3TO6A

Crystal structure of yeast esa1 hat domain complexed with h4k16coa bisubstrate inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Histone acetyltransferase ESA1
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 80
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to6A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to6A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to6A02
5DWNA 3IWZA 3KEOA 1GHCA 4MBUA 3L9FA 4KVME 4ZYHA 1U6GA 2NS0A 3NEUA 2V9VA 3EETA 3TDZC 4HLXA 4LG0B 2FQ3A 1PP7U 4QB9A 5LHHA 4BHBA 2BBYA 5IT9Z 1TTYA 5ICEA 3V7SA 2RV8A 2VODA 1I21A 5FFZA 3CO6C 3HHGA 3DSBA 5L3GA 4HZFA 2JDDA 4KIGA 5JI6A 5CJ9A 3V8JA 3P9IA 3DPTA 4FHTA 4GXOA 3MWMA 3WTWC 4KFCA 1HBXG 1BC7C 3PP9A 5HS9A 5KK1A 3G3SA 3IL2A 1WWXA 2DW4A 4G8XA 2B4DA 1MJBA 1KGSA 1IN8A 2GA2A 2V79A 3W6XA 2DU9A 4KDPA 2KJBA 1G6NA 4ON0A 4XPDC 2ISYA 3VOEA 1F9NA 2DBBA 2Q04A 4NF1A 4GO1A 1Z05A 3RKXA 4M9SA 5JQ4A 4M74A 2F5CA 3TKYA 4KUBA 5DYMA 5TRDA 1YGHA 5EEHA 5FO5A 3S2WA 4R57A 1R22A 2PR8A 4HKFA 1KU7A 4UXNA 3F8MA 3D2PA 5F1RA 4KLVA 3DQVC 4N9HA 2VOPA 2STWA 4HF1A 4GYIA 2FEZA 3F6VA 3B02A 3P7NA 2RN7A 4NXYA 2LDUA 4FT8A 4ZYEA 1JE8A 2JPBA 3IKTA 1U6MA 2H5MA 4HX8A 3FM3A 3EDPA 2VC1A 2JTVA 2QZ8A 3H4QA 2FS5A 2TDXA 4HX7A 4PGHA 4IHSA 2KCWA 5FLXK 5HLIA 4OIPF 5JFRA 5ILVA 2HYGD 5IB0A 3RKYA 3E6CC 2O61A 1G3YA 1XMTA 5A2QZ 1DP7P 2YX7A 1I12A 2WV0A 5L3DA 1UHWA 2FE7A 1SD4A 1P4AA 3FB3A 3FXUA 1FSEA 3KZZA 1S60A 5ED4A 3L7WA 3TDUC 1F1ZA 4AIKA 1S8NA 3GW2A 5D6EA 1WWZA 3MCZA 3TOAA 2CW0F 5LBQA 2CFXA 3DNSA 1ZAOA 3E6BA 1S7KA 3REOA 3IHUA 4KOUA 4RS2A 3VFZA 5E1WA 2ZW4A 4L89A 1HW5A 1LQ1A 4MQ9F 5DUIA 2PG4A 5L3BA 2P6SA 2ZW6A 2EV6A 4RGRA 2W25A 4UV8A 3FXTA 2R7DA 2RNJA 4MGRA 3HOSA 4E8OA 2ADUA 4JK1X 2REEA 5DD8A 4RGUA 2D45A 2PN6A 3BPVA 3LAJA 4KORA 2XAJA 2Y0MA 5F6FA 1U3EM 3HOTA 2PBIA 3B73A 1ZARA 2AXLA 1SD7A 4AVCA 1IXCA 3GEZA 1YREA 1XSXA 3QPHA 2EFQA 2WTEA 2OD5A 2Q0YA 4EM2A 4N0BA 2DXQA 5EEGA 2DQLA 1YW8A 2B5GA 5LHGA 1IICA 4XPDB 2QLZA 1RXTA 3SXNA 1U78A 3F72A 3EC4A 3GXOA 4UUVA 2B3VA 3HRMA 2P6GA 2O0YA 4L0ZB 3BJ8A 1BN5A 5H6QA 5LLQA 3FM5A 3FX3A 4EVIA 1SMYF 4YFKF 5H20A 1O7LA 2IJLA 1KU2A 1YR0A 3MGDA 4FD4A 4FX0A 1FWZA 4B5OA 1L0CA 2MC3A 1C0WA 2VE8A 2P5VA 3I4PA 3KLOA 5E20A 2NNNA 2YR2A 3LFKA 3WGIA 2WPXA 4ENJA 3WTZA 2HOEA 1GVJA 2VBQA 2XRNA 3PFIA 4WXCA 4GGGA 3NRVA 4MQVA 1XCVA 2HTSA 4HOBA 4I98B 5HDKA 4JJXA 1UCRA 2HKXA 2MBFA 1YFHA 2Y75A 1YX0A 1V4RA 1Q2DA 3V7RA 3RPUA 4JWPA 5IT9K 3LA2A 1EH6A 4HV6A 5FB2A 4WX9A 2RC4A 2FBIA 3KP2A 4QC6A 2WWYA 4ORFA 1YG2A 2FBKA 4OIOF 1UHMA 2XHKA 3LSTA 3DKWA 3S6KA 4EMSA 1OZPA 2EV0A 3WE2A 1D3YA 2NAZA 3KLNA 2FSRA 4BH9A 4BQAA 1XCBA 3CXPA 5HLHA 3R1KA 2AE6A 4WXDA 3RI4A 2RVCA 5BMZA 1IYKA 3D2MA 2NRAC 3KP4A 2L4AA 4PK2A 5ILSA 1LDJA 3RJPA 5KVRA 1SAXA 4MY3A 1YTYA 1Y9KA 5F48A 2IPQX 3RIRA 1Z6TA 2OB0A 2CGPA 3GFJA 4Y15A 1YLEA 2DFIA 2E1NA 4M73A 1XF8A 4UV9A 1FSHA 1W7PD 1N71A 4HAMA 3VB2A 4LGWA 3LA3A 4XBFA 5CVVA 1IAWA 2P0WA 4MEXF 5IX3A 1PUAA 2VQYA 2VE9A 2PEXA 5E96A 2PFBA 5FFXA 2K7LA 2WPWA 4E2AA 3RYOA 3LA7A 4E0AA 2FU4A 5E8IA 1QBJA 2BE5F 4LLGF 4U0VA 5CVUA 2YPRA 5BS6A 4HDUA 3T8RA 5JVTA 2A3SA 3R60A 4E70A 3GX4X 2B5GB 3G3ZA 5J6XA 1BIBA 1OMIA 1NHAA 1FBSA 4QVTA 1FNNA 2JEVA 4ASNA 3HHHA 3CUOA 3ROUA 4XPLA 4KVOE 2VN2A 4G9YA 1Y7RA 1XGOA 2DAOA 2O28A 1Y9WA 2IVMA 3V8KA 5HDNA 2H6BA 1I6XA 3L00A 4LFUA 3HTSB 1OYWA 3JAMZ 3D3SA 3K0LA 1TQMA 4HV5A 2M30A 3DV8A 1ZRFA 3K2ZA 4Y13A 3W6KB 3FMSA 4UHTA 3M1EA 2D4PA 4NCZA 3GYAA 2WC2A 3GZ6A 1QSMA 3F5BA 5D8KB 4EQQA 2OZ6A 5A2QK 1YS7A 1ZLJA 4IRGA 3I3GA 1SFXA 4G6DA 4Z2YA 1KYZA 2LKPA 4WXHA 1FYLA 4EJTA 1Z7UA 1K4JA 4I7HA 2V6CA 4G7ZF 4CDGA 4P55A 5DV5A 4YIFA 3KFWX 4RB3C 4RAYA 2IA2A 1AWCA 3T8TA 3U9GA 4EM1A 3BJ6A 2J8NA 3PGPA 3I53A 1NSLA 3ECHA 2JDCA 4S04A 4ENKA 1S7LA 1ZREA 1P4XA 3Q9VA 2A69F 2QUFA 4KUAA 3O3KA 2X4HA 2ZJ2A 1P6RA 4CRZB 4U0YA 3UY5A 1M44A 3J81Z 4MTDA 1D8JA 3I9SA 3K9UA 2PMHA 4G7HF 1XE4A 4KMUX 3HRSA 2K27A 4I02A 2HR3A 2PC1A 5L3CA 5LGUA 3ABTA 3ZMTA 3C1DA 1USTA 1TW2A 5LEJA 5CLSA 1WK4A 2A68F 2ZXJA 1ON0A 1P4NA 2OBPA 1U5TC 2BV6A 4FD5A 3R9FA 2CYYA 4L0YB 1YO5C 4HLYA 3JTHA 4IHTA 2HUZA 4I09A 1QQIA 5GCNA 1Z4RA 1R23A 4HQMA 1PU9A 1U5TA 4G94A 1JHHA 2A07F 2G7HA 2IP2A 3RDIA 4L9VA 4XNHC 3I59A 4M85A 1CF7A 2Q44A 2VT3A 4EJVA 4Q5SF 4QBJA 2FMYA 1V3FA 1FLIA 2FXFA 4MNUA 3BJAA 2FA5A 4AB7A 3IKVA 4F7ZA 2NYXA 1GXPA 4U7DA 1IN6A 2DT5A 1QSOA 2OA4A 3S6HA 2R7HA 1BC8C 4PDKA 3R96A 3F0AA 5LGNA 5DUKA 3R0AA 2HEOA 4KOVA 1G3WA 1TW3A 1O3TA 4FD7A 4RGSA 1P2FA 2YSRA 5HMNA 1XGNA 4YIIA 5F64A 2OZUA 2I00A 1L0OC 5L3FA 1IUYA 2HKOA 5HDGA 4PGGA 3T9YA 5KTAA 4G6QA 5H6RA 2L4MA 2UZKA 4ESBA 4KT5C 3F23A 2P5LC 4L9NA 1A04A 3WG9A 3VWDA 5BPDA 3MEXA 4CGZA 2ZMEA 4EGYA 4LB5A 4JD6A 2HTJA 1TBXA 4IJAA 2M45A 3QOPA 2FBHA 2MH2A 3GLXA 2ZO4A 3TO9A 4AVBA 2VBXA 3ZPLA 1FP1D 1BO4A 3GFMA 2KIUA 1DUXC 3D8PA 2ESHA 1BM9A 3BROA 4KOSA 2HGCA 2UXNA 3HSRA 2G0BA 4BHPA 5E1ZB 4BAYA 1XGSA 1MGTA 2BEOA 1IB1E 5D5XB 1JGSA 4RI1A 3C3WA 4CO8A 2FMLA 2L02A 2R1IA 1P92A 1O3RA 2R7FA 2MA3A 3BPXA 4ZZDA 4J3GA 2XUBA 1ZYRF 3RYPA 4ESJA 1U2WA 1MJAA 3AAFA 3N97A 2ZNZA 1F4KA 2HYFA 1S3ZA 1YK3A 2UXXA 1LDDA 1XIXA 1O7FA 1CGPA 4KN7X 4ZH4F 2DTRA 3I5UA 4R79A 2KJCA 1SD6A 2Z99A 2MLKA 3ZMZA 4YRHA 1R1TA 1QSTA 3BJ7A 1O3QA 5ICFA 2K5TA 5AIQA 4H89A 2HDCA 1YS6A 3P9KA 3Q5FA 2P8TA 4KNYA 5FVJA 3QRFF 1FX7A 3B8GA 5H86A 1WQ2A 2ISZA 4M9XA 1IRFA 4KUMA 2DI3A 3VEPA 1RO5A 2CY2A 5FGMA 3PQKA 2Q4VA 4RAZA 1J5YA 4QWQA 3L2CA 2X7BA 3QU3A 3FIXA 2C27A 4A0ZA 2ACJA 1U5TB 1H9TA 3CTAA 3T1BA 1EH8A 1L3LA 2P6EA 4DQ2A 2F5DA 4HX4A 3CXQA 1X3UA 4OLLA 3I59B 1O57A 1U8RA 1CF7B 3JW4A 3E0KA 3EO4A 1IW7F 1R7JA 2QQBA 3F22A 4A5MA 1STZA 3E5QA 3KP6A 1W5SA 2XAHA 1Z4EA 2A61A 3TO6A 4LX9A 1QSRA 1B6AA 4KN4X 1FC3A 3C7JA 2D4OA 2V1DA 1XGMA 3WTSC 3WE3A 4A5NA 4RB2C 2JZYA 5DDGA 2DLLA 2GE3A 3ERED 1M4IA 3QB8A 3EYYA 2ZNYA 5DCMA 2PI0A 3FXQA 3E5UA 3JAMK 4H6ZA 3TTHA 5HLGA 1J59A 3ZMSA 3L09A 2B4DB 3ZMUA 1ON1A 2LNBA 1H0MA 3R61A 4MI4A 3HSFA 2ZMEB 1BOAA 4HA8A 3G8WA 4HYEA 4ETSA 1SFEA 2Z9OA 1S7AA 2B58A 4NSQA 2EK5A 3WTUC 2OQGA 3SXYA 3TT2A 4FD6A 3WGGA 1FYKA 4PSWA 1OR7A 2XAFA 1I27A 2EFPA 3TQNA 2GZWA 2Q8KA 1KU9A 3KKWA 2Z5UA 1HXDA 3HRTA 1IN5A 4KICA 4NHJA 3DF8A 3E5XA 3CLOA 4U0WA 2JLMA 3J80Z 1K78A 1EV7A 3F8NA 4I2OA 2J8MA 4M6YA 2KRFA 4KOTA 5LRRA 4UWJA 4K30A 2E7WA 3J81K 4PK3A 2STTA 5DWMA 2IW5A 3DEUA 4OMYA 3JTGA 3R0JA 2VONA 4EM0B 4UWIA 1I1SA 4XSZF 1PUEE 2GA1A 2W57A 1LEAA 3HIFA 4P9UA 2FSWA 4R1HA 2F5EA 2EB7A 2VC0A 2Z0ZA 4AVAA 4EGZA 1RIOH 2ZPAA 1D8KA 2QBYA 1K6OA 1FOKA 3O6BB 4OINF 1AOYA 1V0CA 4RB0A 4QUSA 3GO5A 2EFWA 1ZH5A 4WF2A 5HS8A 5LRSA 1MJ9A 1YYVA 3I71A 3DFGA 4AG9A 5CVJA 2HZTA 1B9NA 4BNCA 1E2XA 2BL1A 2CG4A 3MZHA 4NQWA 3HUGA 2A6EF 5C88A 3R9GA 2FIAA 3DPLC 3BWGA 3R6SA 4LLNA 1QNTA 4LLLA 2J5OA 2ETHA 4R8HA 3KCCA 1PDNC 3E6MA 2F5IA 2MLGA 4ONUA 4II9A 1XSVA 4AIHA 1Q1HA 2M8EA 2EFNA 3E6DA 4JXRA 2ZFWA 1HKQA 3SHFA 5JR3A 5EC4A 3SZPA 5DCMB 3CUQC 3FXRA 4JLYA 3SQNA 2BGCA 5ICGA 2EA4A 4EV0A 5FLXZ 1Z91A 1ZN2A 2ARHA 4U9ZA 1LNWA 1MDMA 3TCVA 3T90A 3CUQA 4ESFA 5LHIA 1DPRA 1P4WA 4CAVA 4LG0A 4HF2A 4RGXA 4UVAA 1BI0A 1LB2A 2I79A 4U9YA 2Q4YA 3KEQA 3W91A 3DP7A 5E1XA 1KQ8A 3CJNA 1KA8A 2RDPA 3D0SA 1BI1A 4CYDA 4KOWA 3JVNA 4IXAA 2MD5A 3P2HA 2YX4A 3R4KA 3GZ5A 1K78B 5J8FA 3V4GA 5H84A 4L9JA 2GQQA 1NMTA 3C26A 3FBUA 3IRQA 3M9AA 3V8LA 4P9FA 4A6EA 2K4JA 3MFKA 2XKPA 5DCFA 2R3SA 4KOYA 1S29A 4JBAA 3ECOA 3TO7A 3S6FA 3E97A 2QIRA 4EJUA 1QPMA 3LODA 2PR1A 2GAUA 2O03A 2RQPA 2P6TA 1R5HA 4LJZF 2FNAA 5JPHA 1R1UA 1FBQA 3JSPA 1Z6RA 4K2EA 1CM0A 3JUWA 5FD6A 3DDDA 4B09A 3ABUA 2QBYB 3FHZA 4M3SA 4F0YA 2O6GE 1IF1A 3DXJF 2B3UA 1ZGAA 1TIQA 5D4RA 5K5RA 1MZBA 4ZBGA 3T0YA 1UB9A 4XSXF 4IF5A 1TQIA 1VHSA 2QECA 3R95A 2E7XA 3ZJ0A 4UNOA 2G3TA 2QQ9A 1HSTA 1IRGA 3FYNA 2ZKZA 3BLNA 2Z3YA 5TJJA 1Q2CA 3HYIA 2LF8A 4KVXA 1LJ9A 1W4MA 2FRHA 3F3XA 1QZYA 1OYIA 1ZRCA 3SHPA 2MH9A 2IA1A 4ZZLA 2H6CA 4IVNA 2OQRA 4EVYA 2F2EA 3M8FA 3T5XA 3EQLF 4U7BA 4KZTA 2G9WA 1TNTA 3JSOA 1KQ9A 1I1GA 2GIVA 2Z10A 2PJPA 2OAZA 4PSXA 4HNXB 3LAPA 1W7PA 1T6SA 1T0FA 1ODDA 1FPQA 3KETA 2PRBA 4Q47A 5L3EA 4I0BA 3ELKA 3WU0A 4P96A 2ZW5A 1B87A 2W84A 2DPDA 3GY9A 2QM3A 4BYYA 3PZJA 1BIAA 2EJRA 1MDMB 3CUQB 3N7ZA 3VODA 1B9MA 4NEXA 3FRMA 3CXSA 1YW9A 4PV6A 4I0AA 3OOPA 1T98A 1VKCA 2M1BA 1XMAA 3P9CA 1UFHA 2H27A 5D6FA 4ZYGA 4YFXF 3KP5A 4DNCA 3J80K 4KIBA 4YFJA 2K02A 3I64A 3ML6A 2CWEA 3SXOA 2ELHA 2VT2A 2J8RA 4LB6B 1G3SA 5CVIA 1HKTA 4OOIA 1EH7A 5JHUA 2NNYA 2DK5A 2EVNA 3J7AO 3FWEA 4ZYDA 2ATRA 4KA4A 2PDOA 4O6JA 2COMA 2VZZA 4R3LA 1BBYA 2XROA 1SMTA 2J5PA 2PLYA 2GANA 1IIDA 3GKRA 4GYGA 3C18A 1IYLA 3DR6A 4BMHA 3ZN1A 5E8GA 3F21A 4H0EA 2M5WA 2LF7A 3QP6A 2IL4A 2XGXA 4AG7A 3EYIA 4CS0B 1J2XA 1IN7A 1ZLKA 2HQNA 2XASA 5CYVA 1GHEA 2NMTA 1FT9A 4NB5A 3BDDA 2GXBA 3IRRA 1SFUA 4AIJA 4TV7A 5HH1A 5F47A 5K5QA 3HTUA 1J9IA 4HQEA 5IV0A 2FT0A 1J7KA 4FX4A 3TE4A 2DK8A 1BJAA 1ZG1A 4HNYB 1S7OA 1IN4A 4IRHA 2K86A 3BY6A 3KP7A 3MAJA 4M9ZA 3O2PE 1HSJA 2ZCWA 5BQTA 2V1UA 2ZXVA 1D5VA 2R98A 3GFLA 4PCQA 4A6DA 3WTYC 1K79A 4RB1A 4KYWA 3WGHA 2OH1A 4B8XA 4KOXA 4OIQF 3IGRA 3WTTC 2JRTA 2CQKA 5AONA 3M7GA 4LK1F 5D5VB 1R57A 4HW0A 5ICCA 4WK8F 1RUOA 2LSOA 4S05A 1G3TA 4L5IA 3F8CA 5F46A 4R87A 2HS5A 3RTRA 1XB4A 2FXAA 2IA0A 2A4NA 3Q9SA 1J0RA 5K1YA 3K1MA 3F6OA 4XRFA 5ISVA 3MZYA 2CNSA 2GXGA 1W7PB 1YIOA 2A6HF 2KIFA 1KUXA 2QVOA 1FYMA 5EBVA 2Q0OA 3K69A 2P6FA 3RYRA 1M1DA 3WODF 3ZQ7A 4OIRF 3I0TA 1YQAA 4LMYA 2JT1A 1XMKA 4OU0A 1CJWA 1M4DA 4UA3A 1MKMA 5J8CA 3MQ0A 2DQRA 1F5TA 4UVCA 1FY7A 3TOBA 3LD2A 4XNHB 2P7CB 2XAGA 4O3MA 2AS5F 3EUHA 2BSWA 5KTDA 3SFZA 4RS8A 4IPAA 2RKHA 1LEBA 4UVBA 1OPCA 4O5VA 3I58A 3FZVA 1MD0A 1J4JA 1ZGJA 2F5FA 1LVAA 2Q2EA 5HOOA 2Y48A 1IXRC 4U5YA 3BZ6A 3P2FA 1RI7A 1JHFA 4MTEA 4A0XA 4H6UA 3QP5A 4PZJA 4CAXA 5DD4A 1M4GA 2VZYA 3PQJA 4Y17A 4YFNF 1K7AA 3S6GA 2EV5A 4M6XA 2D1HA 4Y49C 1Z9UA 1O3SA 3LQQA 1LRZA 1XD7A 2XKOA 2VBWA 2E1CA 2P7VB 1SQHA 1S5KA 1XDSA 2FCKA 4HNWB 1T38A 4YG2F 4R3KA 2OZGA 2D1VA 3H3UA 4L5JA 4BHCA 1RNLA 4I49A 2BEIA 5D4SA 3ZZIA 5DEQA 1J75A 1LDKB 3K1NA 1DPUA 2VXZA 1QO0D 2W85A 3ULQB 2HQRA 3GWZA 2B0LA 2K4BA 4CZZA 2JPCA 2EWNA 4P5OA 3G73A 1YW7A 1WI9A 3HRUA 4WWCA 2IRFG 4CAWA 1ON2A 1FP2A 3VWEA 1WRJA 2GWRA 1ZRDA 1G4DA 4YGOA 4Q48A 4MY0A 4ENNA 2QQAA 4IRIA 4OADA 2HFHA 2P4WA 2Z11A 3GF2A 2H09A 2JSCA 2B4BA 5CVRA 4U88A 2VXKA 2XVCA 1FZPB 2L01A 2HWVA 1YVOA 3IWGA 3TGNA 4XLPF 1QZZA 1R1VA 2R8VA 1I5ZA 3CO7C 2D2WA 4MHDA 1ZG5A 2W24A 3NE7A 4AD9A 4M71A 3EFAA 3IC7A 4G7OF 4R9MA 1DDNA 3QPTA 2G7UA 2L54A 5AIPA 1T39A 4CHUA 4L18B 2EUIA 4A12A 1E17A 4MEYF 5ILUA 2A5YB 4HF0A 4AVPA 3KP3A 3NQOA 4OMZA 2H94A 4OAEA 3OWCA 2CSOA 1XN7A 2V1XA 2REFA 1HKSA 4KIFA 1Q2YA 1OYYA 3OV8A 1KZFA 1OKRA 3I54A 2HQYA 3LQRA 2FNPA 1S6LA 3FF5A 4N9IA 1IXSB 1XSDA 2Z33A 4CRYB 4L9TA 4F6AA 3RPQA 2FF4A 2VBYA 1QSNA 2EFOA 1MK4A 4B5PA 2BUEA 4AWXB 2DO7A 4ENMA 3SZTA 2M87A 2IT0A 4X5KA 2L3DA 5BOXA 5CNPA 1P0HA 5KTCA 4LD5A 2Q7BA 1PP8F 2BYVE 3WTXC 4A0YA 2X0LA 1HW2A 2XV4S 5K5OA 1BI2A 4KMFA 3GYHX 3WU1B 3GFIA 3ZN0A 1KYWA 2ESNA 4IUSA 3LWFA 1YLFA 3FMQA 1YVKA 1S3JA 1BI3A 3COAC 5LGTA 2QENA 2DPUA 4XPKA 4UBRA 5HVQC 3BP8A 4JQFA 1HW1A 3F8KA 3R9EA 5D8LB 5I0CA 4A2UA 4MHGA 5ERIA 5D5WB 2XAQA 4Y49B 1HQCA 3GUDA 2VEZA 1R36A 1ULYA 1BOBA 1Z9CA 1QGPA 3BOQA 1WKMA 5FD5A 4JXQA 5E17F 2C6YA 2QYOA 1H9GA 4HBLA 1NE9A 2O8XA 3QU6A 2KIMA 2P5KA 1GXQA 2HV2A 1ZHFA 2FIWA 1T2KA 3WR7A 3WTVC 3V7CA 1KU3A 2FOKA 4L8AA 3ZMDA 1RZ4A 2CNMA 1R5GA 2XIGA 3D5LA 3K9TA 1REPC 2VI7A 3EY5A 3KZYA 1B4AA 1RUNA 1I1DA 4XLNF 4QLCU 1USSA 4WCGA 4KLWA 3KE2A 3ZMVA 2UWMA 1XEBA 1R58A 3M8EA 1B1BA 1S7FA 2QMLA 1XDUA 2YU3A 2CNTA 5D5UB 2QWWA 3TFYA 3H3ZA 1Y0UA 3GVAA 4CXFA 4MJ8A 1ONVA 2FE3A 3FNCA 4I01A 2ZBKA 1VTNC 1B59A 4Q4ZF 3HSEA 4D0PA 1TLHB 2CO5A 2VOOA 3RKWA 3ZP5A 3F8FA 3N4MA 2AJ6A 1Z1DA 5HS7A 4IF4A 2RGVA 4CICA 5BPIA 2O3FA 1ZG3A 5F49A 4BXUA 1KUVA 4LK0F 4EJOA 1IZ1A 3W6SA 2PMUA 1R00A 3QAHA 1W5TA 2ZW7A 3V8IA 1S7NA 1FBUA 1KQ0A 1UFMA 3IWFA 4EJWA 1TNSA 4B5PB 1KUYA 2PSWA 3K1PA 3W6JB 3E3VA 5E18F 3DR8A 2KKOA 3CDHA 1B6BA 4HDVA 4M72A 3EXNA 3BJOA 2PQ8A 1WSUA 3U1DA 6PAXA 3F8BA 1SD5A 4LUAA 2EA2A 1TQPA 3FMRA 4GCVA 5C82A 4GS4A 3ISPA 2OZHA 5LEKA 5IT3A 2OU2A 3H92A 2FL4A 2G3AA 2VBZA 3U2RA 1JXSA
chains in the Genus database with same CATH superfamily
4M3EA 1R6RA 5DWNA 2Y0SA 3IWZA 2L7ZA 3KEOA 1GHCA 4MBUA 4RLQA 2WSAA 2HC9A 3L9FA 4KVME 4ZYHA 1U6GA 2AHQA 2E19A 2NS0A 5IY5H 4XLFA 1MH3A 3NEUA 2V9VA 3DBHB 3EETA 3TDZC 4HLXA 3IAS2 4CYPA 3I4NJ 4LG0B 3V38A 2FQ3A 2IXSA 1PP7U 3GOXA 4QB9A 5LHHA 1WPKA 4BHBA 2BBYA 5IT9Z 2GIZA 1CHOI 2HVRA 1LFWA 4L9MA 4SGBI 1TTYA 3SDGA 3TP3A 4FISA 3U1KA 5ICEA 3V7SA 5AG5A 2RV8A 2VODA 2FJ1A 4B14A 2XRCA 3CQZJ 3KQZA 4B13A 1I21A 5FFZA 4Y3OA 1MNDA 3CO6C 2JA6J 4E1RA 3FSXA 4AYBN 3HHGA 3K70C 3DSBA 5L3GA 3PM1A 5E3RA 2E2HJ 4HZFA 2JDDA 4KIGA 1P9QC 2F8HA 4P4FA 5JI6A 1ARMA 5CJ9A 3KZWA 3V8JA 1WI3A 9ANTA 3P9IA 3DPTA 2QJ8A 4CUGA 1BW5A 2V8GA 4XOTA 4FHTA 4GXOA 2RREA 3MWMA 2YNCC 3CJTB 3WTWC 4KFCA 1HBXG 1WKXA 1BC7C 3HKZA 3IUOA 2CUJA 3PP9A 5HS9A 2LREA 5KK1A 5IOYA 4X6AJ 3G3SA 2WB1N 2DDBA 3IL2A 4B47A 1WWXA 5FUXA 2DW4A 4RAGA 1X58A 4G8XA 2B4DA 2AXTC 1ZLHA 1MJBA 4BQOA 3QODA 1KGSA 1IN8A 2IS4A 2YNCA 2M0MA 4MFQA 4Q36A 1ORKA 2EIKH 3PJRA 5E79C 4IOCF 1M8BA 2GA2A 3Q0UA 4BQQA 1DE4C 2QYVA 2V79A 4XMYA 4Y52J 2DU9A 3W6XA 4KDPA 2KJBA 3D00A 3IWWA 3CF2A 4F92B 1G6NA 4PXDA 2YNEA 1NXUA 2X85A 2EILH 1RKWA 4ON0A 4XPDC 5K8MA 3QYEA 2ISYA 3FEDA 4P4DA 4ZTJA 5B1BH 3FXJA 3VOEA 3F0CA 1YQEA 1W0UA 1F9NA 1IC8A 4OC5A 3DLJA 2DBBA 1ZG8A 2Q04A 4NF1A 3D5SC 3CCYA 4GO1A 2E2IJ 1CGJI 1Z05A 3RKXA 1SANA 4M9SA 2Z3OA 1V5GA 5JQ4A 4M74A 3OXGA 2ECBA 2F5CA 3AG3H 2HDWA 2Z3MA 5LYIA 4A33A 3TKYA 4KUBA 5DYMA 1IOFA 2SGDI 5TRDA 1YGHA 5EEHA 2HDDA 1RR7A 5FO5A 3S2WA 4R57A 1R22A 3DBLB 2PR8A 4HKFA 1S9HA 1KU7A 4UXNA 1IDZA 3F8MA 4M3BA 3OSGA 3LNQA 3SEKC 5F1RA 3D2PA 2Z2SB 4KLVA 3DQVC 4N9HA 2QQDA 2VOPA 2A5WA 3FKIJ 2STWA 4HF1A 4GYIA 1TZLA 2FEZA 1V1IA 2JN6A 2Y2ZA 2Z3NA 3F6VA 1JUMA 1MW7A 3B02A 2RN7A 3P7NA 4I6ZA 1BPNA 2LDUA 1TKHA 4BKXA 2BO9A 4NXYA 4FT8A 4ZYEA 4A94A 1FEXA 1JE8A 4GI3C 2FX0A 1YTPA 3ZQCA 2JPBA 2PX9A 3IKTA 1Y1BA 5A28A 4GFBA 1U6MA 2H5MA 4HX8A 2JQ7A 1WGTA 2DFHA 3FM3A 2XF7A 3EDPA 4UFXA 2VC1A 3HC7A 1N77A 1CT2I 5EF6A 2EK9A 4IO9F 1VFCA 1ZG9A 1QHHD 4E7KA 2JTVA 1P9GA 2JA8J 3OMYA 3K4KA 2LTPA 1FTTA 2QZ8A 4A38A 1ZLIA 3H4QA 2FS5A 2TDXA 4HX7A 4HEA2 3BZCA 4PGHA 2DCEA 1TP4A 1AYEA 2OTJI 4IHSA 2KCWA 2CQ7A 5FLXK 5HLIA 2QA4I 2ZJPF 4B44A 2VJ4A 2LK2A 3S2HJ 4OIPF 2RB7A 2YGWA 1LFPA 2CQQA 2E5NA 5JFRA 2NVQJ 1CT0I 3FBIB 3HGGA 5ILVA 4A3GJ 3S16J 4R8FA 2HYGD 5G21A 1HDDC 5IB0A 1BR4A 3RKYA 3E6CC 2O61A 1G3YA 2GKRI 1XMTA 5A27A 5EDNA 3ONQA 3MN2A 2J9RA 5A2QZ 2ZEEA 1WJAA 1DP7P 2YX7A 1I12A 2MABA 2WV0A 4IX7A 1CP7A 1KONA 4IL6C 4A3JJ 3B4VC 5L3DA 1UHWA 2PVVA 2L9SA 1PPFI 4HSRA 2FE7A 1SD4A 4F52A 1P4AA 3FB3A 1IG7A 2EZIA 3MD2A 3FXUA 3OYNA 4A69C 2RIJA 1X2NA 2E71A 1FSEA 3KZZA 1FYBA 3CCSI 1S60A 5ED4A 3L7WA 4A32A 1W5CC 3TDUC 1F1ZA 2LVSA 2NVTJ 4AIKA 1S8NA 2QKMB 3GW2A 5D6EA 1M8CA 3A0HC 3H3VK 3CC4I 1F57A 2SGEI 1WWZA 4MFPA 3MCZA 4MLOA 2IBDA 2LMDA 3TOAA 2CW0F 5LBQA 2CFXA 1JKOC 3DNSA 1BR1A 1ZAOA 3AG2H 3E6BA 1D5YA 1S7KA 3REOA 5JM6A 3IHUA 3QYFA 4NGTA 1T8IA 4KOUA 3FJUA 4D1QA 2A6TA 4RS2A 3VFZA 5E1WA 3SEZA 3GTJJ 2X1EA 3KY9A 2ZW4A 3JRUA 4L89A 1HW5A 2EZLA 1LQ1A 4MQ9F 5DUIA 2XSJC 3FC3A 2PG4A 3KYDB 1FIAA 5L3BA 2P6SA 4CPAA 2ZW6A 2EV6A 5BWAB 4BXFA 3JRBA 2X1CA 1VQOI 4RGRA 2W25A 4UV8A 3FXTA 2R7DA 1TOTA 4ZYAA 1ULKA 4R7MA 2R7TA 2AFXA 2IQ6A 4IAVA 2RNJA 2TCTA 1JKPC 4MGRA 3HOSA 4E8OA 1MT1A 3VWBA 2ADUA 4JK1X 1CG2A 2REEA 2ELJA 2LLKA 4RGUA 2VB6A 5DD8A 3HBLA 2CV1A 4IKFA 2D45A 1LR8A 1V5FA 3FF3A 3MN8A 2PN6A 3BPVA 2CQNA 3LAJA 4KORA 1TXRA 2H8RA 4J19A 2XAJA 3ZQFA 2Y0MA 2G0EA 5DS9A 4YU9A 2BY0A 4B10A 5F6FA 3OYJA 1U3EM 4A3FJ 4IHMA 3B2YA 2OV7A 3HOTA 4R76A 2DYRH 2PBIA 2VL1A 3B73A 1ZARA 2AXLA 1SD7A 3HM5A 1OCOH 3OYMA 1IXCA 2KISA 2D5VA 4AVCA 3GEZA 2MW8A 2BHYA 1YREA 1XSXA 3QPHA 2EFQA 2LG4A 4BU2A 1MH4A 2WTEA 2KZVA 2OD5A 2Q0YA 2XRLA 4EM2A 4FKDA 1CBXA 1E3HA 4N0BA 2DXQA 4F8ZA 1FOWA 5EEGA 2NU1I 2DQLA 3A9LA 1YW8A 2B5GA 3OIQA 5LHGA 1IICA 2DPTA 4XPDB 2QLZA 3TP0A 1ACIA 5IYBJ 5CKTA 3AG4H 1TBRR 1RXTA 3MVPA 3G1LA 4JZ0A 4D9JA 3J7YJ 3SXNA 1U78A 2ELIA 3F72A 3EUAA 1X3ZB 3EC4A 3GXOA 5JHFA 5C4JJ 3UGIA 3B3WA 4MFJA 3CF5F 4UUVA 4MCPA 3CLQA 1A6IA 2IGMA 2KMPA 2B3VA 3L2NA 4CAEA 5K8PA 3HRMA 2NU4I 2ZEOA 2K5CA 2P6GA 1VQPI 1LR7A 2OOTA 2O0YA 4L0ZB 3BJ8A 1BN5A 5H6QA 5LLQA 1PTRA 2OUMA 3FM5A 1NG7A 3FX3A 4EVIA 5LFAA 1SMYF 4YFKF 5H20A 1O7LA 2IJLA 4CGOA 1KU2A 2X6YA 4FASD 2E73A 1YR0A 3MGDA 3I3LA 4K3NA 3TC8A 3BTCA 4FD4A 4FX0A 1FWZA 1RFHA 4B5OA 3B6CA 1X3WB 1L0CA 1UZCA 1JKRC 3BR3A 2MC3A 4C7IA 1C0WA 2VE8A 2P5VA 1JUPA 3I4PA 3KLOA 2OJED 4ZC3A 5GPAA 4ZDPA 5E20A 1BA5A 3CCJI 4II3A 2NNNA 2F3CI 2YR2A 1WJDA 3LFKA 3WGIA 3SYTA 2JA1A 2WPXA 2RAEA 3BG3A 1BR2A 2DT6A 5LD2C 2XDVA 2ZEMA 3LMMA 4ENJA 3OYAA 2WAEA 1F43A 3WTZA 5HODA 2HOEA 1GVJA 5E3LA 4M6IA 2VBQA 2NVYJ 4BY7J 3OYCA 4C7HA 2XRNA 2ZB9A 3PFIA 1GDTA 4JP0A 1Y56A 1D0YA 4WXCA 4GGGA 3S14J 2GM4A 1LFUP 3CCUI 3NRVA 3D4UA 4MQVA 1XCVA 1RRJA 3PFEA 2HTSA 4HOBA 4I98B 5D8NA 5HDKA 3IV5A 2Z3PA 2Y9ZA 4B6DA 4JJXA 4PXCA 3SJGA 1K7TA 1UCRA 2ID6A 2HKXA 4UCMA 2MBFA 4BE0A 1YFHA 2Y75A 1YX0A 1V4RA 2M2EA 4F55A 5FJ8J 3LACA 1Q2DA 2DMNA 4IHVA 4PFOA 1JQGA 3V7RA 2FVGA 3FVLA 3RPUA 4JWPA 5HLTA 1WH7A 1AU7A 3LA2A 5IT9K 1EH6A 2ENZA 4HV6A 2TRTA 2VASA 5FB2A 3PSIA 2WAQA 2NVXJ 4GRIA 4WX9A 5EZHA 4MCSA 2RC4A 4P45A 1X12A 1TGSI 2PIZA 2DOAA 2FBIA 3KP2A 4QC6A 4GXHA 2ZEDA 2WWYA 4ORFA 4CYCA 1YG2A 2FBKA 3CCVI 4OIOF 1UHMA 2I10A 2L7XA 3SJXA 2ZEHA 1YITI 3OWTA 1CPSA 2XHKA 5B5EC 3BR2A 3LSTA 3NARA 2FUG2 3DKWA 3S6KA 4EMSA 3ZCOA 1OZPA 2EV0A 3NH5A 3WE2A 5KAIC 1D3YA 2NAZA 3KLNA 2FSRA 4BH9A 3I1UA 3H5RA 4PK4A 4QPQA 1SVLA 4BQAA 4G1PA 1XCBA 2EIMH 3CXPA 5HLHA 3R1KA 2UV1A 2AE6A 1BUSA 5ELYA 4WXDA 3RI4A 3MKLA 2RVCA 3ZQQA 2CUFA 4XLHA 3UEJA 5BMZA 1IYKA 1K6YA 3D2MA 1FT7A 2LFBA 2FOWA 2NRAC 4UXJA 4CCMA 1YE9A 3K2AA 3KP4A 2L4AA 3FK6A 1IV8A 4C2MJ 2H1KA 4PK2A 1GV2A 4CGLA 5ILSA 1LDJA 3RJPA 5KVRA 2XEGA 4RN7A 1ZTRA 1SAXA 4UB8C 4FETA 4MY3A 1YTYA 3QWLA 4XKBA 3RSNA 3AFHA 3CZXA 1RESA 1Y9KA 1I3AA 5F48A 2IPQX 5AGEA 4X3RA 3RIRA 4QPOA 2WCYA 1Z6TA 2VPRA 1H8LA 2CGPA 2OB0A 3GFJA 4Y15A 1YLEA 2DFIA 2E1NA 4M73A 3PRTA 1XF8A 2PJ6A 4UV9A 4RLFA 1FSHA 1JTXA 1W7PD 2KP6A 4HAMA 3CCQI 3OXFA 1N71A 3PBBA 3VB2A 2GLJA 3ASNH 1U9OA 2E5RA 1LVKA 4LGWA 3LA3A 4XBFA 2O7OA 1ZKGA 5CVVA 1R9TJ 2PJ8A 1LFBA 1VQ7I 1IAWA 2P0WA 4MEXF 2NOJB 4XR6A 5IX3A 1PUAA 1RTQA 2VQYA 2VE9A 2PEXA 4DJAA 5E96A 5CBMA 2PFBA 4XORA 5JLXA 1CSOI 5FFXA 2K7LA 4NUBA 2WPWA 4XM3A 4E2AA 3FDYA 1OCZH 3A03A 5IYCJ 3RYOA 4NDLA 1HC8A 3LA7A 2V8HA 2BL1A 1SAUA 1X4PA 1KZHA 4E0AA 4AYBA 2FU4A 4I76A 5E8IA 2JA7J 4DZPA 1QBJA 2BE5F 4M6HA 4LLGF 4U0VA 5CVUA 2YU9J 2M4KA 2YPRA 5BS6A 4NGPA 3DLAA 4HDUA 3T8RA 5JVTA 2A3SA 3DLLF 1X19A 2MSYA 4PXBA 3R60A 4E70A 1Z8XA 3GX4X 1H8AC 2B5GB 3RZAA 3G3ZA 2E5ZA 5J6XA 3MZ8A 5GPCA 1Q9BA 3KL9A 1BIBA 4NC7A 1TT0A 1SGNI 1OMIA 1NHAA 2BOAA 5AG6A 4F0XA 2IGNA 1FBSA 1OCRH 3AG1H 1FNNA 4II2A 4QVTA 2JEVA 2WB1A 2VPLA 1JI8A 4ASNA 4BJ5C 4B12A 3HHHA 2OTLI 1XTAA 3CUOA 5FROA 5KAFC 1CGII 2QQCA 3ROUA 4A93J 4XPLA 4KVOE 3ABKH 1MBEA 2VN2A 4G9YA 3UKGA 3FXMA 1XGOA 1Y7RA 3GIUA 2L0KA 2DAOA 2O28A 1Y9WA 2IVMA 3V8KA 1G59A 4XOPA 2JSPA 5HDNA 3H5AA 5FKMA 2H6BA 1I6XA 2LB7A 2UVOA 3L00A 3NH8A 4LFUA 3HTSB 3H8FA 2O53A 4NJRA 1HEVA 1OYWA 3JAMZ 1OVOA 4P1WA 4YEJA 3R5DA 2M8GX 3D3SA 3IO1A 2P81A 4C2UA 3K0LA 1TQMA 4XRSG 3EUKL 5TISC 5M5WJ 2R7SA 1OQYA 4HV5A 1R0RI 1R3NA 4UEZA 2M30A 3DV8A 1BAVA 1ZRFA 3OXLA 4A24A 2JMWA 3K2ZA 3OL3A 3W6KB 4Y13A 3FMSA 3RQ4A 4UHTA 3M1EA 1TC3C 2BZTA 2D4PA 4NCZA 2PRQA 3GYAA 2WC2A 3GZ6A 1QSMA 3F5BA 2EO8A 3W2AA 4ZX9A 4ZJZA 5D8KB 3HOUJ 1G2HA 3FXKA 3S17J 1VGYA 4EQQA 2OZ6A 3LOCA 2JVHA 2OD1A 1X1CA 2ECCA 5A2QK 3BI1A 1YS7A 1ZLJA 4IRGA 5J3LA 3I3GA 5LRGA 2XGDA 2DB6A 1SFXA 3UOEA 2MFZA 4G6DA 4Z2YA 1KYZA 2LKPA 4WXHA 1FYLA 4EJTA 5FUYA 1Z7UA 4ZI6A 2IMOA 4U87A 1K4JA 5F27A 2SGFI 3HOXJ 4I7HA 1LPQA 3S3OA 2V6CA 4G7ZF 4XRMA 1HEEA 4KSFA 4CDGA 1W36C 4P55A 5F0CA 3FEEA 2KRCA 1IUFA 3R5BA 5DV5A 4YIFA 3KFWX 2LH9A 3BJIA 4E4HA 4RB3C 4RAYA 1E3OC 1HJAI 2IA2A 1AWCA 1AN1I 1Y1CA 3T8TA 3U9GA 3VYRB 3BJ6A 4EM1A 4HSTA 3I53A 5M5XJ 4B43A 5E3PA 3ECHA 1NSLA 4MHYA 2V1CC 2JDCA 4CYQA 2ZOFA 4DIQA 2L7MP 4AC0A 1X1PA 4HRIA 3KGQA 4S04A 3JRCA 2CH0A 3OYDA 4ENKA 2ORVA 4PJ0C 1S7LA 1ZREA 1VDDA 1P4XA 3Q9VA 2A69F 2QUFA 2PJCA 4KUAA 3O3KA 2X4HA 1XPXA 3HJEA 2K9HA 2WGCA 2ZJ2A 5J4YA 1P6RA 2HQ5A 2V1CA 3QAYA 3FKJA 3CMYA 2PJAA 4CRZB 4U0YA 3UY5A 2V77A 1NSAA 4P4BA 1M44A 3J81Z 4MTDA 1D8JA 1XRYA 3I9SA 1X4SA 4IK2A 4C30A 1X1AA 2BY3A 2PMHA 1WJCA 4G7HF 1LE8A 3OYIA 3K9UA 1TWFJ 1XE4A 2DODA 4KMUX 2OCEA 3HRSA 2K27A 4I02A 2HR3A 2PC1A 5EG0B 4YIRX 2BCOA 5L3CA 5LGUA 3ABTA 4PJNA 3ZMTA 1A6QA 3C1DA 1USTA 1TW2A 5LEJA 2WBMA 2B9SA 3Q3SA 5CLSA 2ARPF 1IY6A 1OCCH 4BE2A 1UELB 1IGNA 1WK4A 2KDOA 2A68F 3SGQI 2OVOA 2ZXJA 4X1EA 1ON0A 1P4NA 2EQRA 4CYOA 1QRYA 2OBPA 1U5TC 2BV6A 5J40A 4FD5A 3R9FA 2CV2A 2CYYA 2HNHA 4L0YB 1YJNI 1YO5C 1Y0YA 4Y33A 2JXDA 3QQAA 4HLYA 3JTHA 3GLJA 3E0JB 4IHTA 3PEIA 2HUZA 4I09A 1GV5A 2HYJA 3HUVA 1WVRA 1QQIA 5KHDA 4YRVA 1Z4RA 5GCNA 1R23A 4UY8I 1AHDP 4HQMA 1PU9A 1TWHJ 1U5TA 1YOVB 3PFYA 1MBGA 5FLVA 3AL0C 4G94A 1LKXA 1MBKA 1JHHA 1QMUA 4W1UA 2A07F 2G7HA 2IP2A 3RDIA 1Z0XA 4L9VA 3SJEA 4XNHC 3ABMH 3I59A 2QCOA 5EJCA 1GT0C 1CF7A 4M85A 2Q44A 2VT3A 4EJVA 3BXMA 2F4IA 4Q5SF 4QBJA 3S32A 1VNDA 2FMYA 2B0UC 1V3FA 2UZ3A 1FLIA 2FXFA 4V2GA 4MNUA 3BJAA 4BUPA 2FA5A 1VIXA 4AB7A 3IKVA 3BQZA 4F7ZA 2NYXA 4A95A 2X9DA 1GXPA 4U7DA 3S15J 3S8PA 4OIWA 1IN6A 1V55H 2DT5A 2OA4A 1QSOA 1TKJA 2H1LA 3FISA 2CIJA 2R7HA 1BC8C 4PDKA 3R96A 2QVPA 3VDXA 1ITYA 2AFUA 3F0AA 5LGNA 5DUKA 3R0AA 3QTLD 3IU2A 8CPAA 2NU2I 2HEOA 4KOVA 1FTZA 1SGPI 1G3WA 1TW3A 2GVIA 1O3TA 4J00A 4FD7A 1P7JA 3IH2A 4RGSA 1P2FA 2HPIA 2YSRA 4PQAA 3GTOJ 5HMNA 1XGNA 1DGWY 1HCRA 2QSHX 2ZMEC 4YIIA 5F64A 2OZUA 3H9JA 1F2OA 2I00A 1L0OC 4AU7A 5L3FA 4ZDOA 1IUYA 2PJ5A 2ID3A 3SZGA 5DAEA 1Z3YA 2EIJH 2HKOA 5HDGA 3L2QA 4PGGA 3T9YA 5KTAA 2GU2A 3PUBA 4G6QA 3BR1A 5H6RA 1QQ9A 2L4MA 2UZKA 4ESBA 4KT5C 3F23A 3EPZA 3HL2A 2P5LC 3NH4A 3GBGA 4L9NA 1A04A 3PB4X 1W3SA 4ZX8A 1JJ6C 4ZY2A 3WG9A 3VWDA 5BPDA 3MEXA 4CGZA 2ZMEA 4EGYA 3OYHA 4LB5A 4JD6A 2HTJA 3MKWB 4P6YA 1TBXA 4XN0A 4MMOA 1PJUA 5E3MA 1V1HA 4IJAA 2M45A 5FUWA 3M3YJ 3FSYA 3QOPA 1HDPA 2FBHA 2MH2A 2NYQA 1UAAA 3ABLH 2ZO4A 3GLXA 3TO9A 2R7UA 1Y7EA 3ISZA 3N5FA 4AVBA 1CT4I 2VBXA 4HNUA 3ZPLA 1UVGA 7WGAA 4NGSA 1NK3P 1FP1D 1BO4A 3GFMA 4OWRB 2LKXA 2KIUA 1AKHA 1DUXC 1MNMC 4NGNA 3D8PA 2ESHA 4L5EA 3UNGC 1BM9A 4E7SA 3K4BA 3BROA 4KOSA 2YUSA 2HGCA 2UXNA 2JUGA 3HSRA 2G0BA 4BHPA 4CZCA 2EPFA 2KT0A 3SI1A 5E1ZB 3PSFA 3UEYA 4UUTA 4BAYA 1XGSA 1MGTA 2LY2A 2BEOA 1DQUA 1IB1E 4CH7A 1LANA 3RNZA 3RQIA 5D5XB 4JOMA 2B8TA 4UXIA 1JGSA 2VRWB 3DKYA 2M5XA 2DYSH 4RI1A 3C3WA 1SFOJ 2J9AA 4EWTA 4CO8A 2FMLA 4NJQA 2L02A 2JJ7A 2VKVA 2R1IA 2X6OA 1UG0A 5G20A 1P92A 1U5KA 1O3RA 1ETYA 2R7FA 2MA3A 5EEAA 4A31A 3BPXA 4ZZDA 1JKQC 2QQEA 3SGBI 2ANPA 4J3GA 2XUBA 1ZYRF 2BOLA 2OF7A 3RYPA 2ICWG 4ESJA 1U2WA 2AFOA 4IHXA 1MJAA 1VQNI 5M3FJ 1XX5A 1VQ8I 3KX2A 4JX4A 3AAFA 3OYKA 3RAMA 1E3PA 3N97A 1JT6A 2ZNZA 1F4KA 2HYFA 3TW7A 1SGDI 1S3ZA 1YK3A 2F48A 2UXXA 2LY9A 1LDDA 1XIXA 4OC1A 4B6ZA 1O7FA 1CGPA 4KN7X 4ZH4F 1IW4A 2DTRA 1BLLE 2M34A 4MCQA 3I5UA 4R79A 4ZTFA 3L2VA 2KJCA 2RQQA 1SD6A 2Z99A 1ETXA 1I3QJ 1QVTA 2MLKA 3C2HA 3ZMZA 2B63J 2AQFA 1A5JA 1X2MA 4A2ZA 4ZY1A 4YRHA 1R1TA 2WY7Q 4A3CJ 1QSTA 2I3CA 1YX3A 3DWLE 1WJFA 1ZELA 3BJ7A 1O3QA 5ICFA 1W0TA 1SGYI 2K5TA 5AIQA 4H89A 2HDCA 1YS6A 3P9KA 3Q5FA 1MMGA 1VF9A 2P8TA 2XAUA 3DBRB 4H4KC 4KNYA 5FVJA 3QRFF 2BW3A 2VI6A 3U21A 5E3QA 1FX7A 1MMNA 1J09A 4OC3A 3ZXSA 3BCBA 3OYBA 1Z2LA 3B8GA 1WQ2A 2ISZA 4M9XA 5H86A 1IRFA 2E60A 3H0GJ 2YUUA 4C2ZA 2KCXA 2CXAA 4KUMA 5JHWC 4F91B 1U0JA 2XPVA 3BR0A 2DI3A 2IEKA 3VEPA 1RC9A 5K7FA 4XRSA 3CMAI 1RO5A 5FGMA 2CY2A 3PQKA 2Q4VA 2ZJQF 4RAZA 2DPSA 1J5YA 4QWQA 2R7VA 2IS2A 2LP0A 1VQKI 3L2CA 2X7BA 3D67A 3QU3A 1M4LA 2ZELA 3FIXA 3RO0A 2C27A 3KR4A 4A0ZA 2ACJA 2JA2A 3OIPA 4LITA 3GTKJ 1Y39A 1U5TB 4J01A 1H9TA 3CTAA 3T1BA 1IV6A 1EH8A 4X2TA 2CJJA 2E35A 2M7AA 1L3LA 2W00A 2P6EA 4UF4A 4DQ2A 1P7IA 2F5DA 2LRDA 4HX4A 1X1BA 3CXQA 1X3UA 5IP7J 4OLLA 1OBRA 1CX8A 3I59B 3MMYB 1O57A 4JX5A 1U8RA 1CF7B 3JW4A 3E0KA 3EO4A 1LOKA 3SI0A 1IW7F 1R7JA 3GTQJ 2VJIA 5J4VA 2QQBA 3AL0B 3ZOBA 3F22A 4A5MA 3K4MA 2K9LA 2X6XA 1STZA 3E5QA 1DU0A 3IWEA 1XA6A 3KP6A 1MMDA 1W5SA 2CQXA 1JTYA 2XAHA 1Z4EA 2A61A 3TO6A 4LX9A 4KITB 3BG9A 4V2FA 1B6AA 1QSRA 4KN4X 2DA2A 1TWGJ 4XNFA 3TMOA 1FC3A 2AFSA 2QF7A 3CP8A 3JCUC 3C7JA 2Y30A 2D4OA 2V1DA 1XGMA 2POKA 2R5ZA 4DYQA 3WTSC 3WE3A 4A5NA 2ME0A 3V42A 2JZYA 5DDGA 4RB2C 2DLLA 2VQCA 2GE3A 3ERED 3CPXA 1M4IA 3QB8A 3BCAA 3EYYA 2A20A 2ZNYA 4RM3A 2EWBA 5DCMA 2J87A 2C6CA 1TBQR 2PI0A 3FXQA 1ZGWA 3E5UA 4XKCA 4RMNA 4ABZA 3JAMK 4H6ZA 3TTHA 5HLGA 1J59A 3PB6X 3ZMSA 1T95A 3L09A 4KISA 3KASA 1GLNA 2B4DB 2CTBA 3PUFA 3ZMUA 3PNVA 3H35A 1OCTC 3SJFA 1ON1A 4XONA 2XF6A 2R5YA 4CSWA 1SGQI 3CC2I 1QHGA 2LNBA 4KJZA 1A36A 2PJ1A 1H0MA 1A2ZA 1T56A 3IEHA 3R61A 4MFDA 3J7ZI 3K4LA 4BS9A 3JRAA 4MI4A 2JBKA 2PJ4A 5DM6F 3HSFA 1PJRA 1K61A 4A3LJ 2ZMEB 1WH5A 1BOAA 4HA8A 2R92J 3G8WA 4HYEA 4ETSA 3PBEA 1SFEA 4C9YA 4CCKA 1OR7C 3DTKA 2Z9OA 5B3SH 3NA6A 4KSIA 1S7AA 2HVSA 2B58A 3CDIA 2DOEA 4AM3A 4NSQA 2EK5A 4CGNA 3GCMA 4F93B 2SGPI 3LSJA 3PGPA 2X51A 4BINA 4RA2A 2OQGA 3O8HA 3WTUC 3SXYA 3FK7A 3TT2A 4FD6A 3H5NA 3WGGA 1FYKA 1AKHB 3GLLA 3FECA 4TWEA 1S72I 4PSWA 4TNUA 1OR7A 3FXLA 2XAFA 1I27A 2KLOA 2EFPA 3G1OA 3TQNA 2CV0A 3WABA 3QYBA 1VQLI 2GZWA 2Q8KA 4XLCA 1KU9A 3KKWA 2Z5UA 3PL8A 1HXDA 2VKEA 1Z77A 5CPRB 5LRJA 5E3NA 1PCAA 3HRTA 4A39A 4CGMA 3S6HA 3OOUA 1IN5A 4IHWA 2GFQA 4KICA 1R4MB 2V9KA 5CPAA 1T08B 4NHJA 3VYSB 4C3IJ 5CQGA 3S9NA 2MG4A 3IH4A 3DF8A 1YRNA 3E5XA 4B3XA 3CLOA 4U0WA 1Z8TA 2JLMA 3IJ3A 2PJ0A 3J80Z 1OFCX 3S2DJ 2JZMA 1K78A 1EV7A 3F8NA 4FE7A 3SI2A 2NSMA 4I2OA 2J8MA 4M6YA 2KRFA 4KOTA 3OR2C 5LRRA 4UWJA 3BHXA 4DGWB 4K30A 2E7WA 3S1RJ 3J81K 3B3SA 2STTA 4PK3A 5DWMA 2IW5A 3DEUA 4OMYA 3B3CA 1Z21A 3JTGA 2F4MB 4XK4A 1PYTB 5EX3A 3ERMA 2IS1A 3R0JA 2VONA 4MFKA 4EM0B 4C2XA 4UWIA 3GTGJ 1I1SA 4EATA 2L9VA 3P5JA 1ELLP 2J8NA 4XSZF 4OIDA 1JJ8C 1PUEE 2R93J 2GA1A 2W57A 1RETA 2L7FP 1LEAA 3HIFA 1V54H 2I8DA 2FSWA 4R1HA 4P9UA 1VQMI 1ULNA 2XGCA 2ZEPA 4RM2A 3PB8X 2F5EA 2EB7A 3LSIA 2VC0A 3BR6A 1XJOA 2Z0ZA 4AVAA 4EGZA 2DFEA 3KHXA 1SFKA 2BXZA 2VQGA 3HOZJ 1TWAJ 1RIOH 2ZPAA 1YJ9I 3UGLA 1D8KA 2CW8A 2BW3B 2K9SA 3DGVA 4BEHA 2QBYA 1K6OA 1FOKA 1BW6A 1Z5RA 1BL0A 3O6BB 1Y8RB 2C6GA 4OINF 1AOYA 4MO7A 4QTRA 2ERWA 1V0CA 5G1ZA 4RB0A 3X2QH 4RBOA 3VYUB 2X48A 3CC7I 1S20A 4QUSA 3GO5A 2EFWA 5DM7F 4C68A 1YJWI 4FBEA 1ZH5A 5GTIC 2DA4A 3ESWB 4KS9A 4WF2A 4Y7NJ 5HS8A 5HNFA 5LRSA 1MJ9A 1YYVA 3I71A 4M6VA 2CWHA 1WGXA 3DFGA 4AG9A 4ITVA 4O23A 3D5RC 4MFEA 1TF9A 4W9YA 3D7FA 5CVJA 2HZTA 3LWUA 4MHPA 1F36A 1B9NA 4C3JJ 1E2XA 5HNHA 2CG4A 3IP4B 3I55I 3MZHA 4BNCA 2HZDA 2LBFA 3HUGA 2A6EF 4NQWA 1N78A 4MPIA 1VHOA 2WZNA 4EEFG 3F9KA 4Q7AA 3WT4A 2JA5J 5C88A 1NK2P 1WCMJ 3R9GA 4AMLA 5LYFA 5KNLA 2KHMA 1SGRI 4PJLA 2FIAA 2BHZA 3DPLC 3BWGA 3R6SA 4LLNA 1QNTA 4NNJA 2F4OB 4LLLA 2DXIA 3S93A 2Y9YA 2J5OA 1N75A 3QOEA 2CWGA 1YHQI 2I5UA 3VH9A 1UG2A 2ETHA 3CZ6A 2Q51A 1EE3P 3PO2J 4R8HA 3KCCA 3SJMA 2HPMA 2M0CA 1PDNC 1U8BA 4BBRJ 3E6MA 2F5IA 2MLGA 2GREA 4ONUA 4UFVA 1XSVA 4II9A 4AIHA 1Q1HA 2UUZA 2M8EA 5HI7A 2EFNA 3E6DA 1FMWA 3HPGA 4JXRA 1FAQA 2PJ2A 4D7MA 2C6PA 2ZFWA 4DJLA 1HKQA 3SHFA 2QGUA 5JR3A 2QPOA 1LUJB 2DF5A 4AXVA 3CP2A 4BACA 2HVQA 5EC4A 5B1AH 3SZPA 4A3DJ 5DCMB 2WADA 2BUSA 3CUQC 1ZR2A 5G22A 3GTPJ 3FXRA 3FMCA 4JLYA 4PJJA 3SQNA 1X10A 1XMBA 2BGCA 2K9QA 5ICGA 1D1CA 3OYGA 4E7IA 2LOOA 1Z67A 2EA4A 4EV0A 2R5YB 5FLXZ 1Z91A 3C2BA 1ZN2A 2ARHA 2DN0A 4U9ZA 1LNWA 1MDMA 3W2VA 1VQ5I 3NAUA 3TCVA 3T90A 3CUQA 5J1YA 1IGBA 2ZEGA 4ESFA 4CGPA 5LHIA 3M1CA 1XBTA 3MRUA 1DPRA 1P4WA 4CAVA 4DYOA 2KZGA 4LG0A 3QNVA 1UHAA 4HF2A 1TT5B 4RGXA 1BI0A 1R5ID 4UVAA 5C3EJ 4G6TB 4UUSA 1LB2A 3JRGA 2I79A 4HGUA 2NOGA 4U9YA 5C4XJ 2Q4YA 1VI0A 3B6AA 1TWCJ 4RDUA 2R7OA 5K8OA 3KIOA 3KEQA 3W91A 3L2RA 3DP7A 3HGYA 5E1XA 1KQ8A 2E1MC 3CJNA 3OR1C 1LCPA 3GZNB 1WFXA 1K4SA 2MGQA 3A1YA 4IQJA 4P4EA 1KA8A 2RDPA 3QWPA 3D0SA 1BI1A 3PO3J 1CE3A 1ZK8A 5EX0A 3H36A 1LR9A 2X1DA 4CYDA 2MD0A 3ZR8X 3CDXA 3JVNA 4KOWA 4BD9A 4ANJA 4Y4RA 3RKQA 4IXAA 2VXDA 4IHYA 2MD5A 4BXXJ 3P2HA 1PVEA 1IDYA 1MNEA 2YX4A 3R4KA 3BTIA 1SVOA 1XG1A 3GZ5A 1BJZA 3TW6A 3HDDA 3QPSA 2CF4A 4OP4A 1D1BA 3NWSA 1K78B 2RNGA 5J8FA 3R5AA 2WAFA 3V4GA 5H84A 1QA6A 3GTLJ 4L9JA 2GQQA 4RUHA 3K70D 1NG6A 5JH9A 1NMTA 3C26A 3FBUA 1YI2I 1JT0A 4UIBA 5EYRA 3IRQA 3H9QA 3M4OJ 3M9AA 3E2IA 3V8LA 4P9FA 1Y6IA 3QPLA 4A6EA 1TKFA 2K4JA 4P4JA 3MFKA 2XKPA 3KQXA 5DCFA 6CPAA 2R3SA 1GYTA 4KOYA 1S29A 2NU3I 4JBAA 3ECOA 3TO7A 3S6FA 3E97A 1NTCA 3PNYA 2QIRA 4EJUA 1QPMA 3LODA 2M4GA 2PR1A 3S1MJ 1OMTA 1FJLA 2IJZA 2GAUA 2O03A 2RQPA 1B72A 2P6TA 1R5HA 4LJZF 3OYLA 2FNAA 5IP9J 2G9DA 1R1UA 5HVFA 5JPHA 1FBQA 3R5CA 3JSPA 1Z6RA 3L2WA 4K2EA 4A3IJ 1CM0A 1Z7LA 5FRNA 2JW6A 3DKXA 2GKTI 2WA0A 3JUWA 5FD6A 3BG5A 1CQTA 2HI3A 4RAFA 3DDDA 4B09A 4BEHB 3ABUA 2QBYB 4JX6A 3FHZA 2A05A 4M3SA 3CMMA 4F0YA 3H9GA 2KFDA 1IF1A 2O6GE 3DXJF 2B3UA 1ZGAA 4KSAA 3S9MA 1TIQA 1FMVA 5F0HA 2KQRA 5D4RA 5K5RA 5K7HA 1MZBA 1YX5A 4ZBGA 3T0YA 1HLVA 1UB9A 4XSXF 2JEWA 4IF5A 1W4RA 3WHCA 4CYCB 1TQIA 1VHSA 2AFWA 2PIYA 2QECA 4LQ6A 3R95A 2E7XA 2DMTA 1R43A 4B48A 3ZJ0A 3L2UA 3KR5A 4UNOA 2G3TA 2QQ9A 1HSTA 1IRGA 3FYNA 2ZKZA 4FAIA 3G1MA 2Z3YA 4NQWB 5TJJA 3BLNA 1Q2CA 3HYIA 2LF8A 4KVXA 1H88C 1LJ9A 1W4MA 2FRHA 3F3XA 1QZYA 1OYIA 1ZRCA 3SHPA 4P10A 1OISA 1QZEA 2MH9A 4BBHA 2IA1A 4ZZLA 5IOZA 2H6CA 4IVNA 1PYVA 1Q1VA 5BNGA 2OQRA 3CD6I 1Z8LA 4EVYA 2F2EA 3M8FA 3T5XA 3PB7X 2BY1A 3EQLF 2GOMA 1A35A 1I6HJ 3CPAA 3E1SA 1Z7KB 1TBOA 4U7BA 2QKLB 1T0FC 2HB6A 1D0ZA 1GVDA 3D7DA 1TUSA 4KZTA 2G9WA 1TNTA 3JSOA 1KQ9A 2DA7A 3TBIA 1AMPA 3ZGKA 1I1GA 2GIVA 2L7KA 2Z10A 3GUXA 4P44A 4BL0B 2PJPA 1UJ8A 3A01A 2OAZA 1FNOA 4PSXA 4HNXB 4W97A 3JRHA 3LAPA 2QQ0A 1W7PA 1T6SA 3S1QJ 1T0FA 1DP3A 1ODDA 2FQ4A 2FNFX 1FPQA 3KETA 3OIOA 2PRBA 3MKYB 4Q47A 2L2OA 5L3EA 1ETWA 4I0BA 1IJWC 3ELKA 1IY5A 3WU0A 1LAMA 2DEAA 1MBFA 1ZG7A 4P96A 2ZW5A 1ULMA 1B87A 2ORWA 2W84A 2DPDA 3GY9A 2QM3A 4BYYA 2GXAA 3HOWJ 2X52A 5J1UA 3I4MJ 1BIAA 1R79A 3PZJA 3CCLI 2PJBA 3LMSA 1I50J 3DCFA 1K7UA 4UEEA 3K4NA 2EJRA 2PMZN 1MDMB 2AO9A 2L5QA 1TIHA 1VHEA 1PUFA 3CUQB 3JRDA 3N7ZA 2SGQI 3VODA 1B9MA 2QEXI 4NEXA 2K40A 3FRMA 3CXSA 1Z8WA 1CP6A 2DFFA 3JTKA 1N13A 1YW9A 4NBQA 4PV6A 2XGEA 3LSMA 4I0AA 2Z3LA 2CRGA 2DTZA 3VYTB 3OOPA 1T98A 2F6CA 4UUSB 4OC2A 1VKCA 2GLFA 3H8EA 2M1BA 1UVFA 1KWMA 1XMAA 1IY7A 3P9CA 3BTLA 3RZDJ 1UFHA 2CWFA 1HA8A 1X74A 2H27A 5D6FA 4YELA 4YFXF 4ZYGA 4OC0A 2HOSA 3KP5A 3IC1A 4E7LA 1JWQA 4YWYA 4DNCA 3IFEA 3J80K 1MMAA 2L9NA 4KIBA 4YFJA 2K02A 3I64A 1EJ9A 3D1NI 3ML6A 2CWEA 1NH3A 2ELHA 2VT2A 5EMIA 2DOFA 3SXOA 4A37A 2J8RA 4LB6B 1OLTA 1G3SA 4PJMA 5CVIA 4DBQA 1HKTA 2L8EA 1POGA 3G2BA 5IPAA 2XPWA 4C3HJ 3M8JA 1JUSA 2X6WA 2BVMA 2BXYA 4OOIA 1NUBA 3B35A 2DKVA 3B7IA 1FOYA 1EH7A 3K7AJ 5JHUA 2NNYA 2DK5A 4A3BJ 4BY1J 1T33A 1ELMP 3LSKA 2DA3A 1MMSA 2DA6A 3J7AO 1OYVI 3FWEA 1UWYA 4ZYDA 2ATRA 1UHSA 2EVNA 3T8WA 3IAM2 4KA4A 2PDOA 4O6JA 3FXOA 1F2PA 2COMA 3JREA 3WC6A 2E1MB 2VZZA 7CPAA 3CJRB 1BBYA 1LAPA 4R3LA 2ABZA 4BGDA 5FKOA 2XROA 1SMTA 2J5PA 3G4SI 4MHNA 3ZQIA 3CXLA 2PLYA 2HOTA 3SFIA 2VQHA 5D29A 1Y1WJ 2CTCA 1IIDA 2GANA 4GYGA 3GKRA 3OY9A 1Z3XA 3C18A 1HF0A 1IYLA 3DR6A 3ZN1A 5E8GA 4BMHA 4EMEA 2BY2A 3F21A 4H0EA 3D66A 2M5WA 2LF7A 5F0FA 5FUVA 3QP6A 4HPSA 3WG7H 1MIJA 2IL4A 2XGXA 4UFWA 3VARA 1IU8A 3DEEA 4DYCA 4AG7A 1S5LC 5TGTA 3EYIA 3C2GA 4CS0B 1J2XA 1IN7A 1ZLKA 3HOYJ 1WJBA 3PDNA 4I99C 2V8VA 3H1CA 2V9PA 4Q38A 2HQNA 1MSFC 2KMQA 2XASA 2Y69H 5CYVA 3TL4X 4FTHA 4H2KA 1GHEA 2NMTA 1FT9A 2KMUA 4NB5A 1B72B 3BDDA 2GXBA 4MHZA 1X4OA 5KCMA 3IRRA 1SFUA 4AIJA 4TV7A 3G6EI 1R49A 1HPTA 2DIPA 5FLMJ 5HH1A 1KBFA 3IIBA 1B8IA 5F47A 5K5QA 3BG6A 2GKVA 3NFZA 4PFPA 3OS0A 2R0QC 2O8KA 3UFFA 2IGKA 2VIXA 3HTUA 3PB9X 4MFLA 1J9IA 4B11A 3D68A 2LD5A 4HQEA 3SEQA 2FT0A 1J7KA 3IH3A 4FX4A 2DK8A 5IV0A 1FIPA 3TE4A 3J7AY 3CCRI 3HEFA 4M3FA 3ZRGA 1HDLA 1BJAA 2V4JC 1ZG1A 4HNYB 1S7OA 1IN4A 4IRHA 2K86A 3BY6A 3KP7A 2Z3KA 2LYCA 3MAJA 4M9ZA 3K2KA 2JK3A 3O2PE 1HSJA 2ZCWA 3LSHA 3S3MA 5BQTA 2M3AA 1ZO0A 1Z2IA 2V1UA 1W1WE 3D7HA 2ZXVA 1D5VA 2R98A 3GFLA 4WP4A 4PCQA 5EGOA 3OS1A 4A6DA 3WTYC 1ZR4A 5CQEA 4NFRA 1FOXA 1K79A 4RB1A 4KYWA 3K4CA 2JUCA 3WGHA 4B8XA 2OH1A 1ETOA 4KOXA 4OIQF 3FIWA 1HOMA 3HH2C 1LE8B 3IGRA 3WTTC 2JRTA 4UCPA 4UEFA 2CQKA 1Y8QB 3M7GA 4LK1F 5AONA 5D5VB 1R57A 4HW0A 1I39A 5ICCA 4CCJA 4WK8F 1RUOA 2LSOA 4S05A 1G3TA 4L5IA 2K85A 3F8CA 5F46A 4R87A 3S9LA 1PCEA 3VATA 2HS5A 3RTRA 1XB4A 5F08A 2FXAA 2O5RA 2W48A 1EA3A 3FX6A 5GAHJ 4BDZA 2PCUA 4LQGA 2IA0A 2A4NA 3Q9SA 1J0RA 1QVUA 2QSFX 3HG9A 2R7ZJ 5K1YA 3HPHA 3VE5A 2R7RA 3K1MA 3A01B 3F6OA 3VSKA 2AFZA 4XRFA 3CESA 5ISVA 2Z1DA 3MZYA 1SC7A 2KPMA 2EBJA 2PJ7A 2CNSA 2GXGA 1W7PB 2LKSA 1YIOA 2A6HF 1WGCA 2KIFA 1XOVA 4E7ZA 2QVOA 1KUXA 3PFOA 4LIUA 1FYMA 5EBVA 2FD5A 2Q0OA 3K69A 2Q7SA 3HXLA 3MKZA 2P6FA 5THWA 3RYRA 1M1DA 3WODF 4JYWA 2E1OA 4OIRF 3ZQ7A 3HOVJ 1ETVA 3E59A 5HVGA 3I0TA 1YQAA 2ZENA 4LMYA 3PNTA 2JT1A 2K9NA 1XMKA 2Y0SN 4OU0A 3MEKA 3RPUD 1CJWA 1M4DA 5JGFA 4UA3A 2VKDA 4BJ6C 1MKMA 1PUFB 5J8CA 3MQ0A 1WTJA 2DQRA 3EUHC 1F5TA 2Q4ZA 4F9VA 2F5VA 4UVCA 1FY7A 3TOBA 3ZQHA 3LD2A 4XNHB 2P7CB 4MRIA 1G8XA 2E36A 2XAGA 1ETKA 2AS5F 4O3MA 2HQAA 3EUHA 2BSWA 5KTDA 4KT6A 1WJEA 3SFZA 4RS8A 4IPAA 2EINH 2RKHA 1LEBA 2DMQA 4HNVA 4UVBA 1OPCA 4O5VA 4UIAA 1RR8C 3I58A 5M3MJ 3FZVA 2W0TA 1MD0A 1J4JA 4FUUA 2KDZA 1ZGJA 4QIWN 2F5FA 1LVAA 3I56I 2Q2EA 2WY8Q 5HOOA 2Y48A 1IXRC 3FBNB 5GTHC 2GLOA 4U5YA 4ZY0A 4M3DA 3BZ6A 3K4JA 3P2FA 1RI7A 1JHFA 4CYNA 1R4NB 2HXIA 2VKHA 4MTEA 4A0XA 3BI0A 4H6UA 3QP5A 1XBUA 2CMPA 4PZJA 4XN3A 4DZJA 5DD4A 4A3KJ 1M4GA 2VZYA 4D5CA 4CAXA 3PQJA 1PTQA 4Y17A 4YFNF 4UXHA 1N25A 1XC5A 3HKZN 3UR3C 1K7AA 5FRMA 2XB5A 5FKKA 2R7WA 2EV5A 4A3MJ 1O4XA 5GADJ 1VQ9I 5HQ8A 3S6GA 4N4NB 4FWUA 4M6XA 3B3VA 2ROWA 4V19K 2D1HA 4Y49C 2DMUA 1DU6A 4JCVE 2DA1A 2XSDC 1O3SA 3KZIC 2XC7A 1Z9UA 3LQQA 3ISXA 4XICA 3HB9A 1LRZA 1XD7A 2XKOA 2VBWA 5JLWA 2N8GA 2E1CA 2P7VB 4OMEA 4G12A 2EK8A 5K8NA 5K7ZA 1SQHA 1S5KA 1X1DA 1XDSA 3SDBA 2FCKA 4HNWB 1T38A 4YG2F 4R3KA 2OZGA 1D0XA 3WU2C 4A30A 2D1VA 3H3UA 4L5JA 1QU3A 3LSPA 4BHCA 1YW4A 1RNLA 4MXUA 3KHZA 2ENNA 2ZFUA 4I49A 4XQFA 2BEIA 5D4SA 3NE8A 2XEJA 3ZZIA 5DEQA 1XS9A 1J75A 4EFDA 1LDKB 3CT9A 3K1NA 3GMEA 4XL9A 3BTJA 2VXZA 1DPUA 2WVJA 1QO0D 2HU9A 3W2WA 2LEOA 2W82A 4GM5A 5F04A 1P9ZA 2W85A 3RCOA 2HQRA 3ULQB 5IB9A 2RFHA 1B8IB 5C44J 2O9LA 3GWZA 3HZJA 2B0LA 2K4BA 3K6GA 4CZZA 2NU0I 3DTEA 2JPCA 1WJ5A 2EWNA 4P5OA 3G73A 4Z6YA 5F1JA 1YW7A 4A3EJ 1DGRM 2MC4A 1HDUA 1WI9A 3HRUA 4WWCA 2IRFG 4CAWA 1EKEA 1ON2A 1FP2A 4ZDLA 3VWEA 1WRJA 2GWRA 3W3CA 1ZRDA 1G4DA 4YGOA 1IOIA 4Q48A 4F9UA 1D1AA 4MY0A 3LSRA 4ENNA 3GB0A 2WV1A 2QQAA 4OC4A 3BR5A 4IRIA 4OADA 2HFHA 1MSEC 2P4WA 2Z11A 3GF2A 2IAIA 2H09A 2VJJA 2JSCA 2XPUA 2B4BA 4IOAF 2DJNA 5CVRA 3H5ZA 4U88A 3Q0VA 2LUYA 2VXKA 2XVCA 1FZPB 2L01A 2HWVA 4XIDA 1YVOA 3IWGA 3TJQA 3V7ZA 4HNTA 5EGOB 3A2KA 1ENHA 3TGNA 1QZZA 1R1VA 4XLPF 2R8VA 2L9RA 3JRFA 1I5ZA 3DPUA 2PJ9A 3CO7C 2D2WA 4MHDA 1ZG5A 2W24A 5F09A 3DEWA 5E3OA 4AD9A 4M71A 2CFOA 3IC7A 4G7OF 3EFAA 3NE7A 4R9MA 2KMRA 3M07A 1IO2A 5AG7A 3WC5A 2K3PA 4DYRA 1DDNA 3QPTA 3VDPA 3B3TA 2G7UA 3CDLA 3OYEA 2L54A 5AIPA 1T39A 4CHUA 3WHBA 4L18B 2EUIA 1SEUA 3N05A 3OSFA 2KL4A 4A12A 1E17A 4MEYF 2X3TA 5HXDA 1OJLA 2NS7A 2Z16A 2ZOGA 5ILUA 5LYDA 2A5YB 4LIVA 3O8GA 4E6KG 4HF0A 1YIJI 1K7VA 1YSJA 2PJRA 4AIDA 3KP3A 3NQOA 4AVPA 1IRXA 4HG2A 2H94A 4OMZA 5CCMA 2ZEFA 4OAEA 4XLAA 3OWCA 2CSOA 1XN7A 1MBJA 2HXOA 2V1XA 2REFA 1HKSA 4DW6A 3PIPF 4GDFA 4KIFA 2DMPA 1Q2YA 2P6AC 4E7HA 2ZXWH 3BT9A 1OYYA 3OV8A 5EZGA 1KZFA 3JR9A 1OKRA 2M7BA 2KMOA 1VZ0A 2ODDA 4E1PA 3I54A 1ARLA 2HQYA 2JVGA 3LQRA 2CW7A 5JVGF 2FNPA 1S6LA 2JYYA 2V26A 3FF5A 1QPIA 1OMUA 1A31A 3KEYA 4N9IA 1IXSB 1XSDA 2Z33A 4CRYB 4L9TA 1S7EA 4LG3A 4F6AA 3RPQA 2FF4A 2DA5A 4XLEA 1SGEI 2VBYA 2W7NA 2EFOA 1QSNA 3H8GA 1MK4A 1Q7LA 4B5PA 2W1OA 1Y0RA 2BUEA 1V5EA 2CU7A 4F3QA 1YLOA 4AWXB 1HDQA 2DO7A 1W36D 4ENMA 3SZTA 2C1CA 1M1EB 2M87A 2JWTA 2LY1A 1DTDA 1BPMA 1YMEA 2IT0A 4X5KA 2L3DA 4NGMA 1CPXA 4UCNA 4WWVA 5IP6A 5BOXA 2AFMA 3UGDA 2XF5A 2CUZA 3I9V2 3BLYA 1P0HA 9WGAA 1YU6C 5CNPA 5KTCA 4LD5A 2R5ZB 3RZOJ 2Q7BA 1PP8F 2BYVE 3WTXC 3WC7A 1UMQA 4ZGYB 3FHNA 2DJIA 4C2TA 4A0YA 5EG0A 2X0LA 4HPQA 4D7NA 1HW2A 2XV4S 5K5OA 3PIOF 1TF8A 1APLC 4R6TA 5FKNA 4AVZA 4DOZA 3ZQLA 3G71I 3BQYA 3NWTA 2F7VA 3KI9A 2Q2EB 1AA7A 1BI2A 4PXEA 5LYLA 2CUEA 2GBYA 4KMFA 3FH4A 3GYHX 4CCOA 3WU1B 2GOXB 4M3GA 2IS6A 3GFIA 4XKVA 1EF4A 4B3AA 3ZN0A 1KYWA 2BVLA 2ESNA 3RBUA 1E0EA 4IUSA 4S0HB 3LWFA 2O4HA 1YLFA 3FMQA 2N1AB 1WHUA 1OCPA 4FQGA 2V7FA 1YVKA 1H89C 2Q43A 1S3JA 3CMEI 1BI3A 2KRHA 2PMZA 5LGTA 3COAC 4IZZA 4BDYA 1VQ4I 2QENA 1UUCA 4MCRA 2DPUA 1RPWA 2NVUB 2PVWA 4XPKA 4DUKA 5HVHA 1FARA 2OC6A 4UBRA 5HVQC 3BP8A 2AQEA 4CA0A 3S1NJ 4JQFA 1HW1A 1Y0NA 3F8KA 5IYDJ 2W4SA 3ASOH 2VJ5A 3R9EA 3OS2A 4OAZA 4UB6C 5D8LB 1TL8A 3OVOA 2PJ3A 5I0CA 4A2UA 2XB0X 2ZSHB 4MHGA 1TURA 3ZQGA 5ERIA 2E34A 5D5WB 2M9HA 2XAQA 3VSLA 4Y49B 4IEJA 1HQCA 3GUDA 1VQ6I 3RU0A 4ONWA 2Y31A 2VEZA 1R36A 1ULYA 1BOBA 4AUXA 5J47A 4P4IA 4X8IA 1Z9CA 1QGPA 3BOQA 5DS0A 1WKMA 2EBIA 3DTIA 2R4GA 2OCCH 5FD5A 4JXQA 5E17F 3VPRA 2C6YA 2QYOA 1H9GA 4HBLA 1NE9A 2O8XA 2YS9A 3QU6A 2KIMA 1BMOA 4BQNA 2P5KA 4XKWA 1GXQA 2HV2A 1ZHFA 2N52A 1YRNB 1T2KA 2FIWA 2OR4A 3WR7A 2K9MA 2LR8A 3WTVC 4IQ4A 3V7CA 1KU3A 4E7JA 2FOKA 4NC8A 2N17A 4C2YA 3L1PA 4M6GA 2R7QA 4L8AA 4CAFA 3ZMDA 4CCLA 5GAGJ 1KMAA 1RZ4A 1JGGA 1WZ2A 1RKTA 1ZQ3P 2CNMA 3LSGA 5GAEJ 1R5GA 1U9NA 2XIGA 3D5LA 3DU6A 3K9TA 1REPC 5H2FC 2VI7A 2CS3A 1TBNA 3KZYA 1B4AA 1RUNA 1I1DA 4QSHA 2H8WA 3EY5A 2XEFA 3W6VA 4XLNF 2COBA 3IU1A 4NGQA 5J1QA 4QLCU 3D7GA 3A02A 1USSA 2Q1ZB 1SVMA 1MBHA 4WCGA 4KLWA 3KE2A 3S3NA 2HOAA 4LOCA 3ZMVA 2ELKA 3AKZA 2UWMA 1XEBA 2B7EA 1R58A 2VL8A 3M8EA 4X0GA 1B1BA 2NS8A 2DDAA 2QQ8A 1KBEA 1S7FA 2QMLA 4FE4A 4OVOA 1XDUA 4PPZA 1K4TA 3A4CA 4D5FA 2EZHA 3OL4A 3KYCB 2YU3A 1R71A 2CNTA 5D5UB 2QWWA 3TFYA 3H3ZA 4B4CA 1Y0UA 2ODFA 3GVAA 4B1RA 4CXFA 4MJ8A 1ONVA 2FE3A 3FNCA 3BC8A 4I01A 2WUUA 4NGRA 4WJBA 1Y8FA 2ZBKA 4BJTA 1VTNC 1B59A 4Q4ZF 2QSGX 3HSEA 4D0PA 1XX6A 1TLHB 2CO5A 1H0ZA 2EZKA 2V8DA 2JRMA 2VOOA 3RKWA 1ERDA 4N4OB 4OKOA 3ZP5A 3F8FA 2PJRB 3LL7A 2OPTA 3N4MA 1YW6A 1Z1DA 3BG7A 5GP9A 5HS7A 3OL0A 2AJ6A 4IF4A 5LRKA 2RGVA 1DS2I 2IGOA 4CICA 5BPIA 2O3FA 1ZG3A 5DTDA 5F49A 2ZXHA 4BXUA 5AG4A 5J1RA 1KUVA 3CCMI 4NC6A 4Z65A 3TEDA 3A0BC 3HLPA 4LK0F 4EJOA 1IZ1A 3OYFA 3W6SA 2PE3A 2PMUA 2XEIA 3DU5A 2DT7B 2YNDA 3KYLA 1R00A 3QAHA 2LBFB 1W5TA 3HUGB 2R7XA 2CJSC 2ZW7A 3V8IA 4OAYA 1ETQA 1K83J 1S7NA 4DBRA 2WAQN 1FBUA 1KQ0A 3LFUA 4BE1A 2VUMJ 1XMXA 1UFMA 2V6EA 2VQLA 4ZYQA 5FKLA 3H0DA 3IWFA 4EJWA 3E7LA 2ZC2A 3K10A 1TNSA 4B5PB 1KUYA 3CJQB 3GTMJ 4JYKA 2YQPA 2PSWA 1Y1VJ 4MIMA 4FCYA 3BZKA 3K1PA 3W6JB 3E3VA 2ZJRF 3CCEI 2E2JJ 5E18F 2VLAA 3DR8A 2KKOA 3CDHA 5M5YJ 2ZSIB 1B6BA 3VDUA 3KPHA 4HDVA 4M72A 2ME6A 3EXNA 3BJOA 2JBJA 2PQ8A 1WSUA 1IRZA 3U1DA 1GUUA 1AUGA 2NXNB 6PAXA 4MFZA 3F8BA 2N71A 4BBSJ 5CCLA 1SD5A 2K3FA 3JRIA 4LUAA 2EA2A 2KIQA 1TQPA 3FMRA 4GCVA 2V1NA 2LC2A 4CCNA 5C82A 1DS3I 3Q0WA 4GS4A 3ISPA 2V53A 2OZHA 5LEKA 5IT3A 2OU2A 5I4MA 3H92A 2FL4A 2G3AA 3TX8A 5B66C 2WYRA 2VBZA 2ZXIA 1XFOA 3U2RA 2EH3A 2MYSA 4PUSA 1JXSA
chains in the Genus database with same CATH topology
5DWNA 3IWZA 3KEOA 1GHCA 4MBUA 2WSAA 3L9FA 4KVME 4ZYHA 1U6GA 2NS0A 3NEUA 2V9VA 3EETA 3TDZC 4HLXA 4CYPA 4LG0B 2FQ3A 1PP7U 4QB9A 5LHHA 4BHBA 2BBYA 5IT9Z 1TTYA 5ICEA 3V7SA 5AG5A 2RV8A 2VODA 4B14A 4B13A 1I21A 5FFZA 3CO6C 3HHGA 3DSBA 5L3GA 4HZFA 2JDDA 4KIGA 5JI6A 5CJ9A 3V8JA 3P9IA 3DPTA 4FHTA 4GXOA 3MWMA 2YNCC 3WTWC 4KFCA 1HBXG 1BC7C 3PP9A 5HS9A 5KK1A 3G3SA 3IL2A 1WWXA 2DW4A 4G8XA 2B4DA 1MJBA 4Q36A 1KGSA 1IN8A 2YNCA 4MFQA 2GA2A 2V79A 3W6XA 2DU9A 4KDPA 2KJBA 1G6NA 2YNEA 4ON0A 4XPDC 2ISYA 3VOEA 1F9NA 2DBBA 2Q04A 4NF1A 4GO1A 1Z05A 3RKXA 4M9SA 2Z3OA 5JQ4A 4M74A 2F5CA 2Z3MA 4A33A 3TKYA 4KUBA 5DYMA 5TRDA 1YGHA 5EEHA 5FO5A 3S2WA 4R57A 1R22A 2PR8A 4HKFA 1KU7A 4UXNA 3F8MA 3D2PA 5F1RA 4KLVA 3DQVC 4N9HA 2VOPA 2STWA 4HF1A 4GYIA 2FEZA 2Z3NA 3F6VA 3B02A 3P7NA 2RN7A 4NXYA 2LDUA 4FT8A 4ZYEA 1JE8A 2JPBA 5A28A 3IKTA 1U6MA 2H5MA 4HX8A 3FM3A 3EDPA 4UFXA 2VC1A 2JTVA 2QZ8A 3H4QA 2FS5A 2TDXA 4HX7A 4PGHA 4IHSA 2KCWA 5FLXK 5HLIA 4OIPF 2YGWA 5JFRA 5ILVA 2HYGD 5G21A 5IB0A 3RKYA 3E6CC 2O61A 1G3YA 1XMTA 5A27A 5A2QZ 1DP7P 2YX7A 1I12A 2WV0A 5L3DA 1UHWA 2FE7A 1SD4A 1P4AA 3FB3A 3FXUA 1FSEA 3KZZA 1S60A 5ED4A 3L7WA 4A32A 3TDUC 1F1ZA 4AIKA 1S8NA 3GW2A 5D6EA 1WWZA 4MFPA 3MCZA 3TOAA 2CW0F 5LBQA 2CFXA 3DNSA 1ZAOA 3E6BA 1S7KA 3REOA 3IHUA 4KOUA 4RS2A 3VFZA 5E1WA 2ZW4A 4L89A 1HW5A 1LQ1A 4MQ9F 5DUIA 2PG4A 5L3BA 2P6SA 2ZW6A 2EV6A 5BWAB 4RGRA 2W25A 4UV8A 3FXTA 2R7DA 2RNJA 4MGRA