZNYA 2IS6A 3C5HA 4HEJA 4OJKA 2Q3MA 4DLTA 4JLAA 2FDCA 1CF4A 2Z4SA 5CM9C 1DAKA 4HAUA 1G9XA 2XOKA 1JXOA 4BUJA 2IYQA 4C30A 1AQUA 4EPTA 4KVGA 4IRUB 2CNWA 3IQXA 4CDGA 1K8RA 1T91A 4QG7A 4OQMA 4ZO4A 3RNLA 4C0SA 4N0EA 3SJBA 1SXJB 2R6CA 2FMXA 3KKOA 3CLVA 2YV5A 4G0NA 3SBEA 2HXYA 2ODEA 3EAQA 4GRAA 4NCHA 2B8TA 4P32A 2IS1A 5DE3A 5FPKA 1XMIA 1KAGA 4M53A 4AK9A 4JLMA 2WOOA 3C4JA 3H2YA 1T3LA 4Q4HA 2ODWA 3EWAA 3VR2A 1CEEA 1NJGA 3E70C 3LA6A 3OFND 4M1MA 4URZR 1FP6A 1NL3A 2WHXA 2OV2A 4QFMA 3REGA 3BIFA 3LRPA 1P9WA 1Q21A 3ZS8A 2V8OA 2GVZC 5L3VA 4X8MA 4G3XA 2HXSA 5LPNA 1SVLA 3D3QA 1QDEA 2ZVQX 1AN0A 5FBLB 1P2SA 4N1AA 2ZRGA 4C7OB 2PLRA 1QG2A 4DEXA 3B1XA 4URWR 3WRYC 1IXRC 2W58A 2DCUA 2ZUDA 1JECA 2CVFA 2H8KA 3KZ1E 5ELXA 3OIVA 1NMYA 4D82A 4JBXA 2IF0A 4BFUA 1HURA 3PEYA 1FPMA 5JWRA 4BRUA 3THXB 2QUZA 2QBYB 2BHRA 1E9CA 1NBMA 4IW3B 1WE2A 1Q1EA 1IN6A 5JWOA 1R6BX 4HI0E 1NG1A 1UBGA 1JNYA 2O0JA 3KDSE 3B82A 1US8A 4DZZA 5C2JB 1CU1A 4V0KA 3AB3A 4CW7A 1KYIA 4IFEA 4M1KA 3IKJA 4WVFA 1UKVY 3S1AB 4B73A 2J87A 2OE2A 3VKHA 2IYSA 4ACAA 5LD2B 3KL4A 2P5SA 3L2OB 3OIUA 1OXVA 5HE9A 1LS1A 3R9IA 2XJ4A 3CX8A 3R7WB 4DLSA 1N25A 3O8DA 4HLUC 3EA0A 3QI2A 3EIEA 3IO3A 4XTRA 3Q3JB 3LW7A 1Q22A 3BERA 3GFOA 1GM5A 3K0AA 3FTQA 3PUWA 2NQ2C 3FMPB 1NSFA 3O8RA 3GPLA 2QAJA 2E73A 2P2LA 2ZJAA 2FFAA 4ZDJA 4LJ9A 2VEDA 1CJMA 3RABA 3ND8A 3NVAA 1XFAA 1T5IA 2GEUA 4Y0AA 1KSGA 4JBWA 4FW9A 3AF1A 2XOKD 1CS4C 1ZM4A 3THWA 1COWA 2CXXA 1ZP6A 4O2RA 4MDEA 2CNWD 3DOEA 2RB4A 4QGHA 3EZFA 2BCGY 2Z83A 3EZ9A 3RRYA 3AKCA 3N2IA 3AVPA 4LHYA 2J7KA 4NCKA 4C0JA 4E03A 5KYKA 1NP6A 3C41J 2R2AA 3DZ8A 4DCVA 1DEKA 1ZINA 3X1YA 3EZ7A 1FZQA 1X86B 4RCYA 1WRBA 4YMTA 1MO5A 4EFMA 2RGCA 5CM8B 3TH5A 1XCPA 4UQOA 4B6DA 4PC3A 1LS6A 1T0JB 5FUWA 3UGDA 2CL6X 3TE6A 3KJIA 2C9OA 3EA5A 1W2GA 2FE4A 2QL6A 1AK2A 1TQ2A 2LWIA 2SHKA 4Q9LA 3BD9A 4A8JA 4PHHA 1NRJB 1R8SA 3EC1A 2VP6A 4M1TA 2DY1A 4LRWA 3T06B 2NO1A 2Q9BA 2VSXA 4V03A 1L7VC 3SNHA 2ZUCA 2C9YA 1GRNA 3X1WA 1P62B 4LC0A 3LD9A 2OCPA 2QP9X 5D3QA 5DISB 4C4PA 3GP8A 1EWRA 2OFWA 2GXSA 3QSYA 1II9A 3IEUA 4JZKA 2BEKA 5JS8A 4MGIR 4QM6A 4W5JA 4PR0A 3FVQA 1KK0A 1YQTA 3TR5A 3BGWA 3A4NA 3EZ6A 4Z8XA 4TLBA 5JHGB 1NBMD 1KY3A 4OBEA 2QAGA 3A37A 4YONB 4FWTA 1KAOA 4J0QA 5G40A 2QPTA 3G5UA 4D0LB 1G5TA 2R6FA 2NG1A 1ZNWA 4GNKA 3NTUA 4IOLA 1E98A 1EFUA 1N6OA 2E1RA 2CL0X 4V0OA 3KQKA 2ZE5A 3P4XA 3DM5A 1R8QA 1FTSA 1GL9B 1TMKA 1G6OA 3HR7A 2ZU0C 4LZZA 2BOVA 2KJQA 1KDTA 1PUJA 4NCNA 3QKUA 1TEXA 4WW0A 2BMEA 4KAXA 2FPKA 4Q21A 4CEHB 1IXSB 2FEMA 4C0BA 1G7TA 2JAQA 5JHHB 2DB6A 3K0CA 1G20E 4DEYA 1ZC4A 1Q1ZA 4OK3A 1KI3A 2WWFA 1L4YA 5HE8A 2ZYUX 2PZFA 4TL8A 1P75A 1KI9A 1KO8A 4YMVA 5ANRB 2H92A 2LCFA 2NO7A 2ATVA 1COWD 3UXMA 2XTZA 3U4QB 3Q85A 3ZDQA 2C95A 1XZQA 3KKNA 2ZYVX 4TTRA 3K0SA 3GJXC 5EXXA 3ZVLA 1I4DD 3FFAA 4IEEA 4QHTA 4L15A 5C4GB 4TZ0A 1FW6A 2CVHA 2QA5A 4UNPA 4AKIA 1VTKA 1FMLA 2O0KA 2GCOA 4Q48A 4B34A 5JSZB 4A0HA 1VCIA 3W5JA 4QHYA 3V00A 1KKMA 4TQ9A 3U7HB 3Q7PA 4M1YA 1P5ZB 2BV3A 4D6PA 1XD8A 2XAUA 1AA9A 5KNCA 4IVRA 2IUTA 5EP3A 2OCYC 5H1YA 4C9BA 2FZLA 4KFRA 2V6IA 3B8HA 1OFIA 1W46A 1YZUA 1HQCA 1QHIA 3QXJA 4NCJA 4B76A 1SGWA 2F1RA 3K0FA 4Q00A 1UADA 5AUQA 2JJ2A 3BS4A 3GD7A 1MO3A 1VCNA 4LBVA 1P2TA 1FNNA 1W0JA 3QIAA 2PMDA 5FL3A 2P6RA 1B23P 2PL3A 1KK1A 1S9DA 2C2HA 3P26A 3QUSA 2VP9A 1QHSA 1HYQA 1PTQA 1TUEA 1OF1A 1K5GA 421PA 3VR6A 1XEXA 2V6JA 4DRZA 2V3CC 5FI0B 2YWHA 5SZJA 2FFHA 2VSOA 4LJ6A 1H65A 2QRZA 3N2EA 5DSZA 4ZDWA 1T3SA 4A2QA 1U0JA 2FX3A 1IHUA 1Z0IA 1XMSA 3CR8A 5C46F 3AM1A 1Z6GA 4LV6A 1ZBDA 1AGPA 4M1WA 3CPJB 2HJVA 2RHDA 3H4MA 2YYZA 3VKGA 4B3BA 3AF4A 5FR2A 4BLRA 2W6IA 4FMCB 2RAPA 3KUDA 4Q4AA 3WYGA 2G1KA 3IUYA 2QTFA 4C0HA 4AI6A 3D31A 4GT1A 1KKLA 2V9PA 4C0QC 2FEOA 1GRRA 1ODFA 3AKEA 4C2UA 3RDPA 4RZXA 3T5DA 2BMJA 4JL5A 3FOZA 4AG6A 4FCTA 5FL7A 3F8TA 3TJZA 1YZKA 2QM7A 3RC3A 1OKKA 1QHHA 1EGAA 1OXTA 1N0UA 4UJ3A 4Z51A 5DYIA 2GBLA 2ECKA 4JVMA 1W7AA 1HTWA 3QENA 1D9ZA 4BLTA 1XMJA 3Q8XB 5CYOA 4DSUA 1R10A 2X2EA 2BJVA 3CR7A 2QM8A 5D3MA 4OHZA 1T8UA 1VCMA 4D26A 3I5YA 4DBLC 1W4AA 1R79A 2ODBA 3HPRA 5H8WA 3L82B 1FNMA 2FNAA 3W6NA 4FINA 1XD2A 3M6AA 3MJRA 3ADBA 1M8PA 2NIPA 3KQNA 4P4SB 3JVVA 1P7CA 2G9NA 4JLNA 3GLGB 2IHBA 1TU4A 3FKSA 4I1SA 3BE4A 4B6FA 3C14C 1AZSC 3L43A 5DO9A 1F60A 1GKIA 4AC9A 3GJ0A 2HLDA 2MMGA 1WQ1R 2GETA 3AKYA 4GOJA 1QHNA 1IY1A 2JJ2D 4GZLA 3K70D 2IEYA 1TQ6A 4ZV4A 2Z5FA 2OO7A 2EQBA 4KO8A 3FWYA 4Q5IA 1MOZA 2VIIA 4I1VA 1WBBA 2WMOB 3L0OA 3CNOA 3GEEA 4US0R 4BLQA 1W0JD 3TQCA 5DN6A 1X3SA 5JMTA 3B6EA 3BK7A 3RRNA 3GMTA 2WIBA 2A5DA 3VNVA 4XD7A 4OI0A 1NVWQ 1ZU5A 1OLOA 2PBRA 4RFVA 1GFIA 1N6LA 1G18A 2OT3B 2ONJA 3RWMB 1OIVA 2OBLA 3VHLB 5C1BA 2FN4A 3PXGA 5GJCA 3B85A 4UXJA 1JEDA 5EXPA 1KO7A 2FSGA 3UMRA 4CZ2A 2O8DB 4NZYA 2GAOA 2Q3HA 2WTUA 2FNFX 1E1QA 3C5CA 3CRMA 1G6HA 1W36B 3AP2A 2GTPA 2IXGA 3U3RA 3QG5A 2QAGC 4U02A 1M2OB 3FHTA 5GADl 2FPLA 3H0KA 3JZMA 3U5ZB 1NY6A 4TMWA 1T9HA 1XNJA 1NY5A 1JPJA 4FXPA 1E0AA 3KJEA 4ZCLA 3U2QA 1JQLB 4HYYA 3THOA 3DDCA 4RFSB 5JZVA 2C8VA 1TBNA 1E2FA 4YXWA 2ZR7A 2W6ID 3U44B 3A8TA 3SYLA 4DLWA 4PSAA 3DO6A 2VH5R 2F43A 1G4AE 1YHNA 2J9RA 3QPWA 4V0ME 3SZRA 6Q21A 3GLGE 4GPTA 4EJSB 1N6KA 2GZDA 2WBLC 3WMEA 1E9SA 1G3UA 2MSDB 2ZRAA 1OXUA 1P9RA 3KKQA 5FPHA 2V54A 1IY0A 1XXHA 3C16C 1MABB 2QG6A 2OCBA 1I2MA 5FL7D 2EFDB 1LNZA 5FBRB 3U3MA 5BQ5A 4TT3D 2ELIA 1TAGA 3CKLA 1OKKD 3LDAA 4RZ2A 1S3SA 1UM8A 2YC4C 1J99A 3W3AA 2RGNC 4JIMA 2GF0A 4DSTA 3WNBA 3C15C 2GAAA 4UNQA 4DCSA 2NGRA 1D2NA 4AIIA 2ZE8A 3B13B 3U60B 5EUMA 5K8TA 4QGFA 2G3YA 3QQ5A 2QSZA 4OHVA 3TAHA 1E2NA 1RPZA 4IVQA 3AVWA 5KSOA 4G5SA 2YINC 4OQFA 4R7ZA 3BXZA 2P5TB 5UKDA 2D62A 1KI8A 2ZS7A 3FKSD 4UKDA 2JLUA 3NBYC 2V55B 5BXQC 4F4CA 1DAGA 4HB2A 3OEHA 4M0LA 2FA9A 2HLDD 5FUVA 2GF9A 2B8WA 3CIOA 3W8NA 5E3HA 1E96A 1CLUA 1J8MF 4MRPA 5IT5A 2Q9CA 1VG9B 1SHZA 1DAFA 1RRCA 3B78A 3GQBA 3LLUA 2QQEA 1E9AA 2ZYWX 4UXHA 5DN6D 1AS3A 2RCNA 1U9IC 4XD7D 1JJ7A 3KUCA 3A1TA 4TMTA 4XWAA 5FOXA 3BB3A 3NIBA 3QE0A 4HLUA 4B48A 3K70C 2GJAA 1VYUA 4CEJA 3VR1A 4DCUA 2XJ9A 4LJAA 1KMQA 1IJFA 3UWKA 3WYAA 2IYLD 2IWRA 3VU9A 3NXSA 1CULC 5KDDA 2EYUA 1KJZA 2W6JA 1E1QD 1XTRA 1NVVQ 3P4YA 3O47A 1EFTA 1LTQA 4IDHA 4D4JA 4LX0A 4MUBA 1IN8A 1B0UA 2V7QA 4LJ7A 1KO4A 4QJ3A 4BZPA 3O8BA 1NVVR 1N6NA 2R62A 4DHEA 4ZKEA 2AFHE 1W5SA 4YXWD 1Q0UA 2QU8A 2Z43A 1OYWA 2GHIA 5LB2A 4LCBA 2GK7A 1ESMA 2QSYA 4LHXA 2O8BB 2IT1A 1N6IA 2JIZA 4FMDF 5KU1A 3QPUA 5FPYA 2AD5A 2I3BA 4G5RA 4DIEA 3PIRA 2W00A 2REXB 3BB1A 4JT4A 4FIDA 2ANBA 3AF2A 2OXRA 3X1ZA 2RH5A 1TADA 4QKQA 3CM0A 1JAIA 1G41A 4A1FA 2I4IA 2ZI3A 4DB2A 1E2QA 2E9SA 2XX3A 2EFEB 2H16A 2O8EA 3CH4B 3MJHA 5EE3A 4NTZA 4P0TA 3VMFA 2WKRA 4AYWA 2GEDA 2J7PA 2J45A 5EJEA 1OXSC 4XVRA 3QKRB 3PFIA 2J0QA 1NKTA 3TBKA 2XNSA 4RD3A 2BKEA 2NMVA 2G6BA 2A9KA 2KBEA 2WOJA 3TNFA 3K53A 1RIFA 3EG5A 2A2ZA 1MRSA 5JJIA 4MRVA 4QOSA 2OG2A 3GEIA 3BH0A 1X1RA 3OEHD 521PA 1P60A 4DJTA 4C2TA 2ZE6A 4F4IA 3R9XA 3LAWA 3TW4A 1GNPA 3BC1A 1Z6XA 4RD0A 1QBKC 2YOGA 2ASEA 2VHTA 2WSSA 3CW2A 5EXSA 2Q0HA 1FOEB 1KDOA 2AL7A 1KTVA 3E1SA 4XVUA 4PAMA 1XA6A 1U94A 2FOLA 3IIMA 3OE7A 1S3GA 3BH6A 3NHBA 4HLQB 3KTAB 2GESA 2IS4A 1N6RA 1J2JA 2WAXA 4WXRA 3ETLA 4R98A 2CK3A 3FMFA 4CYMA 1E2PA 3GLIA 2QQ0A 3KB1A 4PAQA 3L8ZA 1Q1BA 2ZRKA 4QL3A 5FOUA 1F3OA 3K8YA 2FPMA 2W6JD 4PX9A 4D80A 2ZJ5A 2PJRA 2G1JA 1ZW6A 2RGEA 2GJKA 2EFHB 4YMSA 2O8CA 1E1RD 1T0HB 1UBEA 2OCAA 1P4SA 1UPTA 3KJHA 2WM9B 3EXAA 1IQPA 1Q3HA 5HCIA 1UFQA 1MKYA 2J46A 4Q4JA 2IYTA 1D9XA 1AM4D 2DBYA 4KFSA 2JATA 3FYHA 2HCJB 1Z0JA 2ZROA 4JL8A 4RJLA 2P3SA 3B1VA 4Z1MA 3LBHA 1M7GA 2JIZD 2BMFA 3IILA 2FSIA 4HLDA 4HB4A 4XJXA 1SXJA 1XJCA 4YDSA 1RRPA 2CLDX 3MUFA 3MMPA 4M1OA 4EJSC 2GXUA 3AVXA 3A58B 4PAOA 3L0PA 1XZPA 2ZI6A 3K9HA 5FBWB 1KO1A 3EW9A 2JLRA 2AK2A 1CR4A 3FKQA 4TTQA 5M04A 2FGKA 3I5XA 5KDLA 4G1UC 3W8RA 1DG3A 2J7PD 3EWSA 4BEBA 1JR6A 3MSXA 4PPFA 5DIFA 1OV4A 1S4QA 4GOXA 4PQRA 4W5HA 4B3DA 3GLIE 1KI4A 1ZUIA 2J0SA 2BBSA 4KI0A 4AYTA 1LY1A 1Y63A 1KI7A 3RRZA 4IKEA 3UMFA 4QNMA 4C7OA 4TYWA 4EPYA 2QROA 4AKEA 1G7CA 1KK3A 2WSMA 2ZRJA 3L8YA 1GIAA 3A4MA 3LX8A 1QRAA 2ZUBA 4ACBA 3CX6A 2ATXA 3HYRA 2RGAA 4XH9B 4G5QA 2GZHA 4OHXA 4Q4HB 3W6OA 4MQBA 1SKYE 3W34A 2XTNA 4JYCA 2WSSD 2PJZA 1E79D 3HWSA 3Q7QA 4TQUS 5CB8A 3THXA 4IDQA 3OE7D 1E94E 5EE0A 5SZKB 3MWJA 1ZM7A 3PEVA 3X2SA 5HCNA 3T1OA 1SVOA 1ZD9A 2CL7X 1Z83A 1ZU4A 1Z6AA 3ADKA 4WXPA 2CK3D 2OXCA 2JLZA 2NZJA 1SXJE 2X19A 1BYIA 3CF2A 1CR1A 4XTCS 5L3SB 3JZAA 2ORVA 1MRNA 4MKGA 2XITA 1Y8FA 4HAXA 2H17A 4L4UA 4B2LA 2OHFA 1H8ED 1X1SA 2YWEA 1I4TD 3T1TA 1E99A 3SJAA 4D0GA 2XZOA 5A4JA 5EE1A 1G17A 3ASZA 5KDOA 1F2TA 1KNXA 3NBZC 4ZCMA 1ZM9A 2F3TA 4HB3A 1J7KA 3GJ8A 4FCVA 4MRNA 5B2ZA 2OBMA 4PZZA 2KE5A 1A2BA 1DELA 2ERYA 3NDPA 2ZSFA 2ZRNA 3MAAC 4Z1MD 5SZIA 1XCMA 4TYYA 4KSCA 2ZREA 4NL4H 4JMPA 3TUIC 1J90A 3PUYA 1KHTA 3C7KA 4POAA 4DSOA 4BLSA 1SXJD 1KOFA 1ZIOA 4URUR 3IIKA 1GILA 3FB4A 4JSTA 3RS4A 2KSQA 2N46A 5FTJA 3N70A 4QBFA 4B43A 4AG5A 4OHYA 4O25A 1D6JA 2IA5A 3TUJC 1GAJA 5HR5A 1ZNZA 4TYPA 3ZVNA 4HZUB 1Y3AA 4KYIB 4KCGA 2ODNA 5JWHA 3AVQA 4KXFB 2ZJ8A 4ILEA 4M9ZA 4LYAA 1U8YA 4BEJA 2W2TA 3THWB 121PA 4XOIA 3ZJYA 5LDDC 1MT0A 4BGDA 5GJWC 1D5CA 2ORIA 1YZTA 2RGDA 3X1XA 1X6VA 3SU8A 2CMKA 2F7SA 3KY9A 2FF7A 4LV8B 5IK2A 1L8QA 5FOSA 4LJ8A 1UEIA 1KK2A 3NEYA 2JJ8A 4RZ3A 5SZHB 3H86A 2ZRFA 1EK0A 2NO6A 1C9KA 4OI2A 4NMMA 2VF7A 2VSFA 2CCKA 5L8VA 2R8RA 1SQ5A 2CHGA 4Q7KA 4R9UC 4CF7A 2CLSA 5GJBA 1DOAA 3AP3A 1UBCA 1Z28A 2X77A 4M9SA 3DVLA 1M74A 1ZMXA 3DKPA 3TSOA 3SHFA 5FI1B 3U3KA 3V9PA 4B33A 3PEWA 1DO0A 4DLUA 4RVCA 1VDZA 3V4RA 2OILA 5CYPA 2AD1A 1KY2A 2V1UA 2G88A 4V0LA 4JVNA 4QGAA 5A0FA 3TKLA 4G5GA 5JEEA 1SVMA 4U00A 1U99A 2J3EA 2CDNA 5G3ZA 4LPKA 4Z54A 2HV8A 2KWIA 4QJ5A 3WXMA 4MDFA 2IYXA 4D4LA 3EX7C 1Z2AA 3BWDD 1HE1C 1X8LA 3QXSA 1ZJ6A 4FI3C 5E95A 4AWXA 1IXZA 1FP7A 1DO2A 5J4KA 4BFZA 3IPYA 2ZRDA 4CEHA 3HPQA 2C9CA 3TIFA 4NH0A 3VR4A 1XTSA 2JLVA 1F2UB 1JR3A 2D7CA 2ZRHA 4DDUA 5JLJA 5DNYB 4WAUA 3T1QA 1KNQA 4N3NA 4GSYA 2H1LA 3K9LA 1GKYA 1Z6TA 3GJ7A 4JL6A 3U7GA 1LFDB 1E0JA 1DVRA 2I1VB 2C99A 2JA1A 2FFBA 1GL6A 1YZQA 2RGBA 4Q9IA 1XBTA 2RGNA 2YZ2A 3U4QA 1S2MA 2VF8A 5L3RA 4I99A 4GI7A 4IXMA 1G5RA 4B44A 1LF5A 2QMEA 3TVTA 2ZM5A 3MG9A 2WKQA 3MWYW 4QC2A 2ZJYA 5JJLA 4F4JA 1ZRHA 4MYHA 3VX3A 1PLKA 2XZPA 1T5LA 1NNEA 1PTRA 4BFTA 2YKGA 3FFBA 3SFZA 4B3CA 2WMNB 4DIDA 1SXJC 4C0AC 2WJIA 1FUKA 3WMFA 3I3SR 3NH6A 2IYYA 1NLYA 1UEJA 4B2PA 4JKYA 1ZD1A 3VQTA 3IPXA 1PVOA 3FDIA 1WA5A 4Q1EA 2R6AA 5EE9A 1ZCAA 4HDOB 3UGIA 1DE0A 1Z08A 2QORA 2AWNA 1IAQA 4NPHA 2GNOA 3ECCA 5E7IA 4DCNA 3GLFB 4S35A 1AKEA 5JBQA 1RFLA 1XDBA 4XWKA 5IK2D 1SVIA 3AP1A 1U9IA 1W1WA 2GRJA 1GUAA 2VO1A 1BH2A 2GCOB 3CZQA 2VHJA 4JJZA 4MGKR 4QHSA 3SN6A 1JR3E 1MO6A 5CK5A 2TMKA 4DXAA 1W0KA 1E6CA 1XMVA 2GCPA 2JLXA 3EC2A 2BM1A 3SQXA 1PV4A 1YKSA 4RSGA 5CJPA 4PC2A 2GJSA 3NBXX 4MH0R 4MYTA 4MRSA 4HATA 4A9AA 2KB0A 1GNRA 1U2RA 2ZRPA 1PLLA 1E9DA 3AV0B 4PO1A 1ESNA 4QGGA 5L3QB 3B9PA 2XEXA 3CRVA 1Z8FA 2A7QA 3KJGA 3CXLA 5KSZA 3EPKA 3K0FB 3CNLA 2GXAA 3WNCA 4UXIA 4R2IA 2O5VA 3MWKA 3REFA 4KSBA 4Q7JB 4Q19A 3BB4A 4E09A 2E87A 2PT5A 1G8PA 1HT2E 5LD2C 1G3IA 1FUUA 2WIAA 4YDHB 1JR3D 2ZVPX 1NMXA 1HT1E 5G3YA 1E9FA 2IBMA 2W0SA 4XSGA 5K8LA 4TMVA 4ASUD 3A1WA 3GLFE 1OW3B 1A2KC 1GVNB 1NIPA 3LNCA 4W7SA 1R5NA 5IRCD 1RYFA 3DZDA 5TARA 3GLHB 4JLJA 4TQAA 2BKUA 3SC3A 1W49A 4IFBA 1XX6A 4ZDKA 5E7MA 1SVSA 5BYKA 1G16A 2X2FA 4TT3A 1KI2A 2IYVA 4OKSA 2VHUA 3BJIC 2UKDA 1GOTA 3IQWA 2C98A 4B75A 3N5CA 3ZQ6A 4DVGA 4Y0VA 3WYFA 1N5LA 1Z0AA 1IOZA 4Q4AB 1HUQA 1P61B 5EUQB 4M1SA 1Z29A 1EX6A 3VFDA 4L9MA 3V4FA 1QVAA 4MA4A 1OIWA 4A4DA 3X1DA 4TSFA 3B1ZA 4RD4A 3SQWA 2EVWX 1OXXK 4ZIRA 2WJYA 4Q7MB 2ZR0A 3TAUA 4P4SA 3UG6A 4V0MA 5FBVB 3RS3A 2RGXA 1E32A 4RY2A 3GLGA 1IN7A 1TU3A 1XTQA 4PO8A 1QHXA 3T12A 4AYXA 4ARZB 5DI9A 1KO5A 4EIWA 2XGJA 1DAIA 2DFNA 3SHWA 1KSHA 1Z0DA 2J0UA 3RS5A 4JSYA 1K6MA 3FHOA 4MGYR 4RCZA 1VECA 2ZI5A 3ZGXA 4FKDA 4ON9A 2EFGA 3SFVA 1HQYE 2VYFA 4H9GA 4XIGS 1WDTA 1W0KD 3M0EA 5EZ6B 4KVAA 1DAEA 4IEIA 1XD2B 5FR1A 2W2XA 1VHTA 1BOFA 2ONKA 1RKBA 1AIPA 4JBYA 3TGPA 4M9XA 4GDFA 1UDWA 4BFXA 3ND9A 1IN5A 4A6PA 1OH6A 1CP2A 2CJWB 1KBFA 2ZSEA 3RRMA 2OEPA 3PVSA 3RWOA 3H84A 4BE7B 1E4VA 5AJWA 1OPXA 4EPXA 1A1VA 2J5XA 2AR7A 1Z3IX 2C77A 3CBQA 221PA 4N0DA 1HE8B 1NF3A 3AVVA 2CE7A 2HF9A 3SI7A 1WF3A 1X8KA 1TNDA 2C5LA 4RFSA 4AY2A 5J4YA 1XJ0A 4EFLA 1OHHD 2GKSA 3IHWA 4QJ4A 4RZUA 4D4MA 3VR3A 3ICEA 4V02A 3W90A 3UKDA 4GMDA 3AVYA 1OFTA 4B35A 4EJSA 3LW8A 3RYTC 1KMHB 3IDQA 5CJ2A 2BDTA 4US1R 4RKFA 2ZTSA 1KSJA 2ZITA 3QKSA 4HAYA 2VRWA 1R0YA 1RC8A 3ZD6A 5J4LA 4NYMQ 4HLCA 2ZRCA 5HPYB 1MABA 1Q12A 1EXMA 2F6RA 1YE8A 4H1UA 5G41A 2O52A 5J4HA 5C4MA 3ZVRA 3AVOA 3MD0A 2ORWA 2QTVB 2IYZA 1EX7A 1D2EA 4NYMR 2VPPA 3E5HA 3DEFA 5JECA 3WHLA 4URYR 3NWJA 2EWWA 2LKCA 3FHCB 1DG1G 3GFTA 1XRJA 4D2IA 5J4VA 1WXQA 3BFXA 4HB0A 5DI3B 5B58C 2A30A 5F9FA 2JGNA 3F3YA 3F5FA 4A92A 1GNQA 3UPUA 4OQNA 4BQSA 4EAQA 4PTLA 4TSFD 1ZM3A 4E22A 1XXHB 4EQ6A 3SEAA 1TUIA 4KV9A 3U7FB 3K9NA 4IOKA 2ZI7A 1II8B 1E3MA 4WZBE 3TUZC 2BEJA 2LKDA 2J41A 1IY2A 3SE0A 4E07A 4OK6A 1DS6A 2YVUA 2ZI4A 3I1FA 4OJQA 4PQYA 4TLDA 1NI3A 2QNRA 3BFVA 1W4CA 3ZZ0A 1YR8A 3IIJA 2JDID 1ZAKA 3OIYA 1OT3A 2F55A 1KZGB 1AS2A 3CWZA 5B30A 2GILA 5AJZA 3AH8A 2YNMA 1P2UA 621PA 3P27A 4LBZA 4DC9A 5DYGA 3TSZA 3ZH9B 4A0FA 4NE2A 1E2HA 2ZS9A 1NIJA 2VHCA 5FOWA 5JRJA 3K09C 4YMWA 5JEDA 1O3YA 1OYYA 4A2PA 2H57A 2VP4A 1NMZA 4KFUA 5HTKA 1ANKA 1BMFA 4PHTA 4MUAA 4DLRA 5BN3A 3ZQJA 4Q02A 1W36D 2AKYA 2VP0A 4OHWA 3SJCA 2GEVA 2WZQA 2DYKA 5JCPA 1Q1QA 5JRZA 1KI6A 1LB1B 3U6BA 4GMXA 1O87A 2WWIA 3QF4B 3QG1A 5B57C 3HJNA 5CLLA 4DDVA 4JT2A 2RHMA 4ZCIA 5BN5A 3B60A 3G0HA 2ZS8A 4OI4A 1E1RA 1RW4A 4UNNA 3T35A 3SJZA 2DB3A 3EIQA 1RJ9B 4DDWA 4CEIB 3CWQA 3TMKA 4EDHA 2X1VA 1G8GA 4MKIA 2O8BA 4P3YA 5FUXA 4CEJB 1I4LD 1XPUA 3SYNA 4JKIA 3VU9B 4HAZA 2Q21A 2PX3A 4LI0A 1JXMA 5F2EA 2BBOA 3T61A 3RC8A 1S8FA 1AJEA 4IHQA 3BORA 3F0TA 3TW8B 1A5TA 2N42A 1G5PA 2NTYC 2VQSA 5JCZA 2HCBA 2D2EA 3BH7A 4KLNA 3ZVMA 3LV8A 3OAAA 1M7BA 4ESVA 1JQJC 1P9NA 4P33A 4C3ZA 3WP0A 2L0XA 1ELOA 3CUEF 3QKRA 1RFHA 4PO9A 1LW7A 2BM0A 4PANA 1E69A 1Z2CA 2EYQA 2PCJA 3BRWD 3THYB 1HH4A 3EZ2A 2XXAA 3UEJA 3CNNA 4UJ5A 1W48A 1HEIA 4LSGA 1T3HA 4IXNA 1SZPA 1R0WA 1T4GA 2QY9A 1KIMA 2F1JA 2F3RA 2ZRIA 3KFXA 2I1QA 2JLSA 4WZ6A 4Z8YA 1DTSA 1YRBA 3QKTA 1TPZA 1G3MA 4DDTA 4HUQA 2O8EB 3CF6R 3PUVA 4Q03A 3MFYA 4DB4A 2QMHA 2OAP1 3LBNA 4EUNA 4LYJA 4TLCA 4P31A 3QVUA 1KI1A 1E79A 1Z47A 1ONBA 1U98A 2C03A 4PC1A 4BZXA 2CE2X 3CX7A 4HDQB 4KBGA 4LGMA 1Q57A 2H5EA 1XEFA 2MMCA 2QRNA 3PV0A 4MKHA 1EFHA 4B3GA 1R2QA 2OESA 2DHRA 3KTAA 2UZ3A 1N6PA 2O8FB 1PLJA 2YJTD 5CDFE 2PCLA 2FFQA 3ONWA 1S1CA 4K8OA 2GK6A 1BS1A 2DWPA 3ZS9A 1YR7A 2ZU6A 5E4FA 4W5WA 4LPSA 1U90A 1S9HA 3WRXC 2IEZA 1BMFD 2FV8A 1HV8A 2VA8A 4BFSA 4M22A 4II7A 4EPVA 1J70A 5KNBA 1FARA 3PEUA 1H8EA 2QT1A 1XCGB 4IOJA 3WY9A 4LYFA 5JFGA 1AZTA 1XEWX 1GITA 2OFOA 3U3OA 4YQFA 1N0WA 2IHYA 4H1VA 2WKPA 4TYQA 2EFCB 4B71A 3DMNA 3AKDA 3UFFA 1JBKA 4KYUA 3B1WA 4TWZA 1N5KA 3GJ4A 4PXAA 4Q4LA 1UBFA 3A36A 4EPRA 2Y8EA 1A4RA 4JLBA 4ZI3A 4F92B 2CLCX 1YZLA 1YZGA 2VLIA 4G01B 1FTNA 3KB2A 2VL7A 1TQ4A 2ZE7A 2ZAOA 4EPWA 2ERXA 2IC5A 3QOFA 3TVDA 1KDRA 1K5DA 2F9MA 4D0NA 1W36C 3T5GA 4FN5A 5K8IA 4AKHA 3MGCA 5EXTA 3MLEA 1FX0B 2JEOA 4LJ5A 1UAAA 1YU9A 4GP6A 4PPQA 5TXGA 3OAAD 4DT1B 5B64A 2O8CB 3HP1A 4BZQA 4B3FX 5EZ5A 4Q4JB 5EP4A 4KBFA 2FWRA 4Q1AA 4B6EA 1A82A 2P6NA 1PUIA 3VX4A 1XPOA 3LX5A 2GXQA 1GZSA 4Q1DA 3OF5A 1L4UA 1G21E 4PHFA 2QGZA 2W83A 4HDCA 4Q1BA 2HYIC 4Q1CA 1EFRD 1Z5ZA 3HU3A 3RHFA 4U7DA 1TTTA 2GZAA 1W4BA 4TMZA 2F1HA 4LJ4A 3CRQA 1QF9A 1RVDA 3QXHA 2ZQ5A 2NPIA 1VMAA 4TL6A 2YOFA 2VBCA 1FQKA 2BIFA 4NYJQ 2EW1A 4A36A 4HAWA 4BPBA 1CJKC 1KJYA 4CVNA 1NKSA 4BLOA 5F9HA 2NOAA 2MSEB 3CF0A 2A78A 2IXEA 2HYDA 3GCGA 4FCWA 3RSLA 3HR8A 1JPNA 2ZIAA 4DLXA 4YLGA 4NYJR 2WJHA 3W3ZB 4LUCA 2QBYA 4TLAA 4RKEA 2BC9A 1RRGA 3L0SA 4QRHA 1BYUA 4TN1A 4Q1FA 3CO5A 3SBDA 5IF9A 3IEVA 2QPAA 2H18A 2ZJZA 4WOPA 5TVKA 2VP5A 4I1UA 3RAPR 1HY3A 4GL2A 2FGJA 4JLPA 4JVLA 1EFCA 3QVVA 2PZEA 4Q18A 3AVUA 3S1AA 5L3SA 3R9WA 5DLQC 1NN1A 3PG5A 2QGNA 2ZAMA 2DFTA 4NDZA 3OHMA 2IYRA 3R7WA 2EU8A 2B92A 3H1TA 3IO5A 2Q3FA 1CRPA 1YR6A 1Z0KA 3LFUA 4GZMA 3MCAA 3SR0A 1YJ5A 1TF7A 1QZXA 2AKAB 4FWIB 2VHQA 1NG9A 2ZI9A 5AR1A 2AX4A 4ZDIA 2G77B 4I81A 3PITA 4A6XA 2IUSA 5KPJA 3OEEA 1OFUX 3KQUA 1M34E 4RD6A 1CTQA 3TR0A 2IYUA 3I8SA 3QEOA 1US8B 1JAHA 1KSFX 4TTPA 3BJIA 1VG1A 1T6NA 3CZPA 4LOAA 2YWFA 3WMGA 2FZ4A 5TB5A 2UZIR 5LB4A 5J47A 1VKJA 1P2VA 2H7VA 3M4YA 4CGZA 1Z6YA 4DUGA 4MRRA 2QENA 1N6HA 2G0NA 5C18A 5IHPA 2WWXA 1QHYA 4B74A 1F2TB 2XB4A 3K0AB 2CBZA 2K5UA 5DHAA 3BBPA 5FPTA 2NO9A 1M6NA 5AUPB 3VNUA 4HZUA 5GVRA 1E2LA 1SVKA 1DADA 4A15A 1Q44A 5EQTA 4UNSA 3NEJA 1AQYA 2QMUA 3A1SA 1EESA 2WVJA 5P21A 4RD1A 2ENNA 5CLQA 1GWNA 3I32A 3A1UA 4EKDA 1IN4A 2R9VA 4L5BA 1W4RA 2ANCA 4AURA 5KHOC 1QHGA 2OBNA 3BOSA 3IGFA 3DPUA 3TRFA 4BLPA 1RZ3A 5KSYA 5IDVA 2EWVA 3QXXA 2RMKA 1MV5A 2DFLA 1JEEA 4M8NE 1OH5A 4URXR 5BYJA 1R4AA 4TL9A 1DBSA 1NBME 4O2LA 5FOVA 1OB2A 3SS8A 1XB2A 4QNRA 4URVR 3I62A 2B6HA 2J0VA 3PUZA 4ABYA 5FTKA 3QXCA 1MH1A 3W9YA 5TV2A 4BASA 2IX3A 4RD2A 4A8JB 1WP9A 1QG4A 4NCIA 2AXPA 5FTLA 3KQHA 4IJMA 4NONA 2A5GA 3IHLA 5AJYA 4IDPA 5DHFA 2ZRBA 3LY5A 3WHKA 2FJUA 4Q47A 3KXLA 2W0MA 4LHWA 1VCOA 1AS0A 1GG2A 4JJKA 4ZPXA 1ZVQA 1YZNA 4M4SA 4LHVA 721PA 5KOYA 2B21A 1JB1A 2A5YB 1VYVA 3PR1A 2HDNB 2RKOA 4F93B 1F2UA 4XWOA 5KO2A 4O3MA 2OSBA 1E2EA 2GVIA 1E2IA 2R6DA 1LF0A 2V1XA 4D81A 3OEED 2QAGB 4G5OA 2PT7A 4JLKA 4ASUA 5GJVC 3UEYA 1G7RA 5BW8A 2JLWA 4DKXA 1R5OA 1E2DA 1XWIA 3GFPA 4R71A 2IWHA 4GOKA 4OL0A 2HEIA 2C96A 2FU5C 4EFNA 2VP2A 2HJGA 5FTNA 3I61A 3GJ5A 5TDHA 1SULA 2AXNA 4DUGD 1IM2A 3KKMA 2F1IA 2IYWA 2QN6A 4HAVA 4BFYA 3LVQE 5J40A 1G291 2YHSA 4Q66C 3KQLA 5JSZA 2BVNA 3ZZTA 1SKQA 2IS2A 1OSNA 2JJ1A 2AWOA 4ZKDA 4K46A 3QJYA 2REOA 4PPNA 3UATA 3A4LA 1M1YE 1SVWA 2DFKB 4LY6A 5FH9A 2A5JA 1NJFA 2B7CA 2DR3A 2GCNA 1GP2A 5EP2A 1X8JA 4A82A 4CIDA 5AJVB 2Q6TA 3HYTA 4LK2A 4CRWB 3A1VA 4LWZA 3FGNA 4L9SA 1UF9A 3GLFA 3EIHA 4OI1A 3J81k 3I73A 4NBSA 3WNDA 2QT0A 4LBWA 3NDBB 3UMSA 4HZIA 2GDJA 3DHWC 4MYCA 1II0A 3DKVA 4JLOA 4QBHA 1UKEA 3Q72A 3T34A 2PEYA 3LH5A 2Z0MA 4OQXA 1E0KA 2NPFA 4C0LA 2D7DA 5KPDA 4DSNA 4K81B 2PH1A 1G1MA 3R8CA 1OH8A 2D3WA 4WBSA 3K09A 4ZI2A 4DLYA 2OZEA 4QBGB 4D25A 3VR5A 1U8ZA 4BWYA 5FPSA 1F48A 2YUUA 2IL1A 1D8TA 1MR3F 4DLZA 2P6UA 2HF8A 5L3QA 2ZXUA 3WBJA 4IDOA 3EARA 4B32A 3KXIA 1WMSA 1C4OA 2OUKA 1H8HA 4PZLA 4QBIA 4PQFA 1C1YA 5F3WB 3ZYCA 1CJVC 2NO0A 1A7JA 1CR2A 5EE5B 1JALA 1Q3TA 3K70B 1G7SA 1ETUA 1L2TA 4FMCF 3TSWA 3UIEA 3VKWA 1LV7A 3LBIA 3AEZA 1TF5A 1GTVA 2OM2A 1N0VC 3BAFA 3LXXA 4M9QA 4MITA 1OHHA 2GJ8A 3SOPA 4X8LA 5CK4A 1F6BA 3QF7A 3I72A 2QMOA 1VYTA 3D7MA 2YWGA 2ZRMA 1XEXB 1FMJA 1XU4A 5FTMA 1AKYA 2WPDA 4L9WA 1OE0A 3GLHA 2BBTA 2IXFA 2GWHA 1N5IA 3LQRA 5E7JA 4KHZA 1ZUHA 2HT6A 2P67A 3G82C 1VG0B 3DM9B 5K8UA 2QTHA 5JI2E 1PJRA 1W44A 3NC1C 1E9EA 3ZLJA 4F91B 4GFDA 2JCSA 3B2EA 1M7HA 1Q20A 2WICA 4IDNA 3B7GA 4LHZA 4GBMA 5LBIA 2ZJ2A 3C8UA 3CRW1 1YVDA 2D06A 4MKFA 3OESA 1VHLA 2R6GA 4X8OA 5AK0A 3ADCA 4BFVA 2ENZA 4M21A 1OIXA 1P3JA 2JJ1D 3FMOB 4NU0A 1CKEA 2ZSBA 4PPGA 3NHAA 5CIQA 3PCRB 2ZANA 1PZNA 2D2FA 3FE2A 1W47A 1N3BA 1VPLA 5A5GA 4PC6A 3SYKA 3UG7A 1FQJA 4ARZA 3FMIA 2IW3A 3OZXA 1QHHB 1KGDA 3LLMA 5AJXA 3GEHA 1Z07A 4NHOA 4TZ6A 2QZ4A 4XSHA 2AHOA 2QP4A 3AGPA 1ZD8A 4JS0A 3RANA 5KUTA 2JDIA 1I2DA 4UNRA 3QEJA 3PUXA 2Z4RA 3U7EB 1E0SA 1QVRA 2NZ8A 3ICQB 5FBQB 4IOMA 1GKUB 5D3MB 4FMBB 3O8CA 3EPHA 4AKGA 1XPRA 4PC7A 5DGXA 1ZNXA 1ZYUA 3K9GA 4TMXA 4ZIRB 1NLFA 5G53C 4NP6A 3AQ4A 1EWQA 2WWWA 3GLHE 1OJLA 1UJ2A 5AUOB 2CJWA 2ROWA 4WA7A 1DPFA 1ZM2A
chains in the Genus database with same CATH superfamily
1E1YA 2O8DA 5H70A 1V1HA 4JYBA 1GL7A 3ESCA 5EIXA 3O4GA 1H8HD 2B3DA 2P0EA 4OQ4A 1DC8A 4W9MC 1Z5VA 4WMLA 4BN5A 5I9NA 1CSOI 5EINA 1JHAA 2WA1A 3QELA 5E9JA 2V8BA 3GLVA 2JZOA 3G2NA 4RDIA 3TNDA 2FMIA 1YRLA 1VHJA 2FKAA 2FN9A 2Y1LA 4KLRA 4V24A 3B5JA 3PENA 4G26A 4LSMA 3NC0C 1EJBA 4H7KA 4MYUA 4BBJA 4RGYA 5HIAA 1SOUA 1AX9A 4Y2QA 3E81A 2D0DA 1FRVA 1N1GA 1YJXA 2H2FA 2R1UA 3BAZA 3IBYA 4X8HA 2R6R1 4YEDA 2CCGA 1R8YA 1Z18A 3RSZA 3SEFA 4RMGA 4DJAA 2PIAA 4YCAA 2OORA 1E4YA 3QHQA 2PWZA 3FYCA 5JT1A 2J9FB 3K6JA 4F8JA 1VMDA 4M6WA 3R5AA 3CLKA 3NCHA 4CM8A 3O8NA 4K87A 2YQPA 1ZIPA 2AK3A 3N2LA 1F5NA 4L4SA 3V7FA 1L4BA 5FCDA 1GSIA 5CB6A 5DW3A 2GBFA 1EM8A 5AIBA 3M89A 3DUFB 4HR7A 1ZJWA 3L0YA 4K0KB 1KMAA 4ZU6X 1CR0A 1ZL0A 3TQOA 2B5WA 1Y8CA 5HG0A 2BONA 4KQXA 4TZ6A 3TYXA 1Z7GA 4CLHA 3DBVO 1RTTA 1YOVB 4ARBA 1MBZA 3M6WA 3PQCA 3K0BA 3A6LA 4PHGA 5DI3A 3HU2A 3PQEA 3VBEA 1H22A 4C7VA 4GDMA 2FSHA 4WDQA 3OOJA 3RBXA 3RYHA 3GGOA 1B16A 2X2PA 4MAFA 3WQSB 3M6FA 1YQ9A 2VRWB 3R23A 1QQ6A 3LO5A 4CMCA 2BGGA 3TD9A 1DQNA 4MZDA 4Q9NA 1DFGA 2CHVA 2HN9A 4PVCA 1SHLA 3FCOA 1OVMA 3OLVA 4AJHA 1KVTA 1Y1PA 1FFXB 3HBLA 2CZQA 3NHUA 5AKLA 5ALMA 3ANSA 3T8YA 4E6EA 1CJBA 3ED1A 2HIGA 4GBJA 1Z63A 1JU3A 1OTYA 4IGKA 3AYXB 1MJ9A 1BA3A 2XNDA 3SIPA 2XKKA 3HN7A 4BRWA 4Q3EA 2YOHA 3G8DA 2WWRA 1PJUA 1MFPA 1VIMA 3PXDA 2ZPTX 4DCCA 4BO5A 1KAEA 1TX4B 1CRQA 1GGNA 1WDLA 2EGGA 5DWVA 1YZVA 4HYQA 1MU0A 1QP0A 1YV9A 4RHCA 2C3OA 1XMOB 2NU7A 4Z4GA 3EASA 2Q9AA 2VYND 1FUEA 2NYVA 3ZZUA 3AUXA 3G2KA 1FL9A 4EG8A 4NXNB 1HF3A 2PR7A 4LC1A 3VKVA 1N3IA 3HZHA 3AHJA 2ZT8A 5TQJA 3IURA 2ZR9A 1KEZA 1U0GA 2QI9C 4KZKA 5HP4A 1UKZA 1R0ZA 3H5TA 2F3QA 3MGKA 4HUTA 1P8AA 3LUBA 3ZWPA 3DXZA 3OPQA 2WHRA 3LUGA 3G1WA 5KTOA 2DBQA 2O8NA 2IELA 1GGKA 3N3BC 2HRBA 1QX3A 1CUSA 3GVIA 4ITUA 3JQRA 4DIKA 3WYCA 4GOLD 4FYPA 2X5XA 1G9TA 4MQMA 4TV9F 4EK9A 3PJRA 3ZV5A 4J2TA 2PLFA 2QM3A 2Y27A 3CW8X 1RJ9A 3T5MA 2QTMA 1QO0A 3LTNC 1IONA 1N3LA 3PRKE 2N9UA 2PZKA 2BKVA 5BWMA 1AUXA 4CPDA 5A5EA 1XPJA 1XXHE 2PU5A 2BH9A 2A57A 2R4UA 2V3WA 2XMGA 2ZSAA 3PRYA 1K5HA 1K63A 2IDZA 3NIWA 4XQ9A 3RK4A 3RNOA 3VDMA 4B87A 5K09A 1RWOA 4YRDA 4LJYA 4AZTA 2Q1YA 5HZKA 4H3KB 1TAQA 2VYQA 4Q0MA 3TQHA 2DPXA 5BN3B 1G63A 3HWX1 3WKCA 3P1JA 5F64A 4NYIQ 1VIYA 4CNBA 1MO4A 2O23A 2ZJOA 3AV3A 2WU4A 3O4VA 5FULA 4FDMA 2WJWA 5FQOA 1VIAA 2M98A 4KO3S 3ICCA 4GOOD 4RPIA 4BATA 4AD8A 1G8YA 1TZMA 3F8SA 4TL7A 1T36A 2CHQA 5H68A 4NYIR 1A4XA 2WJJA 1UKYA 1B7GO 2CW5A 1XRRA 1DBIA 1D2AA 2B0UC 1JUDA 1RHJA 2WV9A 3QE2A 4DLVA 4MVJA 3WJAA 6AT1A 3UOWA 1N9ZA 1P6XA 4X66B 3UFXA 1TF2A 5JTTA 3L4JA 4HSEA 1S0UA 4ICIA 4EMSA 3N39C 5CVUA 4AJEA 4C7BA 3V55A 1H1LA 1PCXA 2Q41A 4UMFA 4IH9A 4BJ6A 3CR3C 5I3CA 1E61A 2MSLA 4ERXA 5JNLA 4KR3A 2FPWA 4D3DA 2I2DA 4ED9A 2H0AA 2SICE 2WUVA 4ZAYA 3UOAB 2R87A 1ZN7A 3CXRA 1CJUC 2GB4A 4PGAA 2QW1A 2J4FA 1IQ0A 2CSXA 1KDPA 3W5IA 5JATA 5EJGA 1PR6A 1CXZA 1PZFA 1Q95A 3HRHA 3VE5A 3JS5A 1C7ZA 4IGIA 2KBFA 3QE4A 2CB0A 1PVVA 3ISJA 4L5JA 1PR3A 2HA2A 4S1OA 5FX2A 2WWHA 3QNUA 4MW5A 1T9GS 3ZE0B 3UWOA 5JASA 3JRXA 3FNEA 3OFNA 4CIWA 4JQZA 2FFJA 1P0QA 1TQDA 5F52A 4BNGA 2GK4A 2O2GA 5HKKD 1SUWA 1VLLA 1WV1A 2GBLC 2OAQ1 3PQ2A 4CT4B 4BC0A 4WZAE 1KEEB 1Q2XA 4WD3A 3M2PA 1FVFA 1Y7HA 4EZIA 1I2AA 5C8YF 5AP9A 2B69A 1OFUA 4MDYA 1EVYA 2AN9A 2NVUB 4QXQA 1EI9A 3LXUX 4IJKA 3VU3A 1PX2A 4BMSA 3EVFA 4E5NA 3A6PC 2KMPA 2ZIUB 4M76B 3KOWA 4AQDA 2G0TA 2HNAA 1VJ5A 3ZHQA 1EG7A 2KMRA 4HUQB 1Z7YA 5JCZA 5KTRA 2ZUWA 1XMQB 1KMCA 1FFWA 1Y7LA 2JGKA 3HO8A 1FDIA 1PW7A 3T41A 3VR4H 5KNLA 1YVPA 3AERA 3WBBA 3R20A 3LP5A 2J8ZA 3DL0A 2PQ2A 3OHSX 4FU0A 2WY2D 3U3XA 4YLYA 1LD3A 4I4LA 3HE3A 4PFSA 4EHBA 3Q5EA 2UV8A 3FRIA 2EHJA 3QU9A 2DQKA 3AHDA 2ZKLA 2XSZD 2XB2A 1RYHA 2J09A 2HF2A 3IAUA 3HMQA 4XM2A 1DG9A 2R44A 2XYHA 1UVGA 1Z0FA 1W30A 2FH5B 4XVQA 3F9RA 3MRVA 4E5UA 5JXGA 3WP1B 4IUBS 1XAGA 4BE4A 5E6SA 3D6MA 4KQHA 2LIVA 4J3JA 1BNCA 1E8NA 2G8NA 4PYIA 2IGTA 2FRXA 3ZXXA 1VM6A 4IEFB 1Q0ZA 4NCBA 1S96A 5IH3A 1B15A 4TYNA 3GWZA 4QGSA 2BEUB 1E2MA 2ZSJA 2DBRA 2Z2YA 5HFJA 3DLCA 1ZXLA 3QBVA 1OTHA 5EWMB 1P1KA 1U0LA 1WPQA 1SKYB 4TXNA 1NVMB 3O26A 4EA9A 1GGHA 4RNCA 4PG8A 4OJKA 2Q3MA 3RSQA 1CF4A 2GLXA 4JB8A 2Z4SA 4E2XA 4AVYA 3O84A 3SK0A 1JXOA 3JPWA 5JJBA 4C30A 1Z6PA 4KVGA 4KUEA 4IRUB 2CNWA 3SD7A 5I3ZA 1CERA 4NXMB 1K8RA 2LDXA 4QG7A 2CMHA 1I1OA 4N0EA 2E4ZA 1TC1A 2PPLA 2R6CA 4PONA 4FHZA 1HZJA 3CLVA 3SJUA 2ZZNA 2YV5A 5BNZA 2G5TA 4RE5A 2ODEA 3TZKA 1DSSG 4GWGA 3R09A 5DE3A 3K8ZA 5FPKA 1CEQA 4M53A 3RHSA 3MBIA 4JLMA 2BFCB 3AHIA 3SGQI 4Y6RA 4FT4A 1ZDMA 2OPBA 1LVUA 1PTJC 3E9ZA 4EJMA 4OP2A 1D0SA 2RHRA 1RZRD 1A8SA 4K9OA 1Z15A 4M1MA 4URZR 1FP6A 4EKGA 3MWDA 3R7NA 3LRPA 4DMUB 3UXYA 2AX3A 4MV4A 1BROA 4GPD1 1Y8QB 4R7TA 3IBCA 1UUCA 3OETA 4G3XA 4X8MA 4EY3A 1PL0A 3C1TA 1BTOA 2H4HA 4DV2B 1QPZA 2GKVA 3UJCA 1NXWA 1I14A 2CDRA 4XGIA 1QG2A 4DEXA 1AXEA 4XCVA 5JU6A 1XTZA 3B1XA 2P7IA 3PJDA 3ROZA 4OL9A 1NQOA 5K0ZA 1LH0A 4DJJA 3T3OA 3IC5A 2ZUDA 3BM5A 2CVFA 3RG2A 4MW2A 2CFCA 2UVDA 3OIVA 4BTLA 1S5PA 2I8CA 2UYYA 4IX1A 4DSZA 2IHNA 4JBXA 3B6KA 3KT6A 2IF0A 1FS5A 1P8JA 3WV4A 2PO7A 3D64A 3FWHA 2PRYA 4MUHA 4RHYA 4BRUA 4EF5A 2ZWOA 2QUZA 4M7WA 3KC2A 5EXEA 5AVSA 5IJZA 1QNLA 2P41A 4QTUB 5HM6A 1WE2A 1Q1EA 4IJ5A 3CBGA 4TZTA 4HI0E 3I6IA 2O0JA 5DOZA 5EFOA 1DBQA 3RJ9A 4NBVA 3C5VA 3WOHA 1R18A 2I6SA 3HUEA 4HBGA 2NAPA 3G7UA 1QGUB 3WHIA 2N1MA 1XRLA 1VKRA 2OE2A 5CTAA 3VKHA 2P5SA 3V3TA 3R9IA 3RIXA 3ZTYA 2XJ4A 4DLSA 5G02A 3JQGA 4BJHB 4HLUC 1M9NA 3EA0A 3PGVA 1U8UA 4NOLA 5BWCA 3ZQKA 3Q7SA 3U39A 3L8HA 3I6YA 1YMQA 4RVGA 4UBMA 4X90A 5CVDA 5CA0A 2FDRA 2L2QA 1GR1A 2OHVA 3BERA 3MOIA 2I4RA 4O2AF 4MCAA 3ZX4A 3PUWA 5FADA 4YFVA 3R3ZA 4G09A 3GPLA 4IGEA 2XKBA 1HDEA 3H11B 4ZDJA 3K6SA 1LU9A 3RABA 2GD1O 4ZHQA 3IPAA 3MF4A 3PR2B 2WAMA 3EWNA 1JHVA 2IP2A 4QYIB 2JD1A 4R41A 1KSGA 4FW9A 1PQYA 4R3NA 1JR2A 1JH9A 2Z6QA 1ZM4A 3M6VA 3THWA 5JG7A 1COWA 3FUCA 5FO0A 1NRIA 1ZP6A 4O2RA 1HDZA 2Q4RA 3ZBTA 1TM7E 2EX1A 1MC8A 3GN2A 3WIBA 2W5UA 3MTQA 3EZ9A 3AKCA 2ZT5A 2J7KA 1ZMTA 2G63A 2QRQA 3C4VA 3G2PA 1M10A 1NP6A 1AUPA 2FW8A 3DZ8A 3L6DA 3ZHSA 1P1CA 3A2LA 5IUJC 1DEKA 4UAGA 2WYUA 2KHZA 3EZ7A 2PYZA 5FV7A 1FZQA 3DOIA 3TOVA 3QWFA 4EFMA 1CCWA 4WK2B 3AWIA 2YWXA 4HH0A 1XCPA 3OMXA 1N2JA 1WHSA 1T0JB 4BP9A 3H75A 3WB0A 4FJ1A 4CMEC 5DRTA 1I94B 2Z5GA 3OJLA 5I7UA 2QGFA 1Q19A 2SCUA 3NAMA 4Y7DA 4C6HA 3KJIA 2C9OA 1L5FA 5LBTA 3A7EA 3EA5A 3F46A 2IITA 4ALIA 5LR6A 2FE4A 4AY6A 1O95C 2QL6A 3DHYA 4MWBA 5C53B 1A27A 4RBNA 3NKLA 2AI1A 4J76A 5KHAA 1LBTA 3UHPA 1YDWA 4RM3A 4BMNA 1XF1A 3R40A 2DY1A 4KXWA 2I7VA 2NO1A 1NXQA 2FJPA 2Q9BA 5ILOA 4XVCA 4E5YA 2EX0A 2ZUCA 2WHPB 1RPJA 2JH3A 3IMKA 3A1FA 1SN7A 3NHZA 5D3QA 3GFQA 4Y1EA 1JDUA 5EMMA 3GP8A 1JI3A 1GU1A 1O4VA 1PFYA 1WB4A 2XWJI 3VSCA 4X64B 4P92A 3JWGA 2F8TA 3A1CA 3IEUA 5T67A 4O02B 4UHCA 4MGIR 4W5JA 4PR0A 2RGRA 3X44A 2J85A 3OXLA 4OKIA 1QWSA 3AU9A 3TR5A 3ER6A 2Y2VA 3UMYA 2CT8A 1EQAA 3EGVA 3LLCA 5I7EA 4MYSA 2XT9A 1NBMD 1S8NA 1TC2A 4EATA 2E7ZA 3A37A 2FDXA 4FWTA 2Q4DA 4C7XA 3I23A 3F67A 4J0QA 2AEEA 3TIIA 2QPTA 1T9CA 1WDWB 3T52A 1JVNA 4BMXA 4GNKA 5BSGA 3NTUA 1V1MB 4R8RA 1JF8A 5E7QA 3M34A 2PT9A 4JDPA 3R76A 2X5NA 4V0OA 5J59A 1CLEA 3DM5A 1QGAA 1R8QA 4UM9B 1RJWA 1KZ6A 1GL9B 1TMKA 1V9CA 2Q62A 2FSUA 4MUMA 2GRAA 3SPXA 2WD9A 2SKCA 5ADVA 1PUJA 3MBOA 1YR2A 2O2XA 3IQDB 2CWHA 3ZBUA 5JRZA 3ZY3A 2XNJA 1PAUA 8ADHA 4FOTA 3VDRA 1TTPB 4AN4A 3A1NA 4C0BA 2AUTA 4CEHB 2EOAA 4M38A 1JDBC 2ODPA 4MS4B 5JHHB 2DB6A 1V3VA 2O1SA 1DOHA 1GZHB 4K6CA 1RBYA 4ZAVA 4MMZB 1G20E 4DEYA 1WLSA 1AMUA 1Y7TA 2WWFA 3I64A 1I6WA 2PZFA 1Z6ZA 2LTAA 2O2SA 1LBHA 2PL1A 3K1ZA 4D8XA 3L92A 2ZUSA 2D54A 3CZRA 3SLGA 5BVGA 2YZGA 5ANRB 2NUTA 1FBTA 2Q29A 2B1IA 2ATVA 2ATEA 1KFEB 3K5WA 1QH0A 1LWNA 3WLIA 1TW3A 3Q85A 4QODA 4UUQA 3ZDQA 4EB3A 3ABOB 4IZHA 1LLCA 2WT8A 1TRKA 1S89A 1V3TA 4RTMA 2Q5CA 4MO2A 5AO9A 5HKAA 2JYYA 3THSA 1XJ5A 4Y98A 5JSHA 2V96A 3KT8A 2ID9A 3IJRA 1FDWA 1GJRA 1FMLA 4UZSA 5FJJA 3QX9A 1DTWA 1M8FA 5JSZB 1DBVO 2VZ9A 5CYGA 1E3TA 1DEXA 4QHYA 3V00A 5BV7A 1V71A 2YXLA 2Q45A 1KKMA 1O0SA 1SXGA 3JY6A 4TQ9A 1EE2A 4WLOA 1W85B 1Z2NX 3T4XA 3ZCXA 3HBJA 4GD3Q 4M1YA 1P5ZB 2B78A 2BV3A 3USCS 4BNJA 2FUG6 4IVRA 5EP3A 3URKA 1X7GA 1N5RA 5H1YA 3U80A 1F7VA 4KK3A 3PXCX 3ICOA 4MTCA 1YJCA 4QFBA 2V6IA 1BXRA 2VDQB 3OJCA 3ZJVA 4JSRA 2DKOA 2WJZB 4IG4A 5FPPA 5J2UB 4ZV9A 1OFIA 4W1QA 3RVKA 3WRWA 5GIPE 3JATA 4RTRA 4NCJA 3O3MB 3KELA 2F1RA 3L1VA 3OMWA 1ZN2A 3I01M 4YRQA 5AUQA 2X22A 4D56A 4E15A 3BS4A 1SK9A 2HOQA 1KMMA 2P4EA 1WUHS 2PSDA 3QVLA 4M88A 1Z8NA 2IHKA 4WJLA 1J2EA 3C3BA 3OLWA 4LHSA 2IYAA 2OV4A 1FNNA 4KO2S 3PD1A 4JJIA 5HJ5A 2P6RA 4LFAB 1SQ0A 3IPRA 2J9XB 1I7QB 3QUSA 3A2NA 5F5LA 4B6SA 1ISSA 2VP9A 1SGDI 3RVLA 4BPRA 1CSEE 1N2ZA 5LZ9A 3AI7A 2R47A 2IDJA 1Y9ZA 3S8YA 4BMZA 1FDSA 5FI0B 1HETA 4QXOA 1HNWB 5JH7A 3N2EA 4J1NA 3G2MA 4J3FA 3LUFA 4D9MA 2XUAA 3F6YA 1GY8A 3OI7A 3TFQA 1E4EB 2HBQA 1SGEI 1SFRA 2D8MA 2A5LA 4EG6A 2BT4A 5DTMA 2WMYA 1L7XA 1NYQA 2XE4A 3VPFA 3CPJB 1GXSB 2YVLA 3JZDA 3TD2A 2G08A 4F7DA 1L7RA 3KK0A 5CXXA 4KX3A 5AOBA 2DT8A 5G4KA 3AF4A 2BDEA 4WE3A 2PMFA 4P5EA 4CF5A 4Y2PA 2BTQA 1Y1RA 1KPHA 2RAPA 4J0IA 2XQKA 3DZBA 3HXPA 3NNNA 1V8PA 4AI6A 3LRXA 4RIHA 2Q5HA 1L5QA 1KKLA 4HEQA 3F3KA 3OQPA 3M6MD 5LYYA 2BMJA 3FOZA 2XKAA 4QLOA 1A2QA 3OJXA 1I5OA 1DUIA 4DCJA 4CV2A 3R5XA 3SFTA 3P9SA 3TJZA 1ABBA 3P9YA 4CDMA 1YZKA 1PNOA 2QM7A 4UBLA 1DU4A 2KX7A 3WGJA 2PNFA 4LNHA 1PVDA 1TECE 3HVKA 1HTWA 1Z25A 3QENA 5AKGA 2VXOA 3B36A 2GZRA 4MVWA 3P0FA 1QF7A 3Q8XB 2ZBGA 2BJVA 3HZZA 3O9ZA 4NOJA 4F12A 3RS3A 3USES 1PHRA 2FZVA 2RC6A 3VPAA 4AF7A 4LDPA 4QOFA 2V6GA 1PT8A 1W4AA 2OV6A 4DBLC 2DPHA 1C8KA 3ZK7A 3L82B 5CXQA 5H8WA 3W6NA 3PUJA 2X7JA 3WSVA 3TECE 3RW9A 2P90A 3FOWA 3GO4A 3GZNA 4JP1A 4A0SA 2ILVA 3MJRA 2LR0A 4E4RA 4I4IA 3KQNA 4P4SB 3FF1A 1P7CA 2G9NA 3DAFA 4M37A 2IHBA 1TU4A 3DPIA 1SCQA 4G97A 2G9QA 4I1SA 4NP6A 1AZSC 3L43A 1GZ6A 4PG6A 3TVYA 4EHKA 4L7VA 5HKOA 4DQUA 1UBOS 3BCSA 3V7WA 4BZWA 1CUYA 1H1TA 1CE3A 5JDIA 2H0RA 1M73E 1EVIA 2JGEA 5A5VA 4KAAA 3ZE8A 2ZTLA 1QIGA 2MWMA 4GZLA 2I4MA 3CRZA 3TTVA 1JHXA 1DIRA 4KO8A 4Y2VA 2EQBA 3FWYA 3TQSA 1MOZA 4YRKA 3KJZA 1FVOA 4MVJI 2BUCA 2A0UA 3R5JA 1N7HA 1PL8A 3GEEA 3L0OA 3AJEA 4I1VA 1W0JD 4WWHA 1SB9A 3K9QO 5DN6A 4BLQA 5K6RA 1RPTA 2FWBA 4OI0A 1NVWQ 3CLUC 2PBRA 3IAXA 1FW8A 2OQRA 1K8XB 4D8VA 5C1BA 4LFCB 2WI8A 2I29A 1G8JA 1LA2A 2J9FA 3CLRD 4GUAA 1SD1A 3PXGA 2FWIA 4UFNA 1OOEA 4WKNA 3T7IA 5CLIA 1JEDA 1LZKA 3UMRA 4BNTA 4EFDA 1E5TA 2GAOA 2Y68A 2EG9A 1TEZA 3HZOA 2Q1UA 2VXBA 1UJNA 3C5CA 2H9AA 4CKCA 1O94A 4QQFA 3E59A 1X2BA 3BF7A 3EPRA 3O1HB 3A6JA 3BHJA 2GTPA 2IXGA 1IOLA 3FYDA 5MN6A 3U3RA 2VG8A 1QGDA 2QAGC 1M2OB 3QG5A 4AUMA 5GADl 1VHQA 1MG5A 1MHPA 3DBRB 1DMSA 3H0KA 4Q24A 2PANA 2DOKA 3ZDZB 1YOVA 2HJWA 2P4SA 3E7DA 1U0FA 3TPZA 1XNJA 1JPJA 3UT6A 2QN9A 4RXMA 1GUDA 1GPDG 2XMQA 2QLLA 3FETA 5HBRA 1S4MA 3O38A 3THOA 3RAFC 4RFSB 2C8VA 1TBNA 3C3KA 1JX6A 2YMPA 2ZR7A 1SXIA 2X4DA 4OMCA 2GN8A 2Q3EA 4JP5A 2VH5R 2FRVA 3HCCA 6Q21A 3GLGE 1L1QA 2X13A 3A32A 3AHFA 3AOEA 4N5IX 1AG9A 2WBLC 3P97A 3OQOA 2BE9A 3FFWA 4JHLA 5FPHA 4RJTA 3BD7A 3IOMA 1IY0A 1XXHA 2WF5A 3CKKA 5T57A 3ZTWA 4ARAA 5CH5A 4OHMA 4EYEA 1MABB 2QG6A 1BVUA 4KXXA 3W04A 1L4LA 1CC1S 2HJHA 4BNIA 1FFXA 1THGA 1UJMA 2W8ZA 3RYFB 1TAGA 2H08A 2HWYA 2XZTA 2BGUA 2WT4A 1OKKD 2YUTA 1JH8A 3CKLA 3MPOA 3TIVA 1U2TA 2OR3A 2PL5A 3ITEA 1HE3A 1S3SA 1YXMA 1N9GA 4GNRA 1NR5A 3V7UA 4QOHA 4A8TA 1QTQA 5DXAA 1PJ2A 1WKCA 3K0HA 3K9CA 4N6OA 3WNBA 1CJCA 5CBPA 5HZMA 3DD5A 4I1IA 5A4AA 1K1EA 1KFBB 2FUKA 4JB3A 3HB1A 4IRMA 5I7FA 3B13B 3AK4A 1F2DA 2QVXX 4QGFA 5E8RA 1IAVA 3QQ5A 4OHVA 1T5BA 3L05A 1JDNA 4IVQA 1FFCA 1M8BA 2VHEA 1WBJB 3HK2A 3L7OA 3SR3A 5KSOA 1KWGA 4CLXA 1WW3A 3BXZA 1N13A 2IRWA 2QUBA 2WF6A 3DLIA 4WLVA 1XVVA 1G66A 1Z62A 1V48A 1L3CA 1KI8A 2C83A 3CNQS 3DLTA 3FKSD 4UKDA 3TI7A 4DRYA 4GAEA 4BO4A 3N8IA 1H5QA 3O83A 4F6LA 2ZULA 1ZOPA 2IYEA 3FPGA 1C3VA 1DAGA 2PUTA 4HB2A 2AN5A 2FA9A 5ALTA 4N7RA 5FUVA 1ISGA 3CIOA 4LTMA 3T9EA 2Q3CA 1YQEA 2H1RA 3I6ZA 3LQ4A 3PNPA 2YHBA 3UT5B 4PX3A 3O2JA 4ZRDA 5IEBA 4ZVOA 5IT5A 2RDMA 1X92A 1EK2A 5HRUA 1VG9B 1AQ6A 1Z0UA 1OCEA 2XLCA 2FUNB 3QX7A 4INAA 4UW9A 3R8XA 3E48A 3ER8A 2QQEA 2Q6IA 4FOPA 1PDWA 3WB2A 5GTDA 1JJ7A 3KUCA 4RYLA 4RQTA 5DNCA 1P0CA 1EB8A 2G4CA 2POCA 4TV9A 1Q2UA 4CMAA 1I0LA 1ULBA 2WWTA 4LW8A 4MIYA 1H6AA 2IYLD 1LR7A 3PGJA 4RA9B 2C3YA 4WZAA 1XZJA 3FOCA 4YWHA 2IHVA 3JD3A 3VH2A 4HVCA 3O73A 2GM9A 2QNBA 3HO6A 4KYTA 3RUPA 5I8PA 1XTRA 2G06A 1ZSYA 2IPXA 1RLIA 1X80A 2W43A 3O47A 3WK7A 2QLTA 3CZAA 4OSPA 4JGIA 1XZDA 3UHOA 4S2UA 4F6RB 3V1TC 1ZK1A 2ZBRA 2V7QA 5CW1A 1N7IA 1SUFA 4E2YA 5HUQA 5HYVA 2D1FA 4BZPA 1R15A 1N6NA 1AUOA 4ILKA 5JCJD 3PQFA 1EX1A 5BN5B 1NVDA 1WU8A 3V8RA 3NDRA 4ZKEA 1XYYA 3JD0A 4YXWD 1Q0UA 1GVHA 2Z43A 3I3OA 1ZA1A 3O5AA 1F8UA 3RVRA 3BYZA 1C4XA 4D3YA 2XCRB 1Z13A 3I0ZA 1WPXA 2Y4OA 3CU5A 4RHXA 3ZWDA 4FMDF 4BNLA 1YCDA 3QWIA 3QPUA 9ATCA 2Q4EA 5FPYA 3M3PA 1X8XA 4G5RA 1SCDA 2W00A 4MR9B 2ZIFA 2PUBA 4FHEA 1HLDA 1B8NA 4JT4A 3OT1B 2ANBA 1QRTA 2F3UA 4GXNA 4EHJA 1AU9A 5I4IA 5LMZA 3VZCA 5MGBA 2O59A 4HMOA 4JXZA 3WQQA 3EXHB 3RTDA 4LE0A 2WIKA 3TO9A 4QAQA 3WJ7A 2HGZA 2E9SA 2EFEB 2GA9A 2EQAA 4MPPA 1RYDA 3SXPA 3WLSA 3F47A 5EE3A 2BL4A 2VWQA 3I9KA 5TQ2B 5CFNA 3EGCA 2H7XA 4FFWA 3EUFA 3EISA 2J7PA 3KE8A 1OXSC 5DM0A 5KX5F 5DX1A 4UU0A 1XO1A 1NZJA 1RU3A 4MCIA 1KEEA 1FS6A 2XNSA 2BKEA 4RD3A 3RQSA 1P29A 1VP3A 5GP1A 2G6BA 2GI4A 3R2JA 4G0XA 4HAOA 3KQPA 2A9KA 5B1IA 5TE9A 3VMMA 4BNZA 3ODPA 1APBA 2OENG 2NVUA 4MUGA 3C97A 3PC4A 4R6WA 4X7BA 2BYTA 5BOSA 1UC5B 2ZJ6A 2JFZA 1JYFA 4MRVA 3LUCA 1NE2A 1AQLA 3FSJX 1X1RA 4G24A 521PA 2I1LA 1GQRA 3KWMA 3OSUA 2APJA 5MHTA 1EK5A 4JA0A 2FPIA 3G0IA 1KC3A 4MPTA 3H1EA 4L85A 1RAAA 4N5LA 3QA3E 4KSYA 4AAYA 3IT0A 4F4IA 4ZZIA 5CEEA 2W98A 3ETEA 4OXXA 1QBKC 2P9TA 2WSSA 1YHZA 2ZXEA 4E5PA 1FOEB 1SC3A 2VT3A 3WADA 5DRYA 3NETA 4PAMA 4KQWA 1F38A 4AROA 2F8SA 3ZZ1A 2UXCB 1EJ6A 5E9QA 4G0ZA 2W6OA 2YBDA 3W2HA 5BSUA 1G0NA 4K9NA 3HA2A 4RVUA 2O48X 1EIZA 1W87A 1J2JA 4HX5A 3ZXSA 3BL8A 3KB1A 1JP7A 2NXJA 4CFYA 4HQRA 4O63O 3PQ3A 3UWPA 3QEAZ 3TCKA 1E3JA 1I24A 2W6JD 3ZBPA 5EWLB 2RIRA 3LDFA 2POQX 5G0TA 1P3DA 2A1UA 2BEUA 1RNLA 1TB4A 2D6FA 5DK6A 3QLVA 2QS9A 3F6SA 3L18A 4RSHA 5M29A 1QGZA 3ONNA 2RE8A 2EFHB 1KE2A 4X91A 1NBAA 2C97A 5EWMA 1T0HB 1JHDA 5BUQA 2G1AA 1Q7GA 1XCBA 1GPAA 1UFQA 2O3JA 3M8KA 5ALJA 1SEPA 2FEPA 2YHIA 1SU4A 3AWDA 3F6BX 3L9XA 5DM60 5KQGA 2FZCA 2DBYA 1Z4KA 4WFQA 2JATA 1EFVA 2HCJB 3FTCA 3FYHA 4YQEA 1PJ3A 2ZROA 4JL8A 3WB1A 3ZHCA 5C81A 1Z5OA 2Z8YA 3JQ6A 3IA7A 4GGPA 3NU1A 2HA3A 2EZ8A 4U2BA 4QSHA 3U13A 5CB4B 2A0XA 3BDIA 4HB4A 3A4IA 4XJXA 3KT0A 1U7PA 4J90A 4JDUA 2CV1A 3IUSA 5AXBA 1N2IA 4PLFA 3MUFA 2YJZA 2YW2A 2YFQA 3HFGA 2YYAA 5T4HA 4CL0A 4TVSA 5IBQA 4UDNA 4MS3B 4KMOA 2QG9A 3A58B 3GOQA 3DR5A 3RV4A 5K0BA 2I91A 2BP7A 3J81A 1MAVA 2BFCA 1G8AA 3GCWA 3EW9A 4DQDA 1O95D 4ZXFA 3JQFC 5J5AA 3HWWA 3CG0A 1NQTA 4TTQA 5M04A 1WUKS 3BWMA 3K9WA 2IUFA 1LBIA 1IBMB 1V95A 4PZCA 4G1UC 1IPFA 3SC2A 3EWSA 2OP1A 4W8GA 5AQ1A 2H54A 3NV9A 5TJHA 2WHYA 4PPFA 5D85A 4W5HA 1BS2A 5KWEA 1S8AA 4IQ4A 3OY2A 4LRYA 4EB6A 1DFIA 1UCFA 2BBSA 4KI0A 3IESA 3ABRB 4H0NA 1IOVA 1LI5A 3D2AA 5FUBA 1C9JA 4LSWA 2QROA 4AKEA 3KQVA 3L8YA 5U4XA 4EG0A 5D6OA 5JFTA 3EFOA 4MAAA 1HNZB 1WCIA 2YXNA 4JY7A 1HEVA 1QRAA 1R1DA 1Z5GA 2ENWA 3CX6A 1UPFA 2ATXA 1WMBA 4I9FA 4UVIA 3GDHA 4LISA 4PYNA 5BSMA 4AP9A 1UH5A 2FLVA 2QLBA 4IZOA 4OHXA 4Q4HB 5GOTA 3W6OA 5A2GA 2GR9A 3GD5A 4JYCA 3S40A 2QRKA 2VCYA 1UZUA 1XXLA 1E79D 3HWSA 5HQ8A 4BQFA 4TQUS 6REQA 3FOEC 3IV7A 2L8EA 1TK2A 4EQZA 2YDXA 1F5SA 3OE7D 1E94E 4PTYA 4PYOA 4KE8A 2PY6A 3PJFA 3RBZA 1ZM7A 1ES9A 1TO1E 4GLOA 2GD0A 4L9AA 1SVOA 4HADA 5KTKA 2CL7X 1ZU4A 2EQ5A 3UBTA 1IPHA 2B9EA 2RGYA 3IUQA 4D9IA 2QV0A 2EP8A 1ZNQO 2NZJA 1DTEA 1BYIA 2V58A 5AI9A 3CF2A 1KDZA 1CR1A 1AMOA 3GJYA 1RC0A 3JU3A 4R3WA 1D7OA 4MKGA 4H31A 1TVEA 1C30B 2OSVA 1PSWA 3FUXA 4EL0A 4R1PA 4CG3A 1Y8FA 5ICEA 2H17A 4L4UA 4NS4A 3ZU3A 1AHIA 1T1GA 3QTBA 1JHUA 2ZIEA 1H8ED 1LPPA 1FUYB 1X1SA 3IUMA 4EJ0A 5ITVA 4Y2YA 4RVNA 4A6DA 1EUZA 3HHPA 4RKYA 3IXLA 4KXQA 1G17A 3TPCA 3W2TA 1UBKS 3ASZA 2ZPUA 1ZH6A 2A1TS 2P2YA 1ZGJA 3IE2A 1YFJA 1ZK4A 1PX0A 1KNXA 1ZM9A 1U3FA 4BGEA 3BKXA 5FUMA 1RQGA 4G63A 2RD2A 5U1PA 5LYJF 1JFVA 1MGOA 2IIQA 1I6KA 3ELDA 4O2AA 2QR2A 1CUHA 3ANNA 4S3MA 2X6RA 4DIBA 5AKHA 2PXAA 1QVZA 3HP4A 2YR0A 4XYLA 2WU1A 3MAAC 4DVJA 4Z1MD 4ZN6A 4TYYA 3M9XA 3TLGB 5IVPA 3C8MA 1AQIA 1PEKE 4D9NA 5L9AA 1G5HA 4NENB 4B8YA 1ZJ4A 3PUYA 3Q6NA 4WY2A 4POAA 4RVSA 4EH1A 1SXJD 4OUDB 3FAZA 3SKYA 6CHYA 7ADHA 1GILA 1GV1A 1O6CA 1TKAA 2JGJA 4C5BA 4QAJA 4PYMA 4X1YB 2VTBB 1SD5A 3KEFA 2QLMA 3OQ1A 4LOKA 1HXHA 4M8SA 1Y1BA 4WACA 4C07A 4DHWA 3P0EA 4O25A 5JZOA 1C1XB 3PGLA 3KSDO 3KYIB 4BNDB 9MHTA 3CEPB 3O2SB 5GV7A 1WD7A 4JI7B 3HFRA 1KF0A 4KCGA 5JWHA 3FPCA 4NATA 1ULHA 3ASUA 3LWZA 2PMEA 4RYDA 4DDKA 4BGVA 2VT6A 3IJEB 4G4GA 3HDQA 1SU7A 2ZJ8A 1IZ9A 1HEUA 2H1HA 4LYAA 4OHUA 1ZWKA 5EGNA 3T9FA 2W2TA 3PD0A 5F77A 4YRIA 3H2HA 1SUBA 3W7AA 3ZJYA 2JFXA 1K7FB 1V4VA 1QBGA 3IOYA 2YN2A 2W2NA 4BGDA 3JWHA 2CMGA 3B2QA 1D5CA 2XVAA 3ETNA 3BXFA 1X6VA 2PDAA 2CEKA 3H4TA 2P75A 4MMYB 4Y8VA 4UBJA 3FPHA 5K4GA 1P2BA 3FLBA 1O08A 4TSKA 5LQCA 4LJ8A 1AT1A 5IC6A 2JEYA 1J0AA 2QTCA 1SMKA 2R7AA 5K4HA 1RI4A 2JJ8A 2HEGA 3L7BA 2JGDB 4O4JA 3G3EA 5JTUA 3Q8KA 2ZRFA 2L7XA 5LQJA 2NO6A 1FP1D 4ITVA 4BJ5A 1QRUA 4I2VA 1KJ9A 2CCKA 2ECOA 2V97A 1Y9EA 2NYUA 3LE8A 3SGBI 1SGRI 3NJRA 5L8VA 4WLUA 2ARPF 2I5PO 1PL6A 4MUEA 4Q7KA 3VZBA 4A16A 3RUAA 5GJBA 1DOAA 1ZXBA 5IANA 3KIPA 2X77A 3SHFA 4KMSA 2AZMA 5FI1B 3V9PA 3ZE1B 7YASA 4EX7A 3GBVA 1WEKA 5JOQA 2B99A 1BHJA 1V1MA 2CUKA 1E1MA 5EA2A 3FCUB 3INYA 1RBZA 4QUAA 2ZUUA 3M5PA 2V1UA 1UMDB 1Y5LA 4FN4A 5CCEA 5DASA 2PGNA 4JVNA 1QU2A 3H04A 4G5GA 4JEIA 4U00A 5G3ZA 1TCCA 1U99A 3UWSA