1OYVI

Crystal structure of tomato inhibitor-ii in a ternary complex with subtilisin carlsberg
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
116
structure length
104
Chain Sequence
KACTRECGNLGFGICPRSEGSPLNPICINCCSGYKGCNYYNSFGKFICEGESDPKRPNACTFNCDPNIAYSRCGCTTCCTGYKGCYYFGKDGKFVCEGESDEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin Carlsberg
publication title Structural basis of inhibition revealed by a 1:2 complex of the two-headed tomato inhibitor-II and subtilisin Carlsberg
pubmed doi rcsb
molecule tags Hydrolase
total genus 14
structure length 104
sequence length 116
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02428 Prot_inhib_II Potato type II proteinase inhibitor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1oyvI01
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1oyvI02
3HH2C 1HPTA 1Y1CA 2P6AC 1TIHA 1YTPA 3QTLD 1CGII 2SGPI 1DS3I 2JZMA 2OVOA 2SGQI 2GKTI 4OVOA 2LEOA 1CE3A 2N52A 1OYVI 2BUSA 1IY5A 1H0ZA 1FYBA 1CGJI 4GI3C 1AN1I 1TGSI 2NU0I 3SGQI 1R0RI 2KMRA 3SEKC 1IW4A 1LR8A 1UVGA 2NU1I 2B0UC 2ARPF 1CT0I 3B4VC 1HDLA 2GKRI 1LR7A 2QQDA 2NU3I 1NUBA 2KMOA 1BUSA 2KCXA 1DS2I 4HGUA 3TJQA 1BMOA 1PCEA 1YU6C 2N17A 1Z7KB 1IY6A 3SGBI 1M8CA 1CT2I 1M8BA 1UUCA 1CT4I 2NU2I 1OMUA 2M5XA 1TUSA 2WCYA 2SGEI 2JXDA 1OMTA 1TBRR 1SGDI 1TURA 5DAEA 1SGNI 5JHWC 1SGRI 2N71A 1PPFI 1TBQR 1CSOI 2XRCA 2F3CI 1SGPI 2KMPA 1SGEI 1CHOI 1SGYI 1Y1BA 2KMQA 2NU4I 1N13A 4SGBI 2V53A 2SGDI 2SGFI 1HJAI 2ERWA 3OVOA 1UVFA 2JYYA 1SGQI 1MT1A 2GKVA 1KMAA 2QQCA 1PJUA 1OVOA 1LR9A
chains in the Genus database with same CATH superfamily
3HH2C 1HPTA 1Y1CA 1XBTA 2UZ3A 2P6AC 1TIHA 1YTPA 5FUVA 3QTLD 3TOBA 1CGII 2RC4A 2SGPI 2L7XA 1DS3I 2CWHA 2B8TA 1MJBA 2ENZA 2JZMA 2OVOA 3R5AA 1MJ9A 1Q9BA 2GKTI 2SGQI 3R5DA 4DNCA 1U5KA 3TOAA 4B6DA 4OVOA 1W3SA 2DKVA 2LEOA 1CE3A 2N52A 1PTQA 2VRWB 3OXGA 1P9GA 1OYVI 1WKXA 2BUSA 1IY5A 1H0ZA 4UXJA 3D00A 3TO6A 2DB6A 5J8CA 1CGJI 4GI3C 1AN1I 3R5BA 1FYBA 1TGSI 2V1CC 4FKDA 4L9MA 1KBEA 1TBOA 2LUYA 5HQ8A 2NU0I 3SGQI 5E3PA 1HEVA 2QPOA 1X4SA 3TO9A 1R0RI 2KMRA 1FY7A 2OZUA 5HI7A 3SEKC 1W4RA 5FUXA 1IW4A 1X74A 2GVIA 3PDNA 1LR8A 1UVGA 5CCLA 4UXIA 3R5CA 4WP4A 9WGAA 2DIPA 3MEKA 2CWFA 2NU1I 2B0UC 5E3QA 2ARPF 1WGTA 2JA1A 1CT0I 2PQ8A 3B4VC 1HDLA 2GKRI 3QAHA 1KBFA 1P9ZA 1LR7A 2YQPA 2QQ0A 2QQDA 3RU0A 4A24A 2NU3I 3CXLA 1NUBA 2KMOA 2WGCA 3OL0A 2ENNA 5E3RA 3TO7A 3VDPA 2LB7A 1BUSA 3E59A 1WTJA 3UOEA 1WGCA 2WVJA 5FUWA 1MJAA 1ULKA 2KCXA 1DS2I 4HGUA 3TJQA 1BMOA 1PCEA 3UGDA 1YU6C 1TBNA 2N17A 1TOTA 1Z7KB 2Y0MA 1IY6A 3SGBI 1M8CA 7WGAA 2ODDA 1R79A 1CT2I 3FC3A 1M8BA 1UUCA 5FUYA 2RIJA 1CT4I 4E1PA 2NU2I 2OD1A 3E2IA 1OMUA 3GOXA 1K7UA 1V1IA 1VDDA 1XX6A 2M5XA 1TUSA 2YUUA 3VDUA 1FAQA 3BJIA 4E1RA 1NXUA 2K9HA 2V1CA 5CCMA 2E73A 3UEJA 2WCYA 2SGEI 2ORVA 2JXDA 3FSXA 2X3TA 2ELIA 1OMTA 1K7VA 1TBRR 1SGDI 2OU2A 3UGLA 4AMLA 1TURA 3QWPA 5DAEA 3FSYA 2JW6A 3UGIA 2J87A 1Z2IA 1SGNI 5JHWC 1SGRI 3VE5A 2N71A 1FARA 1PPFI 1TBQR 1CSOI 2XRCA 1UHAA 4MPIA 1S20A 2N1AB 2GIVA 3KY9A 1V1HA 2F3CI 1SGPI 1ULMA 5EX0A 2KMPA 1SGEI 1CHOI 1SGYI 1XA6A 1Y8FA 1Y1BA 2KMQA 2L8EA 2NU4I 2ORWA 2X52A 1N13A 4SGBI 1K7TA 2SGDI 2V53A 3OXLA 1ULNA 4JCVE 3UFFA 2SGFI 5EX3A 5J8FA 2J9RA 2ROWA 1HJAI 3OXFA 2ERWA 3OVOA 2CWGA 2W0TA 1UVFA 2JYYA 4UXHA 2CJSC 1SGQI 3UEYA 1MT1A 2GKVA 1RFHA 2FNFX 1KMAA 2E5RA 1PTRA 2A20A 2QQCA 1PJUA 2QQEA 1OVOA 2UVOA 1LR9A
chains in the Genus database with same CATH topology
3HH2C 1HPTA 1Y1CA 1XBTA 2UZ3A 2P6AC 1TIHA 1YTPA 5FUVA 3QTLD 1CGII 2SGPI 2L7XA 1DS3I 2ENZA 2B8TA 2JZMA 2OVOA 2SGQI 2GKTI 1U5KA 4B6DA 4OVOA 1W3SA 2LEOA 1CE3A 2N52A 1PTQA 2VRWB 3OXGA 1OYVI 2BUSA 1IY5A 1H0ZA 4UXJA 3D00A 1FYBA 2DB6A 1CGJI 4GI3C 1AN1I 1TGSI 2V1CC 4FKDA 4L9MA 1KBEA 1TBOA 2LUYA 5HQ8A 2NU0I 3SGQI 2QPOA 1X4SA 1R0RI 2KMRA 5HI7A 3SEKC 1W4RA 5FUXA 1IW4A 1X74A 2GVIA 3PDNA 1LR8A 1UVGA 5CCLA 4UXIA 2DIPA 3MEKA 2NU1I 2B0UC 2ARPF 2JA1A 1CT0I 3B4VC 1HDLA 1KBFA 2GKRI 1LR7A 2YQPA 2QQ0A 2QQDA 3RU0A 4A24A 2NU3I 3CXLA 1NUBA 2KMOA 3VDPA 3OL0A 2ENNA 1BUSA 3E59A 2WVJA 5FUWA 2KCXA 1DS2I 4HGUA 3TJQA 1BMOA 1PCEA 3UGDA 1YU6C 1TBNA 2N17A 1TOTA 1Z7KB 1IY6A 3SGBI 1M8CA 2ODDA 1R79A 1CT2I 3FC3A 1M8BA 1UUCA 5FUYA 1CT4I 4E1PA 2NU2I 2OD1A 3E2IA 1OMUA 3GOXA 2M5XA 1V1IA 1VDDA 1XX6A 3VDUA 1TUSA 2YUUA 1FAQA 3BJIA 4E1RA 2K9HA 2V1CA 5CCMA 2E73A 3UEJA 2WCYA 2SGEI 2ORVA 2JXDA 2ELIA 1OMTA 1TBRR 1SGDI 3UGLA 1TURA 3QWPA 5DAEA 2JW6A 3UGIA 2J87A 1SGNI 5JHWC 1SGRI 3VE5A 2N71A 1FARA 1PPFI 1TBQR 1CSOI 2XRCA 2N1AB 3KY9A 1V1HA 2F3CI 1SGPI 5EX0A 2KMPA 1SGEI 1CHOI 1SGYI 1Y8FA 1XA6A 1Y1BA 2KMQA 2L8EA 2NU4I 2ORWA 1N13A 4SGBI 2V53A 2SGDI 3OXLA 4JCVE 3UFFA 2SGFI 5EX3A 2J9RA 2ROWA 1HJAI 3OXFA 2ERWA 3OVOA 2W0TA 1UVFA 2JYYA 4UXHA 2CJSC 1SGQI 3UEYA 1MT1A 2GKVA 1RFHA 2FNFX 1KMAA 2E5RA 1PTRA 2A20A 2QQCA 1PJUA 2QQEA 1OVOA 1LR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HH2 C;  1HPT A;  1Y1C A;  2P6A C;  1TIH A;  1YTP A;  3QTL D;  1CGI I;  2SGP I;  1DS3 I;  2JZM A;  2OVO A;  2SGQ I;  2GKT I;  4OVO A;  2LEO A;  1CE3 A;  2N52 A;  1OYV I;  2BUS A;  1IY5 A;  1H0Z A;  1FYB A;  1CGJ I;  4GI3 C;  1AN1 I;  1TGS I;  2NU0 I;  3SGQ I;  1R0R I;  2KMR A;  3SEK C;  1IW4 A;  1LR8 A;  1UVG A;  2NU1 I;  2B0U C;  2ARP F;  1CT0 I;  3B4V C;  1HDL A;  2GKR I;  1LR7 A;  2QQD A;  2NU3 I;  1NUB A;  2KMO A;  1BUS A;  2KCX A;  1DS2 I;  4HGU A;  3TJQ A;  1BMO A;  1PCE A;  1YU6 C;  2N17 A;  1Z7K B;  1IY6 A;  3SGB I;  1M8C A;  1CT2 I;  1M8B A;  1UUC A;  1CT4 I;  2NU2 I;  1OMU A;  2M5X A;  1TUS A;  2WCY A;  2SGE I;  2JXD A;  1OMT A;  1TBR R;  1SGD I;  1TUR A;  5DAE A;  1SGN I;  5JHW C;  1SGR I;  2N71 A;  1PPF I;  1TBQ R;  1CSO I;  2XRC A;  2F3C I;  1SGP I;  2KMP A;  1SGE I;  1CHO I;  1SGY I;  1Y1B A;  2KMQ A;  2NU4 I;  1N13 A;  4SGB I;  2V53 A;  2SGD I;  2SGF I;  1HJA I;  2ERW A;  3OVO A;  1UVF A;  2JYY A;  1SGQ I;  1MT1 A;  2GKV A;  1KMA A;  2QQC A;  1PJU A;  1OVO A;  1LR9 A; 
#chains in the Genus database with same CATH topology
 3HH2 C;  1HPT A;  1Y1C A;  1XBT A;  2UZ3 A;  2P6A C;  1TIH A;  1YTP A;  5FUV A;  3QTL D;  3TOB A;  1CGI I;  2RC4 A;  2SGP I;  2L7X A;  1DS3 I;  2CWH A;  2B8T A;  1MJB A;  2ENZ A;  2JZM A;  2OVO A;  3R5A A;  1MJ9 A;  1Q9B A;  2GKT I;  2SGQ I;  3R5D A;  4DNC A;  1U5K A;  3TOA A;  4B6D A;  4OVO A;  1W3S A;  2DKV A;  2LEO A;  1CE3 A;  2N52 A;  1PTQ A;  2VRW B;  3OXG A;  1P9G A;  1OYV I;  1WKX A;  2BUS A;  1IY5 A;  1H0Z A;  4UXJ A;  3D00 A;  3TO6 A;  2DB6 A;  5J8C A;  1CGJ I;  4GI3 C;  1AN1 I;  3R5B A;  1FYB A;  1TGS I;  2V1C C;  4FKD A;  4L9M A;  1KBE A;  1TBO A;  2LUY A;  5HQ8 A;  2NU0 I;  3SGQ I;  5E3P A;  1HEV A;  2QPO A;  1X4S A;  3TO9 A;  1R0R I;  2KMR A;  1FY7 A;  2OZU A;  5HI7 A;  3SEK C;  1W4R A;  5FUX A;  1IW4 A;  1X74 A;  2GVI A;  3PDN A;  1LR8 A;  1UVG A;  5CCL A;  4UXI A;  3R5C A;  4WP4 A;  9WGA A;  2DIP A;  3MEK A;  2CWF A;  2NU1 I;  2B0U C;  5E3Q A;  2ARP F;  1WGT A;  2JA1 A;  1CT0 I;  2PQ8 A;  3B4V C;  1HDL A;  2GKR I;  3QAH A;  1KBF A;  1P9Z A;  1LR7 A;  2YQP A;  2QQ0 A;  2QQD A;  3RU0 A;  4A24 A;  2NU3 I;  3CXL A;  1NUB A;  2KMO A;  2WGC A;  3OL0 A;  2ENN A;  5E3R A;  3TO7 A;  3VDP A;  2LB7 A;  1BUS A;  3E59 A;  1WTJ A;  3UOE A;  1WGC A;  2WVJ A;  5FUW A;  1MJA A;  1ULK A;  2KCX A;  1DS2 I;  4HGU A;  3TJQ A;  1BMO A;  1PCE A;  3UGD A;  1YU6 C;  1TBN A;  2N17 A;  1TOT A;  1Z7K B;  2Y0M A;  1IY6 A;  3SGB I;  1M8C A;  7WGA A;  2ODD A;  1R79 A;  1CT2 I;  3FC3 A;  1M8B A;  1UUC A;  5FUY A;  2RIJ A;  1CT4 I;  4E1P A;  2NU2 I;  2OD1 A;  3E2I A;  1OMU A;  3GOX A;  1K7U A;  1V1I A;  1VDD A;  1XX6 A;  2M5X A;  1TUS A;  2YUU A;  3VDU A;  1FAQ A;  3BJI A;  4E1R A;  1NXU A;  2K9H A;  2V1C A;  5CCM A;  2E73 A;  3UEJ A;  2WCY A;  2SGE I;  2ORV A;  2JXD A;  3FSX A;  2X3T A;  2ELI A;  1OMT A;  1K7V A;  1TBR R;  1SGD I;  2OU2 A;  3UGL A;  4AML A;  1TUR A;  3QWP A;  5DAE A;  3FSY A;  2JW6 A;  3UGI A;  2J87 A;  1Z2I A;  1SGN I;  5JHW C;  1SGR I;  3VE5 A;  2N71 A;  1FAR A;  1PPF I;  1TBQ R;  1CSO I;  2XRC A;  1UHA A;  4MPI A;  1S20 A;  2N1A B;  2GIV A;  3KY9 A;  1V1H A;  2F3C I;  1SGP I;  1ULM A;  5EX0 A;  2KMP A;  1SGE I;  1CHO I;  1SGY I;  1XA6 A;  1Y8F A;  1Y1B A;  2KMQ A;  2L8E A;  2NU4 I;  2ORW A;  2X52 A;  1N13 A;  4SGB I;  1K7T A;  2SGD I;  2V53 A;  3OXL A;  1ULN A;  4JCV E;  3UFF A;  2SGF I;  5EX3 A;  5J8F A;  2J9R A;  2ROW A;  1HJA I;  3OXF A;  2ERW A;  3OVO A;  2CWG A;  2W0T A;  1UVF A;  2JYY A;  4UXH A;  2CJS C;  1SGQ I;  3UEY A;  1MT1 A;  2GKV A;  1RFH A;  2FNF X;  1KMA A;  2E5R A;  1PTR A;  2A20 A;  2QQC A;  1PJU A;  2QQE A;  1OVO A;  2UVO A;  1LR9 A; 
#chains in the Genus database with same CATH homology
 3HH2 C;  1HPT A;  1Y1C A;  1XBT A;  2UZ3 A;  2P6A C;  1TIH A;  1YTP A;  5FUV A;  3QTL D;  1CGI I;  2SGP I;  2L7X A;  1DS3 I;  2ENZ A;  2B8T A;  2JZM A;  2OVO A;  2SGQ I;  2GKT I;  1U5K A;  4B6D A;  4OVO A;  1W3S A;  2LEO A;  1CE3 A;  2N52 A;  1PTQ A;  2VRW B;  3OXG A;  1OYV I;  2BUS A;  1IY5 A;  1H0Z A;  4UXJ A;  3D00 A;  1FYB A;  2DB6 A;  1CGJ I;  4GI3 C;  1AN1 I;  1TGS I;  2V1C C;  4FKD A;  4L9M A;  1KBE A;  1TBO A;  2LUY A;  5HQ8 A;  2NU0 I;  3SGQ I;  2QPO A;  1X4S A;  1R0R I;  2KMR A;  5HI7 A;  3SEK C;  1W4R A;  5FUX A;  1IW4 A;  1X74 A;  2GVI A;  3PDN A;  1LR8 A;  1UVG A;  5CCL A;  4UXI A;  2DIP A;  3MEK A;  2NU1 I;  2B0U C;  2ARP F;  2JA1 A;  1CT0 I;  3B4V C;  1HDL A;  1KBF A;  2GKR I;  1LR7 A;  2YQP A;  2QQ0 A;  2QQD A;  3RU0 A;  4A24 A;  2NU3 I;  3CXL A;  1NUB A;  2KMO A;  3VDP A;  3OL0 A;  2ENN A;  1BUS A;  3E59 A;  2WVJ A;  5FUW A;  2KCX A;  1DS2 I;  4HGU A;  3TJQ A;  1BMO A;  1PCE A;  3UGD A;  1YU6 C;  1TBN A;  2N17 A;  1TOT A;  1Z7K B;  1IY6 A;  3SGB I;  1M8C A;  2ODD A;  1R79 A;  1CT2 I;  3FC3 A;  1M8B A;  1UUC A;  5FUY A;  1CT4 I;  4E1P A;  2NU2 I;  2OD1 A;  3E2I A;  1OMU A;  3GOX A;  2M5X A;  1V1I A;  1VDD A;  1XX6 A;  3VDU A;  1TUS A;  2YUU A;  1FAQ A;  3BJI A;  4E1R A;  2K9H A;  2V1C A;  5CCM A;  2E73 A;  3UEJ A;  2WCY A;  2SGE I;  2ORV A;  2JXD A;  2ELI A;  1OMT A;  1TBR R;  1SGD I;  3UGL A;  1TUR A;  3QWP A;  5DAE A;  2JW6 A;  3UGI A;  2J87 A;  1SGN I;  5JHW C;  1SGR I;  3VE5 A;  2N71 A;  1FAR A;  1PPF I;  1TBQ R;  1CSO I;  2XRC A;  2N1A B;  3KY9 A;  1V1H A;  2F3C I;  1SGP I;  5EX0 A;  2KMP A;  1SGE I;  1CHO I;  1SGY I;  1Y8F A;  1XA6 A;  1Y1B A;  2KMQ A;  2L8E A;  2NU4 I;  2ORW A;  1N13 A;  4SGB I;  2V53 A;  2SGD I;  3OXL A;  4JCV E;  3UFF A;  2SGF I;  5EX3 A;  2J9R A;  2ROW A;  1HJA I;  3OXF A;  2ERW A;  3OVO A;  2W0T A;  1UVF A;  2JYY A;  4UXH A;  2CJS C;  1SGQ I;  3UEY A;  1MT1 A;  2GKV A;  1RFH A;  2FNF X;  1KMA A;  2E5R A;  1PTR A;  2A20 A;  2QQC A;  1PJU A;  2QQE A;  1OVO A;  1LR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...