1OYVI

Crystal structure of tomato inhibitor-ii in a ternary complex with subtilisin carlsberg
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
116
structure length
104
Chain Sequence
b'KACTRECGNLGFGICPRSEGSPLNPICINCCSGYKGCNYYNSFGKFICEGESDPKRPNACTFNCDPNIAYSRCGCTTCCTGYKGCYYFGKDGKFVCEGESDEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin Carlsberg
publication title Structural basis of inhibition revealed by a 1:2 complex of the two-headed tomato inhibitor-II and subtilisin Carlsberg
pubmed doi rcsb
molecule tags Hydrolase
total genus 14
structure length 104
sequence length 116
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02428 Prot_inhib_II Potato type II proteinase inhibitor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1oyvI01
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1oyvI02
1PPFI 2B0UC 1SGNI 3HH2C 4OVOA 1R0RI 1BMOA 2SGDI 2QQCA 1SGYI 3B4VC 1CE3A 1SGDI 1DS2I 1OYVI 1YTPA 3TJQA 1SGPI 1YU6C 3OVOA 2SGPI 1TURA 1Y1CA 1UVGA 2M5XA 1IY5A 1FYBA 1KMAA 5JHWC 1MT1A 4GI3C 2QQDA 3SEKC 4HGUA 1HPTA 2JXDA 2XRCA 2KMPA 1Y1BA 2N52A 2P6AC 1HDLA 1CGJI 2N17A 1OMTA 2WCYA 1Z7KB 1OMUA 2V53A 2F3CI 2N71A 1UVFA 1TGSI 2LEOA 2BUSA 1IW4A 2NU1I 3QTLD 1AN1I 1SGEI 2NU0I 2KMOA 1CSOI 2GKVA 2GKTI 1UUCA 1LR8A 1CT0I 1HJAI 1PJUA 2JYYA 2JZMA 1NUBA 3SGBI 1TUSA 1CHOI 1DS3I 1OVOA 4SGBI 1CT2I 1TBQR 1TBRR 3SGQI 1TIHA 2ARPF 1IY6A 1SGRI 5DAEA 2KCXA 1PCEA 1M8CA 2OVOA 2SGFI 2KMRA 1N13A 2ERWA 2NU3I 1H0ZA 2GKRI 1SGQI 1LR7A 2NU2I 2NU4I 1CGII 2KMQA 2SGEI 1LR9A 1M8BA 2SGQI 1CT4I 1BUSA
chains in the Genus database with same CATH superfamily
1PPFI 2B0UC 1NXUA 5CCLA 1SGNI 3HH2C 3OXFA 1KBFA 3QAHA 4OVOA 3TOAA 1V1HA 1VDDA 2CWGA 5FUVA 1R0RI 2WVJA 1BMOA 2SGDI 2QQCA 1SGYI 3OXLA 3B4VC 2QQ0A 5E3QA 4E1RA 3UGLA 2YQPA 1CE3A 1PTRA 1SGDI 1DS2I 1OYVI 1YTPA 2WGCA 1WGCA 3UEJA 4UXHA 3R5AA 5FUWA 1PTQA 1W4RA 4JCVE 1HEVA 1K7TA 3UFFA 3TJQA 1SGPI 1YU6C 3OVOA 5HQ8A 1W3SA 3R5CA 2SGPI 2VRWB 3VDUA 1MJBA 5CCMA 3D00A 1TURA 1Y1CA 1UHAA 2QQEA 1UVGA 2M5XA 5E3RA 1IY5A 1FYBA 1K7VA 1KMAA 1V1IA 5JHWC 1XA6A 2OZUA 1MT1A 1WGTA 1ULKA 4GI3C 1FY7A 3FSXA 1U5KA 4AMLA 2QQDA 3SEKC 3FSYA 3UOEA 1ULNA 2LUYA 4HGUA 3VDPA 1HPTA 2JXDA 2J87A 2XRCA 4UXIA 2KMPA 1Y1BA 2N52A 2CWHA 2P6AC 2Y0MA 4DNCA 1WTJA 2X3TA 5HI7A 3VE5A 1HDLA 1CGJI 3UGIA 2N17A 1OMTA 2OU2A 2WCYA 1Z7KB 4UXJA 3R5DA 3QWPA 1Y8FA 1OMUA 1Q9BA 2DIPA 2V53A 2F3CI 1ULMA 2ENZA 2N71A 2GIVA 3TO7A 1UVFA 3TO9A 1RFHA 1TGSI 2CJSC 9WGAA 2V1CA 2J9RA 1XX6A 2LEOA 4B6DA 1TBOA 2BUSA 3PDNA 1IW4A 2E73A 3TOBA 2NU1I 2V1CC 3QTLD 3TO6A 2B8TA 1AN1I 2K9HA 7WGAA 2YUUA 5J8FA 1SGEI 2NU0I 2KMOA 1CSOI 1S20A 3KY9A 2ELIA 1X74A 2ORVA 2GKVA 3E2IA 3E59A 1FAQA 2GKTI 1UUCA 1LR8A 5EX0A 1CT0I 1HJAI 1XBTA 1PJUA 2JYYA 2JZMA 2DKVA 2ORWA 1NUBA 1KBEA 4FKDA 3SGBI 2ROWA 2GVIA 1TUSA 2DB6A 2CWFA 2UZ3A 1MJAA 4MPIA 1CHOI 1DS3I 5J8CA 3GOXA 3MEKA 2PQ8A 1OVOA 2RIJA 1Z2IA 4SGBI 1CT2I 1TBQR 2JW6A 1TBRR 2L8EA 3SGQI 5FUXA 1TIHA 3UGDA 1FARA 5EX3A 2ARPF 1IY6A 1X4SA 2N1AB 4A24A 1TBNA 1SGRI 2OD1A 4WP4A 3FC3A 2FNFX 5DAEA 3UEYA 2KCXA 2X52A 3R5BA 1PCEA 1M8CA 2E5RA 2OVOA 2JA1A 2SGFI 2KMRA 1N13A 2ERWA 5E3PA 4L9MA 2NU3I 1H0ZA 3RU0A 4E1PA 1BUSA 3OL0A 2GKRI 1P9GA 1SGQI 1LR7A 2LB7A 2NU2I 1K7UA 1P9ZA 2A20A 2NU4I 2ODDA 1CGII 1MJ9A 2KMQA 2ENNA 2SGEI 1TOTA 1LR9A 1WKXA 3CXLA 1M8BA 2SGQI 3BJIA 2RC4A 5FUYA 2UVOA 2W0TA 1CT4I 2L7XA 2QPOA 3OXGA 1R79A
chains in the Genus database with same CATH topology
1PPFI 2B0UC 5CCLA 1SGNI 3HH2C 3OXFA 1KBFA 4OVOA 1V1HA 1VDDA 5FUVA 1R0RI 2WVJA 1BMOA 2SGDI 2QQCA 1SGYI 3OXLA 3B4VC 2QQ0A 4E1RA 3UGLA 2YQPA 1CE3A 1PTRA 1SGDI 1DS2I 1OYVI 1YTPA 3UEJA 4UXHA 5FUWA 1PTQA 1W4RA 4JCVE 3UFFA 3TJQA 1SGPI 1YU6C 3OVOA 5HQ8A 1W3SA 2SGPI 2VRWB 3VDUA 5CCMA 3D00A 1TURA 1Y1CA 2QQEA 1UVGA 2M5XA 1IY5A 1FYBA 1KMAA 1V1IA 5JHWC 1XA6A 1MT1A 4GI3C 1U5KA 2QQDA 3SEKC 2LUYA 4HGUA 3VDPA 1HPTA 2JXDA 2J87A 2XRCA 4UXIA 2KMPA 1Y1BA 2N52A 2P6AC 3VE5A 5HI7A 1HDLA 1CGJI 3UGIA 2N17A 1OMTA 2WCYA 1Z7KB 4UXJA 3QWPA 1Y8FA 1OMUA 2DIPA 2V53A 2F3CI 2ENZA 2N71A 1UVFA 1RFHA 1TGSI 2CJSC 2V1CA 2J9RA 1XX6A 2LEOA 4B6DA 1TBOA 2BUSA 3PDNA 1IW4A 2E73A 2NU1I 2V1CC 3QTLD 2B8TA 1AN1I 2K9HA 2YUUA 1SGEI 2NU0I 2KMOA 1CSOI 3KY9A 2ELIA 1X74A 2ORVA 2GKVA 3E2IA 3E59A 1FAQA 2GKTI 1UUCA 1LR8A 5EX0A 1CT0I 1HJAI 1XBTA 1PJUA 2JYYA 2JZMA 2ORWA 1NUBA 1KBEA 4FKDA 3SGBI 2ROWA 2GVIA 1TUSA 2DB6A 2UZ3A 1CHOI 1DS3I 3GOXA 3MEKA 1OVOA 4SGBI 1CT2I 1TBQR 2JW6A 1TBRR 2L8EA 3SGQI 5FUXA 1TIHA 3UGDA 1FARA 5EX3A 2ARPF 1IY6A 1X4SA 2N1AB 4A24A 1TBNA 1SGRI 2OD1A 3FC3A 2FNFX 5DAEA 3UEYA 2KCXA 1PCEA 1M8CA 2E5RA 2OVOA 2JA1A 2SGFI 2KMRA 1N13A 2ERWA 4L9MA 2NU3I 1H0ZA 3RU0A 4E1PA 1BUSA 3OL0A 2GKRI 1SGQI 1LR7A 2NU2I 2NU4I 2A20A 2ODDA 1CGII 2KMQA 2ENNA 2SGEI 1TOTA 1LR9A 3CXLA 1M8BA 2SGQI 3BJIA 5FUYA 2W0TA 1CT4I 2L7XA 2QPOA 3OXGA 1R79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPF I;  2B0U C;  1SGN I;  3HH2 C;  4OVO A;  1R0R I;  1BMO A;  2SGD I;  2QQC A;  1SGY I;  3B4V C;  1CE3 A;  1SGD I;  1DS2 I;  1OYV I;  1YTP A;  3TJQ A;  1SGP I;  1YU6 C;  3OVO A;  2SGP I;  1TUR A;  1Y1C A;  1UVG A;  2M5X A;  1IY5 A;  1FYB A;  1KMA A;  5JHW C;  1MT1 A;  4GI3 C;  2QQD A;  3SEK C;  4HGU A;  1HPT A;  2JXD A;  2XRC A;  2KMP A;  1Y1B A;  2N52 A;  2P6A C;  1HDL A;  1CGJ I;  2N17 A;  1OMT A;  2WCY A;  1Z7K B;  1OMU A;  2V53 A;  2F3C I;  2N71 A;  1UVF A;  1TGS I;  2LEO A;  2BUS A;  1IW4 A;  2NU1 I;  3QTL D;  1AN1 I;  1SGE I;  2NU0 I;  2KMO A;  1CSO I;  2GKV A;  2GKT I;  1UUC A;  1LR8 A;  1CT0 I;  1HJA I;  1PJU A;  2JYY A;  2JZM A;  1NUB A;  3SGB I;  1TUS A;  1CHO I;  1DS3 I;  1OVO A;  4SGB I;  1CT2 I;  1TBQ R;  1TBR R;  3SGQ I;  1TIH A;  2ARP F;  1IY6 A;  1SGR I;  5DAE A;  2KCX A;  1PCE A;  1M8C A;  2OVO A;  2SGF I;  2KMR A;  1N13 A;  2ERW A;  2NU3 I;  1H0Z A;  2GKR I;  1SGQ I;  1LR7 A;  2NU2 I;  2NU4 I;  1CGI I;  2KMQ A;  2SGE I;  1LR9 A;  1M8B A;  2SGQ I;  1CT4 I;  1BUS A; 
#chains in the Genus database with same CATH topology
 1PPF I;  2B0U C;  1NXU A;  5CCL A;  1SGN I;  3HH2 C;  3OXF A;  1KBF A;  3QAH A;  4OVO A;  3TOA A;  1V1H A;  1VDD A;  2CWG A;  5FUV A;  1R0R I;  2WVJ A;  1BMO A;  2SGD I;  2QQC A;  1SGY I;  3OXL A;  3B4V C;  2QQ0 A;  5E3Q A;  4E1R A;  3UGL A;  2YQP A;  1CE3 A;  1PTR A;  1SGD I;  1DS2 I;  1OYV I;  1YTP A;  2WGC A;  1WGC A;  3UEJ A;  4UXH A;  3R5A A;  5FUW A;  1PTQ A;  1W4R A;  4JCV E;  1HEV A;  1K7T A;  3UFF A;  3TJQ A;  1SGP I;  1YU6 C;  3OVO A;  5HQ8 A;  1W3S A;  3R5C A;  2SGP I;  2VRW B;  3VDU A;  1MJB A;  5CCM A;  3D00 A;  1TUR A;  1Y1C A;  1UHA A;  2QQE A;  1UVG A;  2M5X A;  5E3R A;  1IY5 A;  1FYB A;  1K7V A;  1KMA A;  1V1I A;  5JHW C;  1XA6 A;  2OZU A;  1MT1 A;  1WGT A;  1ULK A;  4GI3 C;  1FY7 A;  3FSX A;  1U5K A;  4AML A;  2QQD A;  3SEK C;  3FSY A;  3UOE A;  1ULN A;  2LUY A;  4HGU A;  3VDP A;  1HPT A;  2JXD A;  2J87 A;  2XRC A;  4UXI A;  2KMP A;  1Y1B A;  2N52 A;  2CWH A;  2P6A C;  2Y0M A;  4DNC A;  1WTJ A;  2X3T A;  5HI7 A;  3VE5 A;  1HDL A;  1CGJ I;  3UGI A;  2N17 A;  1OMT A;  2OU2 A;  2WCY A;  1Z7K B;  4UXJ A;  3R5D A;  3QWP A;  1Y8F A;  1OMU A;  1Q9B A;  2DIP A;  2V53 A;  2F3C I;  1ULM A;  2ENZ A;  2N71 A;  2GIV A;  3TO7 A;  1UVF A;  3TO9 A;  1RFH A;  1TGS I;  2CJS C;  9WGA A;  2V1C A;  2J9R A;  1XX6 A;  2LEO A;  4B6D A;  1TBO A;  2BUS A;  3PDN A;  1IW4 A;  2E73 A;  3TOB A;  2NU1 I;  2V1C C;  3QTL D;  3TO6 A;  2B8T A;  1AN1 I;  2K9H A;  7WGA A;  2YUU A;  5J8F A;  1SGE I;  2NU0 I;  2KMO A;  1CSO I;  1S20 A;  3KY9 A;  2ELI A;  1X74 A;  2ORV A;  2GKV A;  3E2I A;  3E59 A;  1FAQ A;  2GKT I;  1UUC A;  1LR8 A;  5EX0 A;  1CT0 I;  1HJA I;  1XBT A;  1PJU A;  2JYY A;  2JZM A;  2DKV A;  2ORW A;  1NUB A;  1KBE A;  4FKD A;  3SGB I;  2ROW A;  2GVI A;  1TUS A;  2DB6 A;  2CWF A;  2UZ3 A;  1MJA A;  4MPI A;  1CHO I;  1DS3 I;  5J8C A;  3GOX A;  3MEK A;  2PQ8 A;  1OVO A;  2RIJ A;  1Z2I A;  4SGB I;  1CT2 I;  1TBQ R;  2JW6 A;  1TBR R;  2L8E A;  3SGQ I;  5FUX A;  1TIH A;  3UGD A;  1FAR A;  5EX3 A;  2ARP F;  1IY6 A;  1X4S A;  2N1A B;  4A24 A;  1TBN A;  1SGR I;  2OD1 A;  4WP4 A;  3FC3 A;  2FNF X;  5DAE A;  3UEY A;  2KCX A;  2X52 A;  3R5B A;  1PCE A;  1M8C A;  2E5R A;  2OVO A;  2JA1 A;  2SGF I;  2KMR A;  1N13 A;  2ERW A;  5E3P A;  4L9M A;  2NU3 I;  1H0Z A;  3RU0 A;  4E1P A;  1BUS A;  3OL0 A;  2GKR I;  1P9G A;  1SGQ I;  1LR7 A;  2LB7 A;  2NU2 I;  1K7U A;  1P9Z A;  2A20 A;  2NU4 I;  2ODD A;  1CGI I;  1MJ9 A;  2KMQ A;  2ENN A;  2SGE I;  1TOT A;  1LR9 A;  1WKX A;  3CXL A;  1M8B A;  2SGQ I;  3BJI A;  2RC4 A;  5FUY A;  2UVO A;  2W0T A;  1CT4 I;  2L7X A;  2QPO A;  3OXG A;  1R79 A; 
#chains in the Genus database with same CATH homology
 1PPF I;  2B0U C;  5CCL A;  1SGN I;  3HH2 C;  3OXF A;  1KBF A;  4OVO A;  1V1H A;  1VDD A;  5FUV A;  1R0R I;  2WVJ A;  1BMO A;  2SGD I;  2QQC A;  1SGY I;  3OXL A;  3B4V C;  2QQ0 A;  4E1R A;  3UGL A;  2YQP A;  1CE3 A;  1PTR A;  1SGD I;  1DS2 I;  1OYV I;  1YTP A;  3UEJ A;  4UXH A;  5FUW A;  1PTQ A;  1W4R A;  4JCV E;  3UFF A;  3TJQ A;  1SGP I;  1YU6 C;  3OVO A;  5HQ8 A;  1W3S A;  2SGP I;  2VRW B;  3VDU A;  5CCM A;  3D00 A;  1TUR A;  1Y1C A;  2QQE A;  1UVG A;  2M5X A;  1IY5 A;  1FYB A;  1KMA A;  1V1I A;  5JHW C;  1XA6 A;  1MT1 A;  4GI3 C;  1U5K A;  2QQD A;  3SEK C;  2LUY A;  4HGU A;  3VDP A;  1HPT A;  2JXD A;  2J87 A;  2XRC A;  4UXI A;  2KMP A;  1Y1B A;  2N52 A;  2P6A C;  3VE5 A;  5HI7 A;  1HDL A;  1CGJ I;  3UGI A;  2N17 A;  1OMT A;  2WCY A;  1Z7K B;  4UXJ A;  3QWP A;  1Y8F A;  1OMU A;  2DIP A;  2V53 A;  2F3C I;  2ENZ A;  2N71 A;  1UVF A;  1RFH A;  1TGS I;  2CJS C;  2V1C A;  2J9R A;  1XX6 A;  2LEO A;  4B6D A;  1TBO A;  2BUS A;  3PDN A;  1IW4 A;  2E73 A;  2NU1 I;  2V1C C;  3QTL D;  2B8T A;  1AN1 I;  2K9H A;  2YUU A;  1SGE I;  2NU0 I;  2KMO A;  1CSO I;  3KY9 A;  2ELI A;  1X74 A;  2ORV A;  2GKV A;  3E2I A;  3E59 A;  1FAQ A;  2GKT I;  1UUC A;  1LR8 A;  5EX0 A;  1CT0 I;  1HJA I;  1XBT A;  1PJU A;  2JYY A;  2JZM A;  2ORW A;  1NUB A;  1KBE A;  4FKD A;  3SGB I;  2ROW A;  2GVI A;  1TUS A;  2DB6 A;  2UZ3 A;  1CHO I;  1DS3 I;  3GOX A;  3MEK A;  1OVO A;  4SGB I;  1CT2 I;  1TBQ R;  2JW6 A;  1TBR R;  2L8E A;  3SGQ I;  5FUX A;  1TIH A;  3UGD A;  1FAR A;  5EX3 A;  2ARP F;  1IY6 A;  1X4S A;  2N1A B;  4A24 A;  1TBN A;  1SGR I;  2OD1 A;  3FC3 A;  2FNF X;  5DAE A;  3UEY A;  2KCX A;  1PCE A;  1M8C A;  2E5R A;  2OVO A;  2JA1 A;  2SGF I;  2KMR A;  1N13 A;  2ERW A;  4L9M A;  2NU3 I;  1H0Z A;  3RU0 A;  4E1P A;  1BUS A;  3OL0 A;  2GKR I;  1SGQ I;  1LR7 A;  2NU2 I;  2NU4 I;  2A20 A;  2ODD A;  1CGI I;  2KMQ A;  2ENN A;  2SGE I;  1TOT A;  1LR9 A;  3CXL A;  1M8B A;  2SGQ I;  3BJI A;  5FUY A;  2W0T A;  1CT4 I;  2L7X A;  2QPO A;  3OXG A;  1R79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...