1OYVI

Crystal structure of tomato inhibitor-ii in a ternary complex with subtilisin carlsberg
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
116
structure length
104
Chain Sequence
KACTRECGNLGFGICPRSEGSPLNPICINCCSGYKGCNYYNSFGKFICEGESDPKRPNACTFNCDPNIAYSRCGCTTCCTGYKGCYYFGKDGKFVCEGESDEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Subtilisin Carlsberg
publication title Structural basis of inhibition revealed by a 1:2 complex of the two-headed tomato inhibitor-II and subtilisin Carlsberg
pubmed doi rcsb
total genus 14
structure length 104
sequence length 116
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02428 Prot_inhib_II Potato type II proteinase inhibitor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1oyvI01
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1oyvI02
1CE3A 1IY5A 4HGUA 1LR8A 2WCYA 1CT4I 1LR7A 2V53A 3OVOA 3TJQA 2GKTI 1CSOI 4SGBI 1Y1BA 2F3CI 1R0RI 1OMUA 1CT2I 3SEKC 1HPTA 3SGQI 1IY6A 1CT0I 2QQDA 2LEOA 1SGQI 1IW4A 4GI3C 2ARPF 1PJUA 1H0ZA 1TUSA 1Z7KB 2N17A 1YTPA 3B4VC 1TIHA 1DS3I 1M8BA 2SGQI 1HJAI 1PCEA 5DAEA 2P6AC 1PPFI 4OVOA 1OMTA 1UVGA 3HH2C 1BMOA 2NU1I 2OVOA 2XRCA 1CGJI 2SGPI 2KMRA 2KMQA 1N13A 1OVOA 1SGRI 2KCXA 3QTLD 1HDLA 2JYYA 1UUCA 2NU2I 2ERWA 1SGEI 1DS2I 1OYVI 2NU4I 1AN1I 1TBRR 2GKRI 2KMPA 1CGII 1M8CA 1BUSA 2JZMA 2N71A 2SGEI 1FYBA 2NU0I 2SGDI 2JXDA 1NUBA 2N52A 2QQCA 1LR9A 1MT1A 1SGYI 1TBQR 2B0UC 5JHWC 1SGNI 1KMAA 2NU3I 2KMOA 2GKVA 1TURA 1SGDI 1TGSI 2SGFI 3SGBI 2BUSA 1UVFA 1Y1CA 1SGPI 2M5XA 1CHOI 1YU6C
chains in the Genus database with same CATH superfamily
1CE3A 2N1AB 3E59A 4UXHA 3MEKA 1VDDA 2J87A 4HGUA 1IY5A 1V1IA 1LR8A 1X74A 1ULKA 3OL0A 1U5KA 3OXLA 1W4RA 2WCYA 4E1RA 1CT4I 1LR7A 2GVIA 2V53A 1RFHA 2Y0MA 1NXUA 2JA1A 1MJ9A 3OVOA 2V1CA 5E3PA 2DKVA 5EX0A 3TJQA 2ELIA 3TO7A 3E2IA 3TO6A 4E1PA 3TO9A 2GKTI 2YUUA 3VDUA 4DNCA 1CSOI 4SGBI 1Y1BA 2F3CI 2QQEA 1R0RI 2JW6A 2QPOA 4JCVE 5EX3A 1OMUA 1CT2I 3SEKC 3VE5A 1HPTA 1Q9BA 2E5RA 3SGQI 1IY6A 1S20A 3FC3A 1CT0I 2A20A 2LEOA 1SGQI 2OD1A 2QQDA 4GI3C 2UZ3A 2ARPF 1P9GA 1IW4A 1PJUA 2X3TA 1TUSA 3TOAA 1Z7KB 2N17A 3OXFA 4B6DA 3UEJA 2FNFX 1YTPA 2GIVA 1TIHA 3B4VC 1DS3I 1WGTA 1M8BA 2SGQI 5E3QA 1HJAI 2DB6A 2CWHA 1PCEA 1KBFA 1WTJA 2UVOA 3R5CA 5DAEA 2P6AC 1PPFI 4OVOA 1OMTA 1UVGA 3HH2C 3R5AA 5HI7A 1FAQA 1XA6A 2PQ8A 2ORVA 2QQ0A 2E73A 2YQPA 4AMLA 1BMOA 1V1HA 2NU1I 2OVOA 2XRCA 1TBOA 1MJAA 4UXJA 1CGJI 2CWGA 2ODDA 4L9MA 1P9ZA 2SGPI 2KMRA 2KMQA 3UFFA 2VRWB 1N13A 1OVOA 1W3SA 1SGRI 2ENZA 2KCXA 3QTLD 1HDLA 2JYYA 1UUCA 2NU2I 2ERWA 2J9RA 1SGEI 1DS2I 1OYVI 2NU4I 1AN1I 2L7XA 2ORWA 1R79A 2OU2A 1TBRR 3UOEA 2X52A 2GKRI 1FY7A 2KMPA 3BJIA 1CGII 5FUWA 4WP4A 1M8CA 2RIJA 1TBNA 3OXGA 1Y8FA 1BUSA 2JZMA 3KY9A 1WGCA 1XBTA 2WGCA 3PDNA 4UXIA 2N71A 2OZUA 2SGEI 4A24A 7WGAA 1FYBA 1K7VA 2RC4A 1X4SA 3VDPA 1XX6A 3FSYA 2NU0I 2SGDI 1ULNA 3UGLA 2JXDA 1NUBA 5FUXA 1FARA 1K7UA 2N52A 2QQCA 3D00A 4MPIA 3UGIA 1MT1A 1LR9A 3UGDA 1ULMA 3QWPA 2ENNA 1SGYI 2K9HA 5CCMA 1PTQA 2V1CC 3FSXA 5J8CA 2CJSC 1WKXA 1MJBA 1TBQR 2B0UC 2CWFA 2ROWA 5JHWC 1SGNI 1KMAA 2LUYA 9WGAA 3QAHA 1PTRA 2NU3I 2KMOA 2GKVA 2LB7A 1TURA 3GOXA 5HQ8A 3R5DA 2B8TA 1UHAA 2W0TA 1SGDI 3RU0A 5CCLA 1KBEA 1TGSI 2SGFI 3SGBI 2BUSA 3TOBA 1UVFA 5J8FA 1TOTA 1HEVA 1Y1CA 5FUYA 1K7TA 2WVJA 5E3RA 3CXLA 1Z2IA 3R5BA 1H0ZA 4FKDA 1SGPI 2DIPA 2M5XA 5FUVA 3UEYA 2L8EA 1CHOI 1YU6C
chains in the Genus database with same CATH topology
1CE3A 2N1AB 3E59A 4UXHA 3MEKA 1VDDA 2J87A 4HGUA 1IY5A 1V1IA 1LR8A 1X74A 3OL0A 1U5KA 3OXLA 1W4RA 2WCYA 4E1RA 1CT4I 1LR7A 2GVIA 2V53A 1RFHA 2JA1A 3OVOA 3TJQA 2V1CA 5EX0A 2ELIA 3E2IA 4E1PA 2GKTI 2YUUA 3VDUA 1CSOI 4SGBI 1Y1BA 2F3CI 2QQEA 1R0RI 2JW6A 2QPOA 4JCVE 5EX3A 1OMUA 1CT2I 3SEKC 3VE5A 1HPTA 2E5RA 3SGQI 1IY6A 1KBFA 3FC3A 1CT0I 2A20A 2LEOA 1SGQI 2OD1A 2QQDA 4GI3C 2UZ3A 2ARPF 3RU0A 1IW4A 1PJUA 1H0ZA 1TUSA 4B6DA 1Z7KB 2N17A 3OXFA 3UEJA 2FNFX 1YTPA 3B4VC 1TIHA 1DS3I 1M8BA 2SGQI 1HJAI 2DB6A 1PCEA 5DAEA 2P6AC 1PPFI 4OVOA 1OMTA 1UVGA 3HH2C 5HI7A 1FAQA 1XA6A 2QQ0A 2ORVA 2YQPA 2E73A 1BMOA 1V1HA 2NU1I 2OVOA 2XRCA 1TBOA 4UXJA 1CGJI 2ODDA 4L9MA 2SGPI 2KMRA 2KMQA 3UFFA 2VRWB 1N13A 1OVOA 1W3SA 1SGRI 2ENZA 2KCXA 3QTLD 1HDLA 2JYYA 1UUCA 2NU2I 2ERWA 2J9RA 1SGEI 1DS2I 1OYVI 2NU4I 1AN1I 2L7XA 2ORWA 1R79A 1TBRR 2GKRI 2KMPA 3BJIA 1CGII 5FUWA 1M8CA 1TBNA 3OXGA 1Y8FA 1BUSA 2JZMA 3KY9A 1XBTA 3PDNA 4UXIA 2N71A 2SGEI 4A24A 1FYBA 1X4SA 3VDPA 1XX6A 2NU0I 2SGDI 3UGLA 2JXDA 1NUBA 5FUXA 1FARA 2N52A 2QQCA 3D00A 3UGIA 1MT1A 1LR9A 3UGDA 3QWPA 2ENNA 1SGYI 2K9HA 5CCMA 1PTQA 2V1CC 2CJSC 2ROWA 1TBQR 2B0UC 5JHWC 1SGNI 1KMAA 2LUYA 1PTRA 2NU3I 2KMOA 2GKVA 1TURA 3GOXA 5HQ8A 2B8TA 2W0TA 1SGDI 5CCLA 1KBEA 1TGSI 2SGFI 3SGBI 2BUSA 1UVFA 1TOTA 1Y1CA 5FUYA 2WVJA 3CXLA 4FKDA 1SGPI 2DIPA 2M5XA 5FUVA 3UEYA 2L8EA 1CHOI 1YU6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CE3 A;  1IY5 A;  4HGU A;  1LR8 A;  2WCY A;  1CT4 I;  1LR7 A;  2V53 A;  3OVO A;  3TJQ A;  2GKT I;  1CSO I;  4SGB I;  1Y1B A;  2F3C I;  1R0R I;  1OMU A;  1CT2 I;  3SEK C;  1HPT A;  3SGQ I;  1IY6 A;  1CT0 I;  2QQD A;  2LEO A;  1SGQ I;  1IW4 A;  4GI3 C;  2ARP F;  1PJU A;  1H0Z A;  1TUS A;  1Z7K B;  2N17 A;  1YTP A;  3B4V C;  1TIH A;  1DS3 I;  1M8B A;  2SGQ I;  1HJA I;  1PCE A;  5DAE A;  2P6A C;  1PPF I;  4OVO A;  1OMT A;  1UVG A;  3HH2 C;  1BMO A;  2NU1 I;  2OVO A;  2XRC A;  1CGJ I;  2SGP I;  2KMR A;  2KMQ A;  1N13 A;  1OVO A;  1SGR I;  2KCX A;  3QTL D;  1HDL A;  2JYY A;  1UUC A;  2NU2 I;  2ERW A;  1SGE I;  1DS2 I;  1OYV I;  2NU4 I;  1AN1 I;  1TBR R;  2GKR I;  2KMP A;  1CGI I;  1M8C A;  1BUS A;  2JZM A;  2N71 A;  2SGE I;  1FYB A;  2NU0 I;  2SGD I;  2JXD A;  1NUB A;  2N52 A;  2QQC A;  1LR9 A;  1MT1 A;  1SGY I;  1TBQ R;  2B0U C;  5JHW C;  1SGN I;  1KMA A;  2NU3 I;  2KMO A;  2GKV A;  1TUR A;  1SGD I;  1TGS I;  2SGF I;  3SGB I;  2BUS A;  1UVF A;  1Y1C A;  1SGP I;  2M5X A;  1CHO I;  1YU6 C; 
#chains in the Genus database with same CATH topology
 1CE3 A;  2N1A B;  3E59 A;  4UXH A;  3MEK A;  1VDD A;  2J87 A;  4HGU A;  1IY5 A;  1V1I A;  1LR8 A;  1X74 A;  1ULK A;  3OL0 A;  1U5K A;  3OXL A;  1W4R A;  2WCY A;  4E1R A;  1CT4 I;  1LR7 A;  2GVI A;  2V53 A;  1RFH A;  2Y0M A;  1NXU A;  2JA1 A;  1MJ9 A;  3OVO A;  2V1C A;  5E3P A;  2DKV A;  5EX0 A;  3TJQ A;  2ELI A;  3TO7 A;  3E2I A;  3TO6 A;  4E1P A;  3TO9 A;  2GKT I;  2YUU A;  3VDU A;  4DNC A;  1CSO I;  4SGB I;  1Y1B A;  2F3C I;  2QQE A;  1R0R I;  2JW6 A;  2QPO A;  4JCV E;  5EX3 A;  1OMU A;  1CT2 I;  3SEK C;  3VE5 A;  1HPT A;  1Q9B A;  2E5R A;  3SGQ I;  1IY6 A;  1S20 A;  3FC3 A;  1CT0 I;  2A20 A;  2LEO A;  1SGQ I;  2OD1 A;  2QQD A;  4GI3 C;  2UZ3 A;  2ARP F;  1P9G A;  1IW4 A;  1PJU A;  2X3T A;  1TUS A;  3TOA A;  1Z7K B;  2N17 A;  3OXF A;  4B6D A;  3UEJ A;  2FNF X;  1YTP A;  2GIV A;  1TIH A;  3B4V C;  1DS3 I;  1WGT A;  1M8B A;  2SGQ I;  5E3Q A;  1HJA I;  2DB6 A;  2CWH A;  1PCE A;  1KBF A;  1WTJ A;  2UVO A;  3R5C A;  5DAE A;  2P6A C;  1PPF I;  4OVO A;  1OMT A;  1UVG A;  3HH2 C;  3R5A A;  5HI7 A;  1FAQ A;  1XA6 A;  2PQ8 A;  2ORV A;  2QQ0 A;  2E73 A;  2YQP A;  4AML A;  1BMO A;  1V1H A;  2NU1 I;  2OVO A;  2XRC A;  1TBO A;  1MJA A;  4UXJ A;  1CGJ I;  2CWG A;  2ODD A;  4L9M A;  1P9Z A;  2SGP I;  2KMR A;  2KMQ A;  3UFF A;  2VRW B;  1N13 A;  1OVO A;  1W3S A;  1SGR I;  2ENZ A;  2KCX A;  3QTL D;  1HDL A;  2JYY A;  1UUC A;  2NU2 I;  2ERW A;  2J9R A;  1SGE I;  1DS2 I;  1OYV I;  2NU4 I;  1AN1 I;  2L7X A;  2ORW A;  1R79 A;  2OU2 A;  1TBR R;  3UOE A;  2X52 A;  2GKR I;  1FY7 A;  2KMP A;  3BJI A;  1CGI I;  5FUW A;  4WP4 A;  1M8C A;  2RIJ A;  1TBN A;  3OXG A;  1Y8F A;  1BUS A;  2JZM A;  3KY9 A;  1WGC A;  1XBT A;  2WGC A;  3PDN A;  4UXI A;  2N71 A;  2OZU A;  2SGE I;  4A24 A;  7WGA A;  1FYB A;  1K7V A;  2RC4 A;  1X4S A;  3VDP A;  1XX6 A;  3FSY A;  2NU0 I;  2SGD I;  1ULN A;  3UGL A;  2JXD A;  1NUB A;  5FUX A;  1FAR A;  1K7U A;  2N52 A;  2QQC A;  3D00 A;  4MPI A;  3UGI A;  1MT1 A;  1LR9 A;  3UGD A;  1ULM A;  3QWP A;  2ENN A;  1SGY I;  2K9H A;  5CCM A;  1PTQ A;  2V1C C;  3FSX A;  5J8C A;  2CJS C;  1WKX A;  1MJB A;  1TBQ R;  2B0U C;  2CWF A;  2ROW A;  5JHW C;  1SGN I;  1KMA A;  2LUY A;  9WGA A;  3QAH A;  1PTR A;  2NU3 I;  2KMO A;  2GKV A;  2LB7 A;  1TUR A;  3GOX A;  5HQ8 A;  3R5D A;  2B8T A;  1UHA A;  2W0T A;  1SGD I;  3RU0 A;  5CCL A;  1KBE A;  1TGS I;  2SGF I;  3SGB I;  2BUS A;  3TOB A;  1UVF A;  5J8F A;  1TOT A;  1HEV A;  1Y1C A;  5FUY A;  1K7T A;  2WVJ A;  5E3R A;  3CXL A;  1Z2I A;  3R5B A;  1H0Z A;  4FKD A;  1SGP I;  2DIP A;  2M5X A;  5FUV A;  3UEY A;  2L8E A;  1CHO I;  1YU6 C; 
#chains in the Genus database with same CATH homology
 1CE3 A;  2N1A B;  3E59 A;  4UXH A;  3MEK A;  1VDD A;  2J87 A;  4HGU A;  1IY5 A;  1V1I A;  1LR8 A;  1X74 A;  3OL0 A;  1U5K A;  3OXL A;  1W4R A;  2WCY A;  4E1R A;  1CT4 I;  1LR7 A;  2GVI A;  2V53 A;  1RFH A;  2JA1 A;  3OVO A;  3TJQ A;  2V1C A;  5EX0 A;  2ELI A;  3E2I A;  4E1P A;  2GKT I;  2YUU A;  3VDU A;  1CSO I;  4SGB I;  1Y1B A;  2F3C I;  2QQE A;  1R0R I;  2JW6 A;  2QPO A;  4JCV E;  5EX3 A;  1OMU A;  1CT2 I;  3SEK C;  3VE5 A;  1HPT A;  2E5R A;  3SGQ I;  1IY6 A;  1KBF A;  3FC3 A;  1CT0 I;  2A20 A;  2LEO A;  1SGQ I;  2OD1 A;  2QQD A;  4GI3 C;  2UZ3 A;  2ARP F;  3RU0 A;  1IW4 A;  1PJU A;  1H0Z A;  1TUS A;  4B6D A;  1Z7K B;  2N17 A;  3OXF A;  3UEJ A;  2FNF X;  1YTP A;  3B4V C;  1TIH A;  1DS3 I;  1M8B A;  2SGQ I;  1HJA I;  2DB6 A;  1PCE A;  5DAE A;  2P6A C;  1PPF I;  4OVO A;  1OMT A;  1UVG A;  3HH2 C;  5HI7 A;  1FAQ A;  1XA6 A;  2QQ0 A;  2ORV A;  2YQP A;  2E73 A;  1BMO A;  1V1H A;  2NU1 I;  2OVO A;  2XRC A;  1TBO A;  4UXJ A;  1CGJ I;  2ODD A;  4L9M A;  2SGP I;  2KMR A;  2KMQ A;  3UFF A;  2VRW B;  1N13 A;  1OVO A;  1W3S A;  1SGR I;  2ENZ A;  2KCX A;  3QTL D;  1HDL A;  2JYY A;  1UUC A;  2NU2 I;  2ERW A;  2J9R A;  1SGE I;  1DS2 I;  1OYV I;  2NU4 I;  1AN1 I;  2L7X A;  2ORW A;  1R79 A;  1TBR R;  2GKR I;  2KMP A;  3BJI A;  1CGI I;  5FUW A;  1M8C A;  1TBN A;  3OXG A;  1Y8F A;  1BUS A;  2JZM A;  3KY9 A;  1XBT A;  3PDN A;  4UXI A;  2N71 A;  2SGE I;  4A24 A;  1FYB A;  1X4S A;  3VDP A;  1XX6 A;  2NU0 I;  2SGD I;  3UGL A;  2JXD A;  1NUB A;  5FUX A;  1FAR A;  2N52 A;  2QQC A;  3D00 A;  3UGI A;  1MT1 A;  1LR9 A;  3UGD A;  3QWP A;  2ENN A;  1SGY I;  2K9H A;  5CCM A;  1PTQ A;  2V1C C;  2CJS C;  2ROW A;  1TBQ R;  2B0U C;  5JHW C;  1SGN I;  1KMA A;  2LUY A;  1PTR A;  2NU3 I;  2KMO A;  2GKV A;  1TUR A;  3GOX A;  5HQ8 A;  2B8T A;  2W0T A;  1SGD I;  5CCL A;  1KBE A;  1TGS I;  2SGF I;  3SGB I;  2BUS A;  1UVF A;  1TOT A;  1Y1C A;  5FUY A;  2WVJ A;  3CXL A;  4FKD A;  1SGP I;  2DIP A;  2M5X A;  5FUV A;  3UEY A;  2L8E A;  1CHO I;  1YU6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...