3TO6A

Crystal structure of yeast esa1 hat domain complexed with h4k16coa bisubstrate inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase ESA1
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transferase inhibitor
total genus 80
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to6A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to6A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to6A02
5DD4A 3C26A 5FVJA 4ONUA 2VEZA 1KA8A 4OADA 3MFKA 2OZGA 3RYPA 3BROA 2YX7A 2BBYA 3I54A 1EH6A 3G8WA 3QRFF 5C82A 4KLWA 2NS0A 2ZMEA 2R1IA 3FNCA 1YLFA 1K78B 3L2CA 4QBJA 1ON0A 3FZVA 2ARHA 3SXNA 2J5PA 4RAZA 1PUEE 4L5IA 4ENJA 3DFGA 4RGXA 4EGZA 2Z99A 2KJCA 3TKYA 3ZMTA 5IT3A 2B5GB 3T8RA 2K7LA 1KYWA 3SHFA 5DWMA 1F1ZA 1QSNA 2P5KA 4EJUA 1W7PD 2UZKA 2BL1A 4L0YB 1M4DA 2XAFA 2ETHA 4IVNA 5EC4A 2H6CA 3W6XA 2XROA 2I00A 3BJ6A 2O0YA 1MDMA 2FT0A 4KUAA 1O3QA 3QOPA 3MZYA 5H84A 1D8KA 4BHPA 2EA4A 4DQ2A 1Z7UA 4KIBA 4WCGA 2ZXVA 2TDXA 1IICA 2J8NA 2IL4A 1OPCA 4A0ZA 2NMTA 3U9GA 4B5PB 3R0AA 2QQ9A 2IJLA 3LA2A 1UHMA 4OLLA 4HOBA 3ZMVA 2GZWA 3WTUC 4OU0A 5LHHA 4R3KA 4M71A 1S3JA 5HDGA 2VXZA 1ZGJA 3S6KA 4ORFA 4UUVA 2XHKA 4CGZA 3BPXA 4K2EA 1OYYA 1W5TA 4AG9A 3BLNA 2DXQA 3CDHA 4M6XA 4KT5C 1S6LA 1X3UA 2A07F 2HEOA 2VODA 2P6SA 3I71A 4E2AA 4Q48A 2L3DA 1XMKA 1XB4A 3DQVC 4PSWA 4IF4A 3FIXA 4NXYA 2H09A 1GXQA 1DDNA 4AVAA 3IWZA 5ICFA 1IYLA 3L9FA 1IIDA 1P4WA 2HQRA 4KICA 2I79A 2A69F 1YTYA 4RB2C 1YIOA 3GUDA 3ZMDA 1R1UA 2PC1A 3R96A 2C6YA 2P5VA 2CNTA 4L89A 2FSRA 4ESJA 1G3SA 1TLHB 5HLHA 4UVAA 3GXOA 3G3ZA 3E5UA 1Z91A 2FL4A 4DNCA 4HX8A 3BPVA 1M44A 3DR6A 5E18F 2CNSA 2A5YB 2FMLA 5IX3A 2PG4A 3DNSA 1WWZA 3M9AA 1YK3A 3U2RA 4A0YA 3IWFA 3HSEA 1EH7A 2F2EA 3D5LA 1RUNA 2GWRA 2HUZA 2ISZA 3PFIA 1Z05A 4ON0A 3ZZIA 1F9NA 1HW5A 4R9MA 1R58A 4KOWA 2FOKA 4KN7X 5LBQA 3ULQB 1H9GA 2IP2A 2LKPA 4AWXB 1IYKA 1R00A 3JSPA 4IXAA 5GCNA 1OMIA 4U5YA 1XCVA 3H3ZA 2BGCA 4CAXA 4GYIA 2Z11A 2A61A 5DWNA 3FM3A 1PU9A 2OZUA 4ZYHA 3E3VA 3KKWA 1USTA 5J8CA 1TQMA 1ULYA 3OV8A 1SD7A 5H6RA 1HW2A 5E96A 3ZMSA 5CVJA 5J8FA 3T9YA 5CNPA 3JTGA 3DDDA 2HV2A 2A68F 5FLXK 3MGDA 4Y13A 4X5KA 5K5QA 3CUQB 2QYOA 3LA7A 1Z6RA 1MGTA 1B59A 2IW5A 4F6AA 5LHGA 1SFXA 2XKPA 5DCMA 2ZNZA 3LFKA 4KUBA 5F48A 5DDGA 3RTRA 4CYDA 5BPDA 1CGPA 4HV5A 1ZAOA 5D8LB 4LB5A 2FBKA 1MD0A 1J59A 2H27A 5FD6A 4U0YA 1IF1A 1EH8A 3KP7A 2FRHA 1ZRCA 1G6NA 4UXNA 1WKMA 3P9IA 4QLCU 4WF2A 4I2OA 1XMTA 1QPMA 1U6GA 4L5JA 2CY2A 5DCFA 2XAGA 3K9UA 3HRUA 4IPAA 2F5FA 1R22A 3S2WA 2Y0MA 1XDSA 1I12A 3J81K 4B5OA 2RC4A 2FF4A 5D4SA 3ISPA 3R9GA 2RV8A 4LGWA 2H6BA 3SXOA 3T0YA 3REOA 1YVOA 3EQLF 3TGNA 3KP4A 2DBBA 2RNJA 4UA3A 2BEIA 3T90A 1USSA 4PZJA 5IV0A 5IT9Z 4R8HA 2HYFA 4EM0B 3LA3A 2DW4A 1G4DA 3KFWX 3IRRA 4LG0A 3IRQA 4G6QA 2F5CA 3KP3A 5JFRA 2BEOA 4MHGA 2QQBA 1J2XA 5L3DA 5FO5A 3M1EA 1BI2A 5D5WB 5HMNA 3TO7A 1ZYRF 1S8NA 3EC4A 1N71A 5J6XA 4PDKA 1LDJA 3LQRA 5BQTA 1FNNA 3VEPA 1KZFA 5BOXA 2PMUA 3HUGA 2XAJA 2JLMA 1STZA 4CRZB 4G7HF 2D45A 1XD7A 2A6HF 1TW2A 2FSWA 3GYHX 1MKMA 3PZJA 1XDUA 3S6HA 1YREA 5ILUA 2M87A 1SMTA 2YX4A 2EFQA 1W5SA 3MWMA 4ESFA 3F22A 2EA2A 5CVUA 3GFJA 1IW7F 1YFHA 1LNWA 4I09A 3K0LA 3D2MA 5FD5A 4Q47A 3KP6A 2DLLA 5IT9K 2ZNYA 4XSXF 1KQ8A 4G8XA 1CM0A 2B0LA 2XVCA 2P6GA 4QB9A 2FS5A 4O3MA 3E6BA 2ADUA 4U9YA 4HAMA 1JE8A 4PCQA 2D1VA 3K1PA 2P6TA 5TJJA 1UCRA 4OIQF 1FLIA 3F5BA 2Z33A 1D5VA 3HOTA 2ZJ2A 4H0EA 5DEQA 1ZRFA 2A4NA 3GY9A 5D8KB 2HKXA 4AIKA 2KIUA 4JBAA 5LEJA 2GQQA 3GLXA 3V8KA 3WTSC 3BJAA 1O3TA 2STWA 3O6BB 4FX4A 1IB1E 4N9IA 2ZBKA 2EWNA 3QPHA 4LLLA 3GFMA 1BM9A 1RZ4A 1FP2A 1KUVA 2OQRA 2HQNA 3NE7A 5FGMA 2V6CA 1DUXC 4ETSA 3P7NA 1U5TA 3HRSA 3SHPA 1XGNA 5HLIA 4A2UA 4U88A 4NCZA 2FMYA 1LDDA 1LEAA 1LJ9A 4EVYA 2VQYA 3DSBA 2VZZA 4KMUX 2BYVE 4XSZF 4KVXA 5DUIA 1LRZA 3CXPA 2PR1A 5CLSA 1Q2YA 2J8RA 2QIRA 3FMQA 3G73A 2DI3A 1BN5A 2JPBA 1QGPA 1S7FA 4FD6A 2MC3A 1XF8A 2OU2A 4R79A 3R9FA 2R7DA 4ZYGA 3L09A 2XKOA 3HYIA 4HX4A 1J7KA 2Y48A 2K27A 3GFLA 3N97A 4R3LA 3VWDA 3BJ7A 4LLNA 4XNHC 2EVNA 4I01A 4R87A 3W6KB 2VN2A 4II9A 5CJ9A 1U6MA 3JAMZ 4IRGA 3TCVA 1OKRA 2R8VA 1Z4EA 1RIOH 2DTRA 4FD4A 5HS9A 4M9ZA 2P7CB 2COMA 3T5XA 2ACJA 4LD5A 3FF5A 2VE9A 5K5RA 4AIHA 3MZHA 2JRTA 1KYZA 1S3ZA 1CF7A 4Q4ZF 4KOVA 1TNSA 2QZ8A 2FA5A 4CRYB 1I5ZA 1YLEA 1BJAA 1S29A 5D6EA 2HQYA 4MJ8A 4ZBGA 5LLQA 1SD6A 1K78A 4IHTA 1QSTA 1ZGAA 4QWQA 4HNXB 3EDPA 1ONVA 3AAFA 2KJBA 1REPC 1FC3A 4M72A 2VOOA 3I64A 4I0AA 2P6EA 4CAVA 2KCWA 3ZN0A 2FIAA 1UB9A 2ZKZA 4KMFA 4Z2YA 2B5GA 3B73A 3F21A 4R57A 1M4IA 1R7JA 1QBJA 3TT2A 3QAHA 5ERIA 5H86A 2YR2A 3JAMK 1TBXA 4MY3A 4HX7A 4UHTA 3VOEA 1U5TC 3QPTA 3M7GA 5D5XB 1J4JA 3F8KA 2HS5A 4B8XA 4YFNF 1B9MA 2G7UA 3RI4A 4A6EA 2PFBA 2QWWA 3SFZA 4L18B 4H89A 2ATRA 3I59B 1ZLKA 3BDDA 1BC8C 1BIBA 4BQAA 1I6XA 3TTHA 1KU2A 4FT8A 3WGGA 1KU3A 3FX3A 1XGMA 5E1XA 2HOEA 4OMZA 4HKFA 3EYIA 2P7VB 1FBSA 1B6BA 1RNLA 4MEXF 4Y49C 1BI0A 2M5WA 2ESHA 3ZMUA 1XCBA 2AJ6A 2K5TA 2OQGA 2CGPA 4AIJA 4NB5A 3HIFA 2NNYA 2M45A 3WG9A 4HV6A 4I49A 4UVBA 2VBYA 2Q7BA 2R7HA 3HHGA 1YQAA 2VBZA 4CZZA 4Y17A 4PGGA 2DAOA 3C7JA 3GW2A 3HHHA 4BAYA 1U2WA 5E17F 4FD7A 2J5OA 2Q4YA 4MY0A 3ZJ0A 2W57A 4KIFA 4D0PA 5TRDA 1XSVA 1YW9A 2Q8KA 2GAUA 5FFZA 2DT5A 3ECOA 3I0TA 1R5GA 4MNUA 5L3CA 1S7OA 1NE9A 2E1NA 3P9CA 1FT9A 2FU4A 2ZW7A 4EGYA 4ZYEA 3DR8A 3HRTA 2HGCA 4H6ZA 5JPHA 5FLXZ 3ELKA 1IXSB 3ROUA 3WTTC 4YRHA 4WK8F 1ZG3A 4KOSA 4JWPA 4RGSA 2CSOA 3F8MA 3H3UA 1BO4A 2BV6A 3LSTA 1I1DA 4PGHA 5F47A 3EETA 2XASA 3GVAA 4UWJA 5K1YA 1J75A 4MQVA 1ZARA 1AWCA 2RKHA 1KQ0A 2PR8A 1TIQA 3RIRA 3E6CC 2NNNA 3K1NA 3LODA 1M1DA 3KEOA 3TDZC 5L3GA 4JJXA 4HNWB 2H94A 4RAYA 5E8IA 4M3SA 2ZO4A 3OWCA 3KLNA 5ICEA 1G3TA 2DPUA 1S7AA 3J81Z 2HR3A 2Z10A 3F8FA 3HSRA 3V4GA 3GZ5A 4HF0A 1SMYF 1YG2A 2FBIA 1G3YA 2E7XA 2XAHA 2G0BA 3DEUA 2Z3YA 2O28A 1NSLA 3HTUA 4HW0A 2FEZA 2K02A 2VT2A 4XRFA 4YIFA 3FBUA 3CUQA 2VBQA 1PUAA 4U7DA 2C27A 1FSEA 3MCZA 3MAJA 3R60A 4MQ9F 3FB3A 1B4AA 2O8XA 3TOAA 1OYWA 4F7ZA 5L3BA 1FBUA 1PDNC 3D3SA 3FRMA 4G94A 5H6QA 1I27A 5DD8A 2CNMA 4U7BA 2EFOA 1YYVA 4HZFA 1KU7A 4RB1A 1RO5A 4KN4X 1FP1D 2AS5F 3IL2A 2JT1A 2RGVA 4A5NA 1FYKA 3R4KA 4U0WA 4WX9A 2R98A 2HZTA 2RVCA 2W24A 2DU9A 4CDGA 2XIGA 4KUMA 3O3KA 5I0CA 1MJAA 3WR7A 3WE2A 3GYAA 1MZBA 4EJVA 4XPDB 3V8JA 1R1TA 2ZW6A 1ZH5A 3ZMZA 1SAXA 1T98A 3FMSA 2OH1A 4LK0F 1BOAA 4EV0A 3IHUA 4HLYA 5CYVA 4JXRA 1J5YA 1R1VA 4ESBA 4HDVA 2PSWA 5A2QZ 1S7NA 4BMHA 1TNTA 3CO6C 4L9JA 4P96A 3I9SA 4ZYDA 2WPWA 1Q2CA 2K86A 2IT0A 4NHJA 5BS6A 2O61A 3KETA 3E6DA 2L02A 2EV5A 3COAC 1T38A 4KOTA 1Y7RA 1YS7A 4G7ZF 4HNYB 1LEBA 3F72A 4MHDA 3RYRA 5ISVA 2V1UA 3R1KA 4OIOF 4TV7A 3E5QA 2X7BA 2HKOA 4EMSA 2GE3A 3KP5A 3TQNA 3O2PE 4U0VA 1OZPA 4M9SA 2EFPA 5ICGA 4XPLA 4L0ZB 4JXQA 1O3RA 2D2WA 2D1HA 5LEKA 4A12A 1JXSA 1RI7A 3FHZA 2FXAA 2PI0A 4LG0B 4UNOA 2EFNA 1IN7A 3B02A 2OBPA 4KFCA 4UWIA 3QP6A 1BIAA 2AE6A 5EEHA 4PK3A 5AIPA 3Q5FA 1E2XA 3R61A 4GYGA 3JSOA 1K79A 3CUQC 3I53A 2D4PA 1O7LA 5LHIA 4ZZLA 1R5HA 5A2QK 3RPQA 1XSXA 4IF5A 3PQJA 2CQKA 3H4QA 2PN6A 1Z4RA 1UFMA 3EXNA 1ZHFA 2QLZA 2L4AA 2GXBA 4HLXA 4H6UA 2DQRA 4KLVA 1LQ1A 2GA1A 2VONA 2QQAA 1FSHA 1HSTA 4FHTA 4IRHA 4KZTA 4YIIA 4YG2F 3CO7C 3F8NA 2OAZA 4KA4A 5H20A 3TDUC 2P0WA 4GS4A 5LGUA 3F3XA 4PSXA 4E70A 4EJWA 5JQ4A 4GO1A 3SQNA 3ML6A 3N4MA 3WE3A 2YSRA 3E0KA 1B87A 3J80Z 4N9HA 3KCCA 4ENMA 1SD5A 4P9UA 5JHUA 2UWMA 2FNPA 2ELHA 1W7PA 2PEXA 4NEXA 4M9XA 2D4OA 2M1BA 1S7KA 2B4DB 3PGPA 2VC0A 3E5XA 1L0CA 1FYLA 3FXTA 5E1ZB 2Q0OA 4RI1A 4KNYA 4KOXA 3GO5A 4MEYF 3J7AO 4J3GA 5KK1A 2BUEA 3RKXA 4FX0A 1HQCA 2HWVA 2G7HA 3HOSA 1Y9KA 3JVNA 3T1BA 3WODF 5FFXA 2IRFG 4JK1X 1P4XA 2VE8A 1QSOA 1YW8A 3WU1B 2CW0F 2IVMA 2PLYA 1IXRC 5KTAA 2KKOA 5ILSA 5LGTA 1L3LA 3P9KA 2JPCA 1WI9A 4OAEA 1SFEA 1I21A 4NF1A 1IUYA 1U8RA 1ON1A 2HYGD 4R1HA 1FX7A 4AVPA 3CUOA 2WC2A 3PQKA 2O3FA 4CXFA 3E97A 2ESNA 1XN7A 2M30A 2MH2A 1Z6TA 1T39A 2VBWA 3J80K 1P4AA 2L01A 3RPUA 4HDUA 3JUWA 2LSOA 3VFZA 3ZN1A 3R0JA 2FXFA 4YFKF 3EYYA 4GXOA 3I3GA 1Q1HA 3QP5A 3FXRA 4OIRF 1HSJA 1IN8A 3M8EA 3C3WA 2IA0A 4EM1A 2XV4S 1FBQA 2MBFA 2XGXA 3EO4A 2Q04A 2P4WA 5F46A 1A04A 2NAZA 1QO0D 4EQQA 1GVJA 3MQ0A 4ZZDA 2QBYB 5D6FA 1Z1DA 5E8GA 3C18A 4MBUA 4XLPF 3CLOA 3TE4A 2LDUA 5HS8A 2YPRA 2GANA 1JHHA 5HS7A 2GXGA 5BPIA 2V1XA 3ERED 1H9TA 4IRIA 4ZH4F 1I1GA 1O7FA 1FY7A 2Y75A 4OMYA 2QMLA 3KE2A 4WWCA 3HRMA 2F5DA 2PQ8A 4AVCA 5KVRA 3DPLC 1B9NA 2JZYA 1Q2DA 4ASNA 1U78A 1BOBA 2OZ6A 1HKTA 2X0LA 1UHWA 2ZMEB 3ZPLA 4Q5SF 3KZZA 1GHEA 1FWZA 4HA8A 4Y15A 3V7CA 1P2FA 4ENNA 4L9VA 3BJ8A 2B3VA 2V1DA 2Q0YA 4LLGF 2HTJA 1YW7A 5E1WA 2REFA 2IA2A 3EFAA 4UVCA 4JQFA 1OYIA 4S04A 1FOKA 2NRAC 3WGHA 5LRSA 4IUSA 5DV5A 3QB8A 3I59A 1VKCA 2PRBA 3FXUA 4RS2A 2JDDA 4CS0B 2EFWA 1P4NA 2J8MA 4EM2A 2EK5A 4B09A 4B5PA 1NMTA 1QSRA 4GGGA 2XAQA 2LF8A 2DQLA 1G3WA 3LAPA 1IRFA 3F8BA 2FQ3A 4L9TA 2FCKA 3NQOA 4E0AA 1EV7A 1QZZA 4MI4A 2LNBA 3BY6A 2ZFWA 4S05A 4M74A 1MDMB 4EJOA 5JVTA 2K4JA 2B4BA 4PK2A 2V79A 4UV8A 1PP8F 5L3EA 1ZREA 1UFHA 4HQEA 4IJAA 3IGRA 4RGRA 1HXDA 1RUOA 1WQ2A 2X4HA 5F1RA 1V0CA 3WTVC 1F5TA 5CVVA 2Q44A 1S5KA 1MJBA 4YGOA 2QENA 1S7LA 1C0WA 1K7AA 3BZ6A 2B58A 5HOOA 3HTSB 2NYXA 1IN5A 2MLKA 2R7FA 2VI7A 3RKWA 3BJOA 2L54A 3RDIA 4N0BA 2RQPA 5F64A 4I0BA 2KIFA 5KTCA 1MK4A 1DP7P 1T2KA 1QQIA 2VBXA 1J9IA 2AXLA 1T0FA 1IXCA 2A3SA 3OOPA 1XSDA 1ZN2A 2JSCA 4XBFA 3R9EA 4WXCA 2QUFA 1WWXA 1ZRDA 2ZW4A 4M6YA 4I02A 4I7HA 3U1DA 3NEUA 4L9NA 1BI3A 2Z5UA 1YO5C 2MA3A 2ZXJA 3D2PA 1TQIA 2CG4A 3UY5A 4KDPA 4AVBA 1BC7C 4ENKA 4MTEA 5CVIA 4QVTA 3BOQA 3CXSA 4KOYA 1JGSA 3DXJF 2PJPA 3GF2A 1XIXA 1IAWA 2FE3A 1ZG1A 3KLOA 5LGNA 3K2ZA 1LDKB 4P5OA 4AD9A 5AONA 2EB7A 3FWEA 1YX0A 2OD5A 4LUAA 1K4JA 1YS6A 3N7ZA 2REEA 4EJTA 2EV6A 1GHCA 2ISYA 2OA4A 3TO6A 3FXQA 2W84A 3QU3A 1WSUA 3Q9SA 3MEXA 2Q4VA 4KVME 3ABTA 5AIQA 2VZYA 4YFJA 4HYEA 3W91A 3RKYA 4RB0A 4M73A 3NRVA 2RN7A 1IRGA 1QZYA 2UXNA 1LVAA 5JI6A 3KP2A 1YGHA 2HDCA 1P92A 3PP9A 2O03A 2DK5A 4AB7A 3F6OA 5ED4A 1I1SA 1AOYA 5CVRA 3JTHA 1TQPA 3DPTA 3CJNA 2WWYA 1W4MA 1D3YA 4WXDA 2E1CA 1S60A 3GZ6A 2P8TA 4CICA 1V4RA 1D8JA 1R36A 4MTDA 5EEGA 1IZ1A 5D5UB 2PDOA 2PBIA 5BMZA 3EY5A 1HKQA 2KRFA 1ZG5A 5EBVA 1ZLJA 3K1MA 3F8CA 3KZYA 5DCMB 2MD5A 4OINF 2GIVA 1J0RA 2VT3A 4KORA 1NHAA 5LRRA 5ILVA 2OB0A 2STTA 1JHFA 3S6FA 3V8IA 5KTDA 1IN6A 2JEVA 1YVKA 3TOBA 2V9VA 3VODA 3HSFA 1V3FA 1MJ9A 2G3TA 1IN4A 4G6DA 3GKRA 5L3FA 3WTYC 2G9WA 1B6AA 1XEBA 2EV0A 3ZP5A 2MLGA 2P5LC 1RXTA 4QUSA 2F5IA 4BNCA 1FPQA 5JR3A 3K69A 3EUHA 2WTEA 3IWGA 3LD2A 2DFIA 2QVOA 3WTZA 2BE5F 2R3SA 4NSQA 4O6JA 1TTYA 1WRJA 5F49A 3RYOA 2M8EA 2CO5A 4XLNF 1KU9A 3WTXC 2ZCWA 3I5UA 5D5VB 2CYYA 1OR7A 4LMYA 3T8TA 4A0XA 3DKWA 4OOIA 5DYMA 1Z9UA 2ZPAA 3ECHA 3M8FA 1BBYA 2HFHA 3G3SA 2H5MA 3JW4A 3QU6A 1L0OC 3DV8A 5F6FA 3FM5A 5E20A 1KUXA 5HH1A 1VHSA 3F23A 5FB2A 3F6VA 1WK4A 4PV6A 4CHUA 4K30A 2ZW5A 3H92A 2Q2EA 2QECA 2CFXA 1Z9CA 1O3SA 6PAXA 3KEQA 4G7OF 2VXKA 3BP8A 1XE4A 3FMRA 1QSMA 2W85A 4WXHA 5IB0A 2LF7A 1HKSA 1PP7U 5K5OA 3GX4X 4U9ZA 3V7RA 1CJWA 2FE7A 4F0YA 2W25A 2FNAA 2G3AA 3SZPA 3BWGA 1KGSA 4XNHB 1XGOA 3TO9A 1Y0UA 4KVOE 3K9TA 1SD4A 2DO7A 5ICCA 4HBLA 2L4MA 3IKVA 3WTWC 5D4RA 1H0MA 4JLYA 2KIMA 4RB3C 5HDNA 4XPDC 3GWZA 2WV0A 2XUBA 1R57A 2VC1A 4UV9A 1DPRA 3VB2A 2JDCA 4RS8A 4HQMA 4G9YA 1HW1A 3E6MA 2IPQX 3GFIA 1FZPB 4A6DA 4KOUA 3B8GA 3TFYA 4YFXF 4P9FA 2VOPA 3GEZA 2B4DA 1ON2A 3IC7A 5HDKA 3CXQA 3V8LA 2QM3A 1HBXG 1LB2A 2O6GE 3C1DA 4BHCA 4EVIA 2PMHA 4LK1F 1KUYA 1XMAA 4AG7A 5C88A 4BXUA 2DPDA 4XPKA 3I58A 3V7SA 4KIGA 3I4PA 1SQHA 3LWFA 4FD5A 3R6SA 3R95A 2A6EF 1W7PB 3P2FA 2GA2A 3S6GA 4A5MA 2EJRA 4GCVA 1GXPA 2XRNA 2RDPA 1VTNC 1ODDA 2F5EA 1U3EM 2JTVA 1P6RA 2K4BA 4HF1A 4LJZF 1U5TB 4QC6A 2FBHA 2DK8A 2IA1A 1TW3A 3W6JB 2MH9A 4BHBA 1P0HA 4E8OA 3CTAA 2P6FA 2FIWA 1Y9WA 1XGSA 1B1BA 2UXXA 4IHSA 3L7WA 1F4KA 3Q9VA 1E17A 3ZQ7A 4O5VA 3WU0A 3ABUA 4CO8A 5HVQC 4BYYA 4JD6A 4L8AA 1DPUA 4LX9A 2Z0ZA 1QNTA 4LFUA 3RJPA 1BI1A 2Z9OA 4KYWA 3F0AA 2WPXA 2EUIA 3W6SA 1T6SA 3LQQA 2OZHA 4UBRA 3DF8A 1M4GA 3WGIA 4P55A 4Y49B 4NQWA 3IKTA 1YR0A 1SFUA 4HF2A 3SXYA 3SZTA 4BH9A 2QBYA 4I98B 4LB6B 3D0SA 1K6OA 1O57A 2CWEA 4CAWA 3P2HA 3DP7A 5HLGA 3FYNA 1R23A 4OIPF 5DUKA 3L00A 1KQ9A 3VWEA 2E7WA 2B3UA 3D8PA 2YU3A 1FYMA 2HTSA 4RGUA 1CF7B 4MGRA 4M85A 2BSWA 3LAJA
chains in the Genus database with same CATH superfamily
3OIOA 5LRGA 3FXJA 5DD4A 3C26A 2NU2I 1WZ2A 2PJRB 2E35A 2VEZA 4E7LA 4ONUA 1KA8A 4GFBA 5FVJA 2F5VA 5IP9J 4OADA 3MFKA 3J7AY 2X6YA 5B3SH 2XC7A 2GLFA 1IJWC 2ZEDA 4BE1A 2OZGA 4YEJA 5F0CA 3RYPA 3BROA 5FRMA 1OQYA 2YX7A 2BBYA 2X51A 3I54A 4M3GA 1KZHA 1EH6A 3FXKA 1M8BA 4IHMA 3G8WA 3S1QJ 3QRFF 4NDLA 5C82A 5G22A 2W00A 2JK3A 4KLWA 1F36A 1PYVA 2NS0A 4XKCA 1OCPA 2ZMEA 3BQYA 2HOSA 3R5AA 1ZG9A 1YLFA 5EEAA 1K78B 3L2CA 2Y31A 3KYDB 5EF6A 3FNCA 4QBJA 1ON0A 3OYLA 1TC3C 1T08B 3FZVA 2LP0A 2ARHA 1CPXA 1FTTA 4SGBI 5C3EJ 3SXNA 2G0EA 2J5PA 4RAZA 1PUEE 4L5IA 1YI2I 2KIQA 1U0JA 1TT0A 3QPLA 1H8AC 4ENJA 3DFGA 3OSFA 4RGXA 2BVMA 2Z99A 2KJCA 4RM2A 3TKYA 4EGZA 2LKXA 4OMEA 3ZMTA 5IOZA 2BXZA 1W36D 5IT3A 4F8ZA 1U8BA 2B5GB 3T8RA 3TX8A 2K7LA 1KYWA 3SHFA 4JOMA 5DWMA 1ETWA 1F1ZA 4CAFA 2DDBA 3LSJA 4W9YA 3LACA 1QSNA 3GTMJ 2P5KA 4FBEA 4PK4A 4EJUA 3B4VC 1W7PD 2UZKA 2BL1A 2LY2A 4L0YB 2XAFA 2ETHA 3VWBA 1M4DA 4IVNA 5EC4A 1K4SA 1FOWA 4XL9A 2H6CA 3W6XA 2XROA 2I00A 2HC9A 3BJ6A 2O0YA 4EEFG 2ORVA 4M3EA 3H8GA 3S2HJ 1LOKA 4UXJA 2NVUB 1MDMA 1HPTA 1MSFC 2FT0A 1O3QA 4KUAA 3QOPA 3MZYA 3ONQA 4N4OB 2ROWA 1D8KA 2EZIA 4F92B 5H84A 4BHPA 2LEOA 2EA4A 3KPHA 4DQ2A 1Z7UA 4XK4A 4KIBA 4WCGA 4OC1A 2ZXVA 3VYUB 2TDXA 2K85A 4UIAA 5A28A 5J1YA 1IICA 2J8NA 3OL3A 3LOCA 1VQ6I 2IL4A 3SJMA 2XB5A 1OPCA 2R7RA 2PJ5A 4A0ZA 2NMTA 1MBFA 3U9GA 5F08A 4B5PB 3R0AA 2QQ9A 2IJLA 2Y69H 3TW7A 3LA2A 2WB1N 3FSYA 3CCLI 1LE8B 1UHMA 2R7SA 4A24A 4OLLA 4HOBA 3ZMVA 2GZWA 1NG7A 3WTUC 2IGMA 4OU0A 2ZJRF 1QPIA 3DGVA 1IUFA 1M8CA 2ZEOA 1MNMC 3TP3A 5LHHA 4GXHA 2LD5A 1SFKA 2PJ7A 1ETYA 2FUG2 1Z8WA 4R3KA 3BG3A 2VQGA 4M71A 1S3JA 2OVOA 1CP6A 4CCLA 5HDGA 2VXZA 1ZGJA 4ZX9A 4JX6A 3S6KA 3KY9A 1Y1CA 3NE8A 2NS7A 4ORFA 4FASD 2HPMA 4UUVA 1FARA 2XHKA 2E71A 4CGZA 1WGTA 3BPXA 4K2EA 1OYYA 1W5TA 1V55H 4B3AA 5IOYA 3LMSA 4AG9A 3BLNA 2E19A 1ZELA 1TT5B 4IOCF 1D5YA 2DXQA 3CDHA 4M6XA 4XRMA 2ARPF 3D68A 4MCRA 4AYBA 3WHCA 4NNJA 3FXMA 4E7HA 4UCMA 5LYLA 3RPUD 5LRJA 2NOGA 3RQ4A 5E3LA 4KT5C 1S6LA 1X3UA 2A07F 1W1WE 2HEOA 2P6SA 4XOTA 2VODA 2Z3LA 2E2JJ 1Q7LA 3I71A 1IC8A 4E2AA 3K2AA 5C44J 4Q48A 1MT1A 1WI3A 2LY1A 4UCPA 2L3DA 1KBFA 2L7KA 4KSAA 2ORWA 2V9PA 3SFIA 1XMKA 3SYTA 1XB4A 3DQVC 4PSWA 3S9NA 1SVMA 4IF4A 4RMNA 5J1UA 4OC2A 2QSHX 1EKEA 2DKVA 2Z3OA 3LSPA 2H09A 1XX6A 1GXQA 1DDNA 3FIXA 3IWZA 4NXYA 4AVAA 2QGUA 4P4IA 1WPKA 5ICFA 4BEHA 4Z65A 4XIDA 1IYLA 3L9FA 2OC6A 4B1RA 4QSHA 1P4WA 1IIDA 2HQRA 2H1KA 4KICA 2I79A 4FWUA 4BINA 2A69F 1VQ7I 3MKWB 1YTYA 4RB2C 1YIOA 2ZMEC 3GUDA 3D66A 3GCMA 3ZMDA 1R1UA 2UV1A 4PJLA 4B47A 1Z5RA 5HI7A 2XGEA 2PC1A 2EZLA 3R96A 4A33A 3FISA 3QQAA 2GLOA 2C6YA 2P5VA 2CNTA 1IRZA 1D0YA 4L89A 2L2OA 2FSRA 4MFZA 4ESJA 1V1IA 3VH9A 5D29A 2VQLA 1G3SA 3VSKA 2DTZA 1TLHB 5HLHA 2DXIA 2C6GA 3BZCA 4Q7AA 5BWAB 4UVAA 1TP4A 1OBRA 4M6HA 5EGOB 3C2BA 3GXOA 3IJ3A 2JA6J 1CQTA 3G3ZA 3E5UA 4C68A 1Z91A 2FL4A 1CT2I 1PJUA 4DNCA 4HX8A 3BPVA 5GAEJ 1M44A 3DR6A 5E18F 1N78A 2A5YB 2CNSA 4FISA 1I6HJ 4FKDA 2FMLA 5IX3A 2PG4A 3MEKA 3DNSA 3GB0A 4CYCA 1WWZA 3M9AA 4F9UA 1YK3A 1YJNI 4OAYA 3U2RA 1ENHA 4A0YA 3IWFA 2X6XA 3HSEA 1F2PA 1EH7A 3OYGA 2F2EA 2F7VA 3D5LA 1RUNA 2GWRA 4DOZA 2ISZA 3PFIA 1Z05A 2HUZA 3PNTA 5B1BH 4ON0A 3ZZIA 1F9NA 1IY7A 1HW5A 1JT0A 1CBXA 1QA6A 4R9MA 1R58A 1NK2P 2CU7A 4KOWA 1IU8A 4Y4RA 2ZEEA 4CPAA 2FOKA 3FC3A 1MMGA 4CZCA 1QHGA 1DU0A 2V9KA 2H1LA 4AVZA 2Z3MA 3DEEA 4KN7X 3NFZA 5LBQA 3OXGA 3E1SA 3ULQB 2CV0A 3PIPF 1H9GA 2FX0A 2IP2A 2LKPA 4AWXB 3CCUI 1Z77A 1VHEA 5K8MA 1IYKA 1R00A 3JSPA 3DEWA 4IXAA 1V5EA 5GCNA 1OMIA 4U5YA 4R76A 2Y9ZA 1XCVA 3H3ZA 4V19K 3JRCA 5IP7J 2BGCA 2IQ6A 3OYKA 4CAXA 4GYIA 2Z11A 4LG3A 2HQAA 3WC5A 2QQCA 3OL0A 3IFEA 1FTZA 2A61A 5DWNA 4AUXA 4XORA 1BLLE 1ZK8A 3FM3A 3PUBA 4F52A 3WG7H 1PU9A 2WB1A 2OZUA 2OV7A 2WY7Q 3TBIA 2A20A 2R93J 3UEJA 4ZYHA 4UXHA 3E3VA 1RTQA 1USTA 3KKWA 5J8CA 3HUVA 2OR4A 1TQMA 1ULYA 3OV8A 1SD7A 5H6RA 1HW2A 3B7IA 5E96A 3QOEA 2HYJA 3OYBA 3ZMSA 3HG9A 3PDNA 5CVJA 3Q0VA 5J8FA 3T9YA 3RZAA 2RAEA 5CNPA 2L9NA 3JTGA 3DDDA 2LTPA 2HV2A 2A68F 1OCOH 4AU7A 3MKZA 5FLXK 1XMXA 2DMUA 4FETA 3MGDA 4Y13A 1Z7KB 1YOVB 4X5KA 5K5QA 1K7UA 1QU3A 3CUQB 1ZLHA 2X1DA 1BR1A 2QYOA 3LA7A 1Z6RA 3A01A 1MGTA 1B59A 4DIQA 4YWYA 3GTJJ 2IW5A 4F6AA 4M3DA 4S0HB 2K5CA 2AFWA 3MVPA 4ZY0A 4X2TA 3B3CA 5LHGA 1SFXA 3OYNA 2XKPA 5GTHC 2HVQA 5DCMA 2ZNZA 3LFKA 4KUBA 2R7TA 5F48A 5DDGA 3KR5A 3H35A 3OR1C 4RDUA 5FKMA 4IZZA 3RTRA 3IWEA 4CYDA 1QZEA 3ASNH 2RNGA 3JCUC 3S93A 5BPDA 1CGPA 4HV5A 2CUJA 3RZOJ 1ZAOA 5FKLA 5D8LB 1VQMI 3CXLA 3CCSI 5HNFA 4LB5A 5HVGA 2FBKA 1ELMP 2QJ8A 3BR0A 1MD0A 1J59A 3ABLH 3LSRA 2H27A 5FD6A 4RN7A 4U0YA 2LLKA 4A32A 3VYTB 1IF1A 1EH8A 2Y0SA 2B8TA 4MHYA 3KP7A 2FRHA 1ZRCA 4F9VA 3O8HA 4IHYA 1G6NA 3MRUA 2PIYA 3B35A 4UXNA 2ME0A 1LFUP 1YTPA 1WKMA 3P9IA 4QLCU 2PIZA 4F93B 4WF2A 4I2OA 3S3OA 1QPMA 2MFZA 1XMTA 4TWEA 3BHXA 1U6GA 3CCEI 1BL0A 2GXAA 4L5JA 2CY2A 5DCFA 2XAGA 3K9UA 3HRUA 4IPAA 2VL8A 2F5FA 1NK3P 1R22A 3S2WA 2Y0MA 5K8NA 1XDSA 1I12A 3J81K 1TKFA 2YS9A 4B5OA 2RC4A 5EX3A 2FF4A 2XEIA 5D4SA 3ISPA 3R9GA 2RV8A 3IAS2 2PJCA 1YX3A 3N05A 4LGWA 1HJAI 2H6BA 3L2QA 3KGQA 3W3CA 3SXOA 2VASA 3T0YA 3REOA 1YJ9I 4DYOA 1YVOA 3EQLF 1VQKI 1GYTA 2P81A 4DUKA 3TGNA 3KP4A 1TURA 2DBBA 3ZQLA 2UVOA 2RNJA 4UA3A 2BEIA 4ZC3A 3T90A 2SGEI 3VE5A 1USSA 2CMPA 3QPSA 4PZJA 5B1AH 5IV0A 3HM5A 2VQCA 1X2MA 3DU5A 5IT9Z 4R8HA 4CGOA 1K6YA 4E6KG 2HYFA 4EM0B 2R4GA 3ZCOA 3LA3A 2DW4A 3JRFA 3OOUA 2K9QA 1UHAA 4RAFA 1G4DA 1WHUA 1S7EA 3KFWX 5KNLA 3IRRA 3BR5A 4LG0A 3IRQA 4G6QA 1LPQA 2F5CA 1R43A 1Z0XA 1D0ZA 3KP3A 5EG0B 1TBOA 4UUSB 4E7JA 4OC0A 5HNHA 4BY1J 5JFRA 2BEOA 1Z8XA 4MHGA 2QQBA 4B14A 1J2XA 1R5ID 5L3DA 5CCMA 1QVUA 3M1EA 5FO5A 1BI2A 2XPUA 5D5WB 2KRCA 4Q36A 5HMNA 1V1HA 3TO7A 1ZYRF 1TIHA 4B12A 1LKXA 3F9KA 1V5FA 1S8NA 2CW7A 1A36A 5DS0A 4D5CA 3W2WA 4MFLA 3EC4A 1ARMA 2NU4I 1N71A 5J6XA 4PDKA 3RBUA 4XNFA 4I6ZA 1MBEA 1HDDC 3DTIA 1LDJA 3CT9A 3LQRA 5BQTA 1FNNA 2YQPA 3JRBA 4FE4A 3VEPA 1KZFA 4C7HA 2M9HA 2IS4A 4DJLA 3WT4A 5BOXA 2FQ4A 2ID6A 2PMUA 2Q1ZB 3BG9A 3HUGA 2BW3A 2XAJA 2JLMA 1STZA 4HPQA 4CRZB 4P1WA 3H0GJ 4D1QA 2EINH 4G7HF 2D45A 3BCBA 4H2KA 1XD7A 5G21A 2CUZA 2A6HF 1MBKA 1IY5A 1TW2A 2FSWA 5J47A 3OS1A 3GYHX 2OJED 1MKMA 3PZJA 2XEGA 1X1DA 1TF9A 3BG6A 2EIMH 1XDUA 3LFUA 1ZLIA 3S6HA 2SGPI 1YREA 2EQRA 5ILUA 2M87A 3G1OA 1SMTA 5FLVA 2YX4A 1EE3P 5M3MJ 2EFQA 1W5SA 1U5KA 1PYTB 1NG6A 4A69C 4XRSG 5GAGJ 3MWMA 4ESFA 3FF3A 1K4TA 2EIKH 1ZO0A 2YNDA 1M1EB 2EA2A 5CVUA 3GFJA 3F22A 1IW7F 1YFHA 1H88C 1LNWA 4I09A 4YIRX 4HRIA 1JT6A 3K0LA 4R8FA 2X6WA 3A9LA 3QAYA 2HZDA 4WJBA 3D2MA 2AO9A 1P9GA 4X1EA 4Q47A 2KL4A 5FD5A 4C30A 1SGYI 2F4OB 1JUMA 4CCJA 4WWVA 4IO9F 4RLQA 3SI0A 3KP6A 2A6TA 2DLLA 5IT9K 2ZNYA 2V4JC 4XSXF 3HOZJ 1KQ8A 3BLYA 4G8XA 1CM0A 2B0LA 2XVCA 4KJZA 1GDTA 1SGNI 2FS5A 2P6GA 4QB9A 5IYDJ 4O3MA 3SEZA 3E6BA 2ADUA 1WFXA 4U9YA 4HAMA 3S9LA 1JE8A 3GTKJ 4PCQA 2D1VA 1VQPI 3Q3SA 2P6TA 1G8XA 1FIPA 3K1PA 1UCRA 1R4MB 5TJJA 2LRDA 5F27A 3OY9A 4OIQF 1FLIA 3F5BA 2Z33A 1D5VA 4KSIA 2KRHA 3H36A 4A38A 3HOTA 4UFVA 2NS8A 2ZJ2A 1ETVA 1DU6A 3CCQI 4H0EA 2L7MP 2WAQA 5DEQA 1ZRFA 3HGYA 2VJ4A 2A4NA 3NA6A 2CS3A 1Y6IA 2EH3A 4J19A 3GY9A 4DYQA 5D8KB 2HKXA 4MO7A 3ZOBA 4AIKA 2IS6A 2KIUA 2ELKA 2M3AA 4JBAA 5LEJA 2GQQA 2X6OA 3CDXA 3GLXA 3V8KA 3NAUA 2P6AC 3WTSC 3BJAA 1O3TA 2STWA 3O6BB 1JWQA 7CPAA 4FX4A 1IB1E 4N9IA 2ZBKA 2EWNA 2RB7A 4D9JA 3QPHA 4LLLA 3HPHA 3GFMA 3S3MA 4B43A 1XFOA 5AG6A 1BM9A 1TWFJ 4P4DA 1RZ4A 2EILH 4PQAA 1FP2A 1KUVA 2OQRA 2XDVA 1OISA 2HQNA 2ZSHB 3NE7A 1OFCX 1RKTA 1S9HA 5FGMA 5EYRA 1HDLA 2V6CA 3RO0A 1Z2IA 1DUXC 4ETSA 1YMEA 3B6AA 1U5TA 2W4SA 3HRSA 2JWTA 3P7NA 3SHPA 1XGNA 1B72A 5HLIA 2DA6A 4U88A 4A2UA 1PUFB 2ZENA 2FMYA 4NCZA 1LDDA 8CPAA 4B10A 1LEAA 3B3SA 1S20A 1LJ9A 2DMTA 2QSGX 4OVOA 4XLCA 2X9DA 2EO8A 4EVYA 2VQYA 3DSBA 3TL4X 2VZZA 2AHQA 4ZDLA 3BJIA 4KMUX 4W97A 3OYJA 2BYVE 4XSZF 2JA5J 3W2VA 3BI1A 1Q1VA 2PE3A 3PFEA 5FUWA 1IDYA 4KVXA 5DUIA 4A3CJ 2E60A 3M4OJ 1LRZA 3UGDA 4BE2A 3CXPA 2PR1A 2HPIA 3DKXA 4YELA 2KZVA 5CLSA 1Q2YA 2J8RA 4TNUA 2K9LA 3IC1A 2QIRA 3FMQA 1DP3A 3SDGA 3G73A 2DI3A 1BN5A 2JPBA 2YNEA 4DBRA 1QGPA 4NJQA 1YW4A 4NBQA 2BY3A 1S7FA 3V42A 4FD6A 2MC3A 2L9RA 3KHXA 3WU2C 1XF8A 2OU2A 4R79A 4CGNA 1DS2I 4B6ZA 3R9FA 3KI9A 5I4MA 2R7DA 4ZYGA 4JCVE 5K7HA 3L09A 2XKOA 2LFBA 3HYIA 4MRIA 3RAMA 1N13A 4HX4A 1J7KA 2Y48A 2K27A 3GFLA 3FBIB 3CESA 3X2QH 3N97A 2LKSA 1CSOI 4R3LA 3VWDA 3BJ7A 2ZJPF 2AFMA 4LLNA 5F1JA 1TOTA 1LUJB 4RAGA 4XNHC 2EVNA 4I01A 4R87A 3W6KB 2CQQA 2L7ZA 4X0GA 1SGPI 1YLOA 4NGMA 2VN2A 3QTLD 3NH4A 3HOYJ 2QEXI 4A3FJ 4II9A 2IXSA 5CJ9A 2L9SA 3JAMZ 3CF2A 1U6MA 2AFZA 4IRGA 1E3HA 4KSFA 3TCVA 2SGFI 1OKRA 2K9MA 2R8VA 3ZQFA 1Z4EA 1RIOH 5E3NA 4X3RA 2VPRA 5GADJ 4M6VA 1IV8A 2DTRA 4B3XA 1SVOA 1VQ8I 4FD4A 2H8WA 5HS9A 3HBLA 4CGMA 3MD2A 4M9ZA 2P7CB 5LRKA 2COMA 3T5XA 2L5QA 3TEDA 2ACJA 2DFFA 4LD5A 3IO1A 1RETA 2KLOA 3FF5A 3HXLA 2VE9A 5K5RA 1GLNA 2IS2A 4AYBN 4AIHA 4A3EJ 2M4GA 3MZHA 4HGUA 1ZQ3P 5AG7A 2JRTA 3VPRA 1KYZA 1BW6A 1S3ZA 4LQ6A 1CF7A 1BR2A 1R0RI 4Q4ZF 2ZEFA 2IJZA 2BY2A 5JLWA 3G4SI 4KOVA 1TNSA 1QQ9A 4W1UA 4ZYAA 2DA1A 2R7OA 2BCOA 2QZ8A 2WYRA 3JTKA 3N5FA 2FA5A 2PJRA 4MFQA 4CRYB 3HB9A 2CUFA 1I5ZA 1R3NA 1YLEA 1BJAA 3IU1A 3OWTA 5KAFC 1XG1A 4MFDA 3JREA 2OTJI 5J3LA 1RKWA 4XQFA 1H0ZA 1S29A 5D6EA 1FOYA 2R5YB 3CP2A 2HQYA 1A35A 4MJ8A 3GTOJ 4MCPA 4ZBGA 5LLQA 3OIPA 1ZG8A 2XF6A 1SD6A 3AG2H 4ANJA 1K78A 3GLLA 4IHTA 1QSTA 1ZGAA 2X85A 2M0MA 4QWQA 4HNXB 1FAQA 3EDPA 2CV1A 1HA8A 1ONVA 2BY1A 3AAFA 2KJBA 1UG2A 2E1MC 1REPC 1FC3A 1YSJA 4M72A 2VOOA 1A2ZA 2Z1DA 3I64A 1VQLI 5CCLA 4I0AA 2P6EA 2PJ6A 4CAVA 3B3WA 2KCWA 2CIJA 3PB8X 1HDPA 3OIQA 2IGKA 3ZN0A 4HG2A 3RU0A 2FIAA 4IL6C 2ZKZA 1UB9A 2L0KA 1N75A 3QYBA 1RESA 4Z2YA 2CV2A 4KMFA 3CPXA 2DOFA 2B5GA 4IQ4A 3B73A 3D7HA 3F21A 4E4HA 4R57A 1M4IA 1SVLA 5FKNA 2ZXIA 1YRNB 2R5ZB 1R7JA 3AG1H 4DYCA 1LFWA 1QBJA 3BG7A 1PTRA 3RSNA 2IMOA 2KMRA 3LSKA 3PB6X 3QAHA 5ERIA 5H86A 2YR2A 3JAMK 3TT2A 1TBXA 1AN1I 4HX7A 2VLAA 4MY3A 2IBDA 1H8LA 2SGQI 4UHTA 2B0UC 3H8FA 5K8PA 3VOEA 1U5TC 2YUSA 2JBJA 3QPTA 3ABKH 3M7GA 5D5XB 3RZDJ 3QODA 1J4JA 3F8KA 2GKVA 2HS5A 4B8XA 4MFJA 3BT9A 1B9MA 4YFNF 2GREA 1Z21A 4UFWA 3IH3A 2G7UA 3RI4A 1G2HA 2M8GX 2X52A 2EZKA 3DBLB 3ZQQA 2PFBA 4A6EA 2IS1A 2QWWA 4B13A 5FUVA 3SFZA 4L18B 1Y0NA 5DAEA 5HVHA 4F55A 2IGOA 3ISZA 4H89A 2ATRA 2DCEA 3I59B 4E7IA 1CPSA 2V1NA 1ZLKA 1Z3XA 3BDDA 2DB6A 5JHWC 2JZMA 2LBFB 1BC8C 1BIBA 4BQAA 1I6XA 5J1QA 3A03A 3TW6A 3SGQI 4XN0A 3TTHA 1W0TA 1KU2A 4CYOA 1BW5A 3IV5A 2PJ9A 4FT8A 3WGGA 1KU3A 1IV6A 1LE8A 3FX3A 1XGMA 2KP6A 3MZ8A 1WJEA 5E1XA 2HOEA 4OMZA 1WTJA 1OLTA 4HKFA 3EUAA 3EYIA 2P7VB 1FBSA 4A3LJ 1B6BA 1OMTA 1NXUA 3PUFA 1RNLA 3SDBA 4MEXF 2NVTJ 2GKTI 4Y49C 2CJJA 3M1CA 1BI0A 2M5WA 1LANA 2ESHA 2EIJH 4ITVA 3FEDA 3ZMUA 4BACA 1XCBA 2XB0X 1HCRA 2AJ6A 3PB9X 1EF4A 2K5TA 2OQGA 1YU6C 1APLC 2CGPA 4AIJA 3LSGA 5E79C 2Z3PA 4BL0B 3IP4B 2DPSA 4NB5A 3HIFA 2NNYA 4XLAA 1T33A 2PVVA 1TUSA 2M45A 3WG9A 4HV6A 4I49A 4UVBA 1SC7A 4PXBA 3UGIA 1GV5A 2VBYA 2Q7BA 2ZJQF 3HHGA 1YQAA 4UY8I 2R7HA 2VBZA 3VATA 3O8GA 4CZZA 3KQXA 5EZHA 4Y17A 2R92J 4PGGA 2DAOA 3C7JA 3GW2A 1B8IB 1YW6A 3HHHA 3ERMA 4BAYA 3K70C 3DLLF 2DEAA 1U2WA 2MYSA 3CMMA 4A37A 4EFDA 5E17F 4FD7A 2J5OA 1I3AA 2Q4YA 1UJ8A 4MY0A 2ENZA 2ODFA 3ZJ0A 2XAUA 2BOAA 3J7YJ 2W57A 3SJFA 3NWSA 5J4VA 3H8EA 1BR4A 2V7FA 4HNUA 4KIFA 2X1CA 3HOUJ 4DYRA 1X19A 4C2TA 2Z2SB 2EBIA 2HXOA 4HPSA 3GMEA 3CCJI 4D0PA 5TRDA 3CCVI 1XSVA 1YW9A 2Y0SN 2GAUA 1WH5A 2Q8KA 4XLEA 5FFZA 5IYCJ 2DT5A 3ECOA 3I0TA 2JA8J 5EX0A 3AG4H 2DMPA 1R5GA 2PJ2A 4MFKA 2QKMB 4MNUA 5L3CA 1S7OA 3CDLA 2E1NA 3P9CA 1NE9A 1CE3A 2MG4A 4BDZA 4QIWN 1FT9A 2GFQA 2FU4A 2ZW7A 4EGYA 4BUPA 3BR3A 4ZYEA 3DR8A 4E1PA 4NGNA 2PMZA 3HRTA 1BA5A 3VYSB 4J01A 2Y30A 2IEKA 1J09A 2HGCA 4H6ZA 5JPHA 4C2YA 5FLXZ 3ELKA 4JX4A 5EGOA 3H0DA 1IXSB 3ROUA 1K7TA 2NU3I 3WTTC 3PB4X 4YRHA 2O9LA 4WK8F 3L2RA 3QWPA 1PCAA 1ZG3A 2VIXA 4KOSA 2C1CA 4JWPA 4XOPA 4A3BJ 1TF8A 4JYWA 4RGSA 2CSOA 2OOTA 1GVDA 3F8MA 3H3UA 1TBRR 1BO4A 1OCCH 2BV6A 2WADA 3IUOA 3LSTA 3FHNA 4PGHA 1I1DA 2ZXHA 5F47A 3IEHA 4I99C 2E1OA 1Z67A 3EETA 2JEWA 4NGPA 1NTCA 2XASA 3GVAA 4UWJA 1IRXA 2E2IJ 1ZR2A 1BPMA 1JJ8C 2XSDC 1LFPA 5K1YA 1J75A 2WUUA 2MABA 4MQVA 3AL0B 1ZARA 1AWCA 1VGYA 3DLAA 2M4KA 2K9HA 2RKHA 1KQ0A 1MH4A 1A5JA 3PNYA 1TIQA 3RIRA 2HOAA 2PR8A 3E6CC 2NNNA 1E3OC 1ARLA 3K1NA 4ZX8A 3TP0A 3UGLA 3LODA 1M1DA 1XOVA 4ZY1A 3KEOA 3TDZC 5L3GA 4JJXA 3KZWA 4Y33A 4PJMA 4ZDOA 4HNWB 1VZ0A 1ELLP 2H94A 4RAYA 5E8IA 4M3SA 3ASOH 2C6PA 2YNCA 2ZO4A 4OWRB 4CYCB 3OWCA 3KLNA 2BVLA 5ICEA 3U1KA 3D5SC 2CTBA 2DJIA 4UEEA 1G3TA 3A0BC 4L5EA 2DPUA 1S7AA 3J81Z 2HR3A 3BTJA 2Z10A 3VDXA 2JBKA 3F8FA 3WC7A 2MD0A 3HSRA 3V4GA 3GZ5A 2HU9A 4HF0A 1SMYF 2RQQA 3FDYA 2H8RA 1YG2A 3KHZA 2OF7A 4HEA2 2FBIA 2HNHA 2VKVA 3JRGA 4P44A 3M3YJ 1G3YA 2AQFA 2E7XA 2XAHA 3DEUA 2Z3YA 2G0BA 2O28A 5EMIA 1NSLA 1YE9A 3HTUA 4HW0A 4A95A 5CQGA 2LOOA 3HZJA 2FEZA 1IG7A 2RIJA 2DT7B 2AFXA 1W4RA 2K02A 2VT2A 1U9NA 4XRFA 4YIFA 1R71A 1NH3A 4G6TB 3CUQA 1Z8TA 2VBQA 3FBUA 1ETOA 1PUAA 4GM5A 4C7IA 1RR8C 4DZPA 4U7DA 2C27A 1S72I 3DKYA 3MN2A 4C3IJ 2XPWA 3PBEA 1X12A 1XBUA 1FSEA 4HNVA 2OCEA 4UF4A 3MCZA 3MAJA 3PM1A 3R60A 4MQ9F 3FB3A 1XPXA 1B4AA 1E3PA 2O8XA 3TOAA 5CQEA 1OYWA 4F7ZA 2B9SA 1FIAA 5L3BA 3PEIA 4P4FA 3S17J 4BQQA 1Z8LA 2CQXA 1FBUA 2CQ7A 5E3MA 1PDNC 3D3SA 2E34A 4G94A 3FRMA 2CXAA 5H6QA 1I27A 5DD8A 2CNMA 4U7BA 2EFOA 4A30A 1YYVA 4HZFA 2DN0A 1KU7A 2DMNA 5J4YA 4RB1A 2J9AA 1RO5A 3S2DJ 4KN4X 1FP1D 5J40A 2AS5F 3CD6I 2LUYA 4BJ6C 3IL2A 2I8DA 2NXNB 2SGDI 1GV2A 2JT1A 2QSFX 2RGVA 4A5NA 5LFAA 1FYKA 2LB7A 3R4KA 4EMEA 4U0WA 2K9NA 3MKLA 4WX9A 3OR2C 2R0QC 2R98A 2HZTA 1O4XA 2W24A 2RVCA 2DU9A 4CDGA 2XIGA 3HDDA 4KUMA 1XBTA 3O3KA 2O53A 3VDUA 1T0FC 2V8HA 4NC8A 5I0CA 1VI0A 1MJAA 2LK2A 3MMYB 3S3NA 3WR7A 2VI6A 3WE2A 3FK7A 1CGJI 3GYAA 1MZBA 2EK8A 4EJVA 4XPDB 2ZEPA 3V8JA 1R1TA 4Y7NJ 1HOMA 2ZW6A 2CWGA 2JYYA 2WAQN 1ZH5A 3FECA 3ZMZA 5E3OA 1X1AA 1S5LC 1SAXA 3UFFA 3CMAI 1Z2LA 1IGBA 2JXDA 3PFYA 1T98A 3FMSA 5M5XJ 2V8DA 2OH1A 2V8GA 2GOMA 4LK0F 1UHSA 3OS2A 5CPAA 3FH4A 4L9MA 1BOAA 1X1CA 1AMPA 4EV0A 4UCNA 3CPAA 3SI2A 3IHUA 1LAMA 4F91B 3FX6A 4HLYA 5CYVA 1VIXA 4JXRA 1J5YA 1R1VA 1X58A 3LMMA 4UB6C 4ESBA 4Z6YA 5A2QZ 4HDVA 1S7NA 2PSWA 5F09A 4E7SA 3CLQA 4BMHA 1TNTA 2ID3A 4L9JA 3CO6C 4P96A 3BR6A 2QKLB 3I9SA 4ZYDA 2WPWA 1Q2CA 2V77A 2K86A 2L7FP 5EJCA 2IT0A 4NHJA 5BS6A 2R1IA 2O61A 4XKBA 5JLXA 3KETA 3E6DA 2L02A 4D7MA 2EV5A 3J7ZI 2PJ8A 4MHZA 3COAC 1T38A 1TKHA 4KOTA 1Y7RA 1YS7A 4BKXA 2N8GA 4G7ZF 1RFHA 2WVJA 2C6CA 1LEBA 4HNYB 5GAHJ 3F72A 4MHDA 4P10A 1ERDA 3RYRA 1W5CC 5ISVA 5EG0A 2TRTA 3FKIJ 4UUSA 1Y1WJ 2V1UA 4X6AJ 3BXMA 2N71A 3R1KA 2R7VA 4PPZA 1HEEA 1VHOA 2YGWA 2ECCA 4OIOF 4TV7A 2BOLA 2LH9A 2X3TA 3PRTA 3NH8A 1K83J 3E5QA 1D0XA 2HKOA 2FNFX 2X7BA 4EMSA 2R7XA 2GE3A 3G1MA 3R5CA 2WAFA 3KP5A 2GLJA 3TQNA 3O2PE 4U0VA 3GUXA 2NYQA 2YNCC 1OZPA 4FE7A 1Y8QB 4M9SA 2EFPA 4XN3A 3D7FA 1WH7A 2JN6A 1ACIA 5CBMA 5ICGA 4XPLA 2QVPA 3OSGA 4L0ZB 4RUHA 4JXQA 3KYLA 2COBA 1O3RA 2CWFA 2D2WA 4PJNA 2D1HA 5LEKA 4A12A 1JXSA 2BUSA 1XTAA 1JGGA 3K4BA 4V2FA 1RI7A 3FHZA 3H3VK 2FXAA 1VF9A 1OMUA 3OYCA 2PI0A 4XONA 1KWMA 3DTEA 4LG0B 5K7FA 1AU7A 4UNOA 2EFNA 3QNVA 3K10A 3AFHA 1GUUA 1IN7A 3FJUA 4XICA 3B02A 3JRIA 2OBPA 3OMYA 4FQGA 5F0FA 1JKQC 4G1PA 4KFCA 4UWIA 3KEYA 3QP6A 3IAM2 1BIAA 4O23A 4P4EA 2AE6A 3A1YA 5EEHA 4DJAA 5AIPA 4PK3A 3Q5FA 4CYQA 2HDWA 2Z3NA 2V53A 1E2XA 3R61A 4GYGA 1X3ZB 1TL8A 3JSOA 1K79A 2Q2EB 3CUQC 2Z16A 3I53A 1R9TJ 1A31A 4MFPA 5JH9A 4BQOA 2D4PA 1T8IA 1OVOA 4AXVA 1O7LA 5LHIA 3A02A 1MIJA 3ZR8X 4ZZLA 1R5HA 5A2QK 3RPQA 1GT0C 5FUXA 1XSXA 3DU6A 4IF5A 2BXYA 3PQJA 3HC7A 2CQKA 3H4QA 1XA6A 2PN6A 2ERWA 3HUGB 1Z4RA 1UFMA 3SGBI 3EXNA 4LQGA 1QHHD 1ZHFA 4AIDA 2QLZA 2L4AA 3HOXJ 2GXBA 4HLXA 1ULMA 4H6UA 1YITI 3K6GA 1R49A 1AYEA 2DQRA 5J1RA 3OXFA 4KLVA 1LQ1A 1XJOA 4FAIA 4F0XA 2GA1A 1PTQA 2VONA 4A94A 4UIBA 2QQAA 1FSHA 1HSTA 4FHTA 4IRHA 2DA7A 4Y52J 1WKXA 3DWLE 4KZTA 5AG5A 4YIIA 4YG2F 3L1PA 2EBJA 2LG4A 3CO7C 4A3JJ 3F8NA 2OAZA 3H9JA 4KA4A 3IWWA 5H20A 3TDUC 4BE0A 1X2NA 5FRNA 2P0WA 1W0UA 3K4NA 5HLTA 4GS4A 1Y56A 5LGUA 3F3XA 3FBNB 2DOEA 5K7ZA 4PSXA 5TGTA 1MMAA 2W7NA 2HB6A 4ZGYB 4E70A 4EJWA 2DA3A 4IHWA 3OL4A 2I5UA 5BNGA 5CPRB 2KMOA 2DDAA 2BHZA 5B66C 5JQ4A 4GO1A 2XGDA 3SQNA 4BQNA 4ABZA 3IIBA 2CQNA 5LD2C 3ML6A 3UKGA 2JUGA 2Y2ZA 3WE3A 3N4MA 4CGLA 2YSRA 3E0KA 1MBJA 1B87A 1UVGA 2ZOGA 3J80Z 4N9HA 3KCCA 4ENMA 1TBNA 1SANA 3DCFA 1SD5A 4P9UA 5JHUA 7WGAA 1TZLA 5FKOA 2UWMA 1Y1BA 2FNPA 3FIWA 2ELHA 4AMLA 4BXXJ 1W7PA 2PEXA 3I4NJ 5GP9A 4RA2A 4UXIA 4NEXA 4M9XA 3HL2A 1DS3I 3CCRI 3LL7A 1AKHB 2D4OA 5E3RA 2M1BA 1S7KA 2B4DB 3PGPA 2VC0A 3PFOA 3E5XA 1L0CA 1FYLA 1BAVA 3FXTA 5E1ZB 3S32A 1HC8A 2Q0OA 3H5ZA 1T95A 2QYVA 3I4MJ 4RI1A 3HKZA 1IOIA 4RLFA 4KNYA 2RFHA 4KOXA 4D5FA 2JA7J 3GO5A 1PUFA 4MEYF 1DGRM 3J7AO 5KK1A 2BUEA 3RKXA 4FX0A 4J3GA 4P45A 1HQCA 2HWVA 2M7BA 3W2AA 2G7HA 4XM3A 4BBHA 3HOSA 4CCMA 4A3MJ 1IDZA 1Y9KA 2CW8A 4HSTA 3JVNA 3T1BA 3WODF 5FFXA 1VFCA 2IRFG 2UZ3A 5B5EC 4JK1X 1XC5A 1OCTC 3S1MJ 1P4XA 4M3BA 2ZEGA 2VE8A 2NU1I 1QSOA 1YW8A 2CW0F 3WU1B 4KS9A 2IVMA 2PLYA 1ZR4A 4GI3C 1IXRC 2F4MB 1HF0A 3CC4I 5KTAA 4MFEA 3BZKA 2KKOA 2F3CI 3H1CA 1OJLA 3SEQA 1X3WB 5ILSA 5LGTA 1L3LA 2KMUA 3HPGA 3P9KA 3B3TA 2QPOA 3KZIC 4P6YA 2Y9YA 2JPCA 1WI9A 3BG5A 3D00A 4OAEA 1SFEA 1I21A 4NF1A 1IUYA 1U8RA 3CCMI 5M3FJ 1ON1A 3GIUA 1ITYA 2HYGD 4R1HA 3D1NI 1FX7A 3S16J 3C2HA 1LR7A 2DA4A 4AVPA 5KCMA 3CUOA 1BUSA 2WC2A 4JYKA 3PQKA 1SFOJ 2PJBA 2O3FA 2XEJA 1VQNI 4CXFA 4RM3A 2ELIA 2XRCA 3RQIA 3I55I 3E97A 1CHOI 1BPNA 2ESNA 3CZ6A 1XN7A 2ZC2A 4CCKA 2M30A 1GHEA 2MH2A 1Z6TA 3L2NA 2W82A 1T39A 1WGCA 2VBWA 3J80K 3I9V2 1P4AA 2L01A 3RPUA 4HDUA 3JUWA 2LSOA 3VFZA 4BJ5C 3OXLA 3ZN1A 1RRJA 3R0JA 2FXFA 4YFKF 4NC7A 4MHPA 2ZFUA 3S9MA 3EYYA 1JJ6C 2QQEA 1QVTA 2GBYA 4GXOA 3I3GA 1Q1HA 3VARA 3QP5A 4U87A 4GRIA 1IOFA 3FXRA 4OIRF 1HSJA 4CCNA 2Q4ZA 2Q7SA 1IN8A 1WJ5A 2M34A 3C3WA 2IA0A 3CQZJ 3M8EA 2HOTA 3GTGJ 4IEJA 3K7AJ 2DODA 4EM1A 2XV4S 4KITB 1FBQA 2MBFA 2XGXA 4JP0A 3VYRB 4B6DA 5DM7F 3NWTA 3EO4A 4CYPA 3F0CA 2Q04A 4LITA 2P4WA 1ORKA 4NQWB 1EJ9A 1TKJA 1A04A 1Y0RA 5F46A 2NAZA 1QO0D 2JW6A 3K4JA 1ZKGA 4EQQA 3K4LA 1GVJA 3MQ0A 3R5DA 4ZZDA 3MN8A 3P5JA 2QBYB 2R5YA 2JVHA 5D6FA 1Z1DA 3NARA 4XLHA 2E5NA 2KPMA 5E8GA 3C18A 1Y7EA 2DA2A 4MCQA 4EWTA 4MBUA 5LYDA 4XLPF 4FUUA 3CLOA 2MSYA 3TE4A 2LDUA 5HS8A 3FSXA 2YPRA 4R7MA 2OUMA 3ZQGA 2AFUA 2KHMA 1JHHA 3K4MA 1P9ZA 5HS7A 2GANA 3D4UA 1W36C 3KIOA 3GTQJ 2GXGA 2PMZN 3DTKA 5BPIA 3ZGKA 1F57A 2V1XA 3ERED 3I1UA 4UFXA 2JQ7A 1H9TA 4IRIA 1Y8FA 4ZH4F 1I1GA 3LWUA 1O7FA 3B2YA 2WAEA 1FY7A 2HXIA 2Y75A 4XKVA 3BTIA 4OMYA 2QMLA 1LR8A 3KE2A 4WWCA 4IKFA 3HRMA 2VJ5A 2F5DA 2PQ8A 2R5ZA 1YRNA 4C2MJ 3L2UA 2ANPA 1D1AA 1LCPA 2PJ4A 5KVRA 1D1CA 3DPLC 4AVCA 1B9NA 4CH7A 1ETKA 2JZYA 1Q2DA 4ASNA 2LVSA 1BOBA 4PFOA 1U78A 3ZQHA 4C2UA 1Z3YA 3PBBA 2OZ6A 4XR6A 1HKTA 2X0LA 4OC4A 1BJZA 1UHWA 2ZMEB 4NC6A 3ZPLA 2KISA 4Q5SF 3KZZA 4IX7A 1FWZA 4HA8A 2QCOA 4Y15A 3V7CA 3L2WA 1P2FA 3HH2C 2D5VA 1A6QA 3ZRGA 4ENNA 4L9VA 2J87A 3BJ8A 2B3VA 2V1DA 2LYCA 2Q0YA 4LLGF 3NH5A 2VJIA 2KQRA 2HTJA 1YW7A 2GIZA 3UR3C 5E1WA 5HODA 3AKZA 2PJAA 2REFA 2IA2A 3EFAA 3CP8A 4UVCA 4JQFA 2W48A 1OYIA 2PX9A 4S04A 1FOKA 3WGHA 2NRAC 5LRSA 5KHDA 1FT7A 3IH4A 2LR8A 1A6IA 1UUCA 5E3PA 4IUSA 5DV5A 3QB8A 3I59A 2ELJA 5DM6F 1VKCA 2PRBA 3FXUA 1FNOA 4ZJZA 4IAVA 4RS2A 1NUBA 2VXDA 2LBFA 2JDDA 4CS0B 2KFDA 2EFWA 1P4NA 2J8MA 4EM2A 2EK5A 3S14J 2JSPA 3BTLA 4B09A 2KMQA 2N1AB 4OC3A 4B5PA 1NMTA 5HXDA 1QSRA 4GGGA 2ZEMA 3OYHA 2XAQA 2LF8A 2PJ3A 2DQLA 2YUUA 1G3WA 4FCYA 3LAPA 2ODDA 4ZY2A 1IRFA 3F8BA 2FQ3A 4L9TA 3KYCB 2FCKA 3OYAA 1DQUA 4Q38A 3NQOA 2K9SA 3HOWJ 4E1RA 4ZYQA 4E0AA 1JTXA 1EV7A 1QZZA 4MI4A 4CGPA 2OD1A 4UEFA 1RC9A 3BQZA 1X4PA 2LNBA 2W1OA 2ZFWA 3BY6A 4S05A 1F2OA 4M74A 1MDMB 4II2A 4EJOA 3I56I 4OKOA 5JVTA 2K4JA 2B4BA 2NVQJ 4PK2A 2V79A 4UV8A 1PP8F 5L3EA 1ZREA 1UFHA 1MSEC 4MPIA 5AG4A 3SJEA 4HQEA 4IJAA 3IGRA 2DIPA 3CC2I 2NOJB 2LREA 1SEUA 4RGRA 3GLJA 1VQ5I 2DT6A 2Q43A 4ZDPA 1HXDA 2OTLI 4NGSA 4UEZA 2K40A 2GVIA 1RUOA 4IHVA 1B8IA 2XF7A 5EDNA 3JRAA 3PO3J 1WQ2A 2X4HA 5F1RA 1V0CA 3K2KA 5C4JJ 1EA3A 5FJ8J 3WTVC 1F5TA 5CVVA 2Q44A 1S5KA 1WJAA 1MJBA 2XF5A 4YGOA 3VSLA 2QENA 1MMNA 2CFOA 1JI8A 1S7LA 2VKHA 1C0WA 4CCOA 4CUGA 5HVFA 1K7AA 2FD5A 3BZ6A 3E7LA 3L2VA 2B58A 3E2IA 5HOOA 1MW7A 3HTSB 2NYXA 1IN5A 1DGWY 2CRGA 2MLKA 2R7FA 4G12A 2VI7A 3RKWA 1TBQR 3BJOA 2L54A 1PJRA 3RDIA 2ZOFA 4N0BA 3KR4A 2RQPA 5F64A 1XX5A 4I0BA 4M6GA 4NGRA 2KIFA 4IHXA 5KTCA 1MK4A 1DP7P 1ZG7A 2RREA 2F4IA 1T2KA 1QQIA 1MNDA 2VBXA 1J9IA 2AXLA 2PJ0A 1T0FA 4N4NB 2NVXJ 1X1PA 1IXCA 4BGDA 2CJSC 1X4SA 2A3SA 3SI1A 3OOPA 1FMVA 1UELB 1RPWA 4ZI6A 1XSDA 2E2HJ 1ZN2A 2JSCA 4XBFA 2OCCH 1VQ9I 2VPLA 5M5YJ 5E3QA 2WSAA 3R9EA 2O4HA 4LOCA 4WXCA 2QUFA 1WWXA 2J9RA 3H5RA 1ZRDA 4PUSA 2HVRA 2AQEA 1CP7A 2ZW4A 4M6YA 4I02A 2BZTA 4BBRJ 3CCYA 4I7HA 3U1DA 4ONWA 3NEUA 4XRSA 3K70D 4L9NA 4A3IJ 2DYSH 1BI3A 2ICWG 2Z5UA 1YO5C 2FVGA 2FJ1A 2BY0A 2MA3A 2ZXJA 3D2PA 1TQIA 2CG4A 1MNEA 5H2FC 3PIOF 2EK9A 3UY5A 4IK2A 5IY5H 4KDPA 2DYRH 3B6CA 2B63J 1SGDI 4B4CA 4BEHB 4AVBA 2G9DA 2ZXWH 1BC7C 4ENKA 2V8VA 2QF7A 4KT6A 4MTEA 2TCTA 5CVIA 4J00A 4QVTA 3UNGC 3JRHA 3BOQA 1YQEA 1UG0A 3A4CA 3CXSA 3KQZA 4KOYA 1JGSA 1YX5A 3DXJF 3OYEA 4BU2A 2PJPA 1YIJI 3GF2A 1XIXA 1IAWA 2FE3A 4QPQA 1ZG1A 4OIWA 2I10A 3KX2A 3KLOA 5LGNA 3K2ZA 1LDKB 4P5OA 4AD9A 3LSMA 5G20A 2R7QA 5AONA 2EB7A 1TWHJ 1UMQA 3FWEA 1R79A 1YX0A 3JR9A 3T8WA 2WZNA 2OD5A 4LUAA 2BHYA 2PJ1A 3HEFA 1K4JA 4C2ZA 1YS6A 1TGSI 2LY9A 3N7ZA 2REEA 1JUSA 4B44A 4EJTA 2EV6A 1GHCA 2ISYA 2OA4A 3TO6A 3FXQA 5DTDA 4BBSJ 2W84A 2YU9J 3QU3A 4DGWB 1WSUA 3Q9SA 3WHBA 3MEXA 2Q4VA 4KVME 3ABTA 5AIQA 3Q0UA 1SGRI 3ZXSA 1OYVI 2KT0A 4B48A 2VZYA 4OC5A 4YFJA 2A5WA 2E5ZA 4UBRA 4HYEA 3W91A 3RKYA 3PB7X 3HGGA 4RB0A 3H5NA 3Q0WA 1WJCA 4M73A 3BC8A 4V2GA 3NRVA 1LFBA 2RN7A 1FJLA 1R4NB 3DBRB 2XRLA 4XLFA 1IRGA 5LYIA 5JM6A 3VDPA 1QZYA 4Y3OA 1OCRH 2UXNA 1N77A 1LVAA 5JI6A 3MKYB 1JKRC 1K7VA 3CJRB 3KP2A 1WJFA 3CZXA 2N52A 1YGHA 3HLPA 1SAUA 2HDCA 4NGTA 1P92A 2EPFA 1WJDA 3PP9A 2O03A 2DK5A 4AB7A 3F6OA 5ED4A 1I1SA 3FVLA 1AOYA 5JHFA 5GPCA 4WP4A 1ZTRA 2GKRI 5GPAA 2JJ7A 5CVRA 5FLMJ 1FEXA 3JTHA 1TQPA 3PSFA 1R6RA 3DPTA 3CJNA 3M8JA 2WWYA 2WV1A 1W4MA 1D3YA 2IGNA 4WXDA 1P7JA 5CKTA 4UUTA 2ZELA 2E1CA 4OAZA 1S60A 3GZ6A 4PXCA 2P8TA 4CICA 4CA0A 2I3CA 1V4RA 1D8JA 1R36A 4MTDA 5EEGA 1IZ1A 1JKPC 5D5UB 1X74A 2PDOA 1IW4A 1DTDA 2PBIA 5BMZA 4A2ZA 3EY5A 1HKQA 2DPTA 2KRFA 3A01B 1ZG5A 3RCOA 5EBVA 1X4OA 1ZLJA 4IOAF 3FXLA 3PJRA 4LIVA 4E7ZA 5G1ZA 2F48A 4NGQA 2O5RA 1KONA 3F8CA 3K1MA 3KZYA 5DCMB 2PVWA 1VDDA 3PO2J 1Y8RB 2MD5A 3RKQA 1X1BA 4OINF 4F3QA 2JMWA 2GIVA 3UEYA 1J0RA 2VT3A 4KORA 5C4XJ 1NHAA 5LRRA 5ILVA 2OB0A 5LYFA 3SJXA 2STTA 5IP6A 1BMOA 2L8EA 3DBHB 1JHFA 1TWGJ 3S6FA 2XPVA 3V8IA 3WABA 1ETXA 2A05A 5KTDA 1IN6A 2MW8A 5GTIC 2JEVA 1YVKA 3QWLA 2MGQA 2WA0A 2KMPA 4M6IA 3E0JB 3TOBA 2V9VA 3VODA 4X8IA 3HSFA 1V3FA 1MJ9A 2G3TA 1IN4A 3K4KA 4G6DA 1PPFI 3GKRA 2V1CA 2E73A 2QQ0A 4ZTJA 1W3SA 5L3FA 3OYMA 3WTYC 3G6EI 1ZGWA 1NSAA 2CH0A 3WC6A 5FUYA 5K8OA 2G9WA 1B6AA 1XEBA 4NJRA 2EV0A 5TISC 3ZP5A 2MLGA 4C2XA 9ANTA 3HKZN 2P5LC 2HQ5A 3ZQIA 3AL0C 1RXTA 1XMBA 4QUSA 4NUBA 2F5IA 4BNCA 3GTPJ 1FPQA 1WCMJ 5JR3A 3K69A 3EUHA 2WTEA 4II3A 3IWGA 1Z7LA 3LD2A 2DFIA 2QVOA 4QPOA 3WTZA 1VNDA 3M07A 2BE5F 2R3SA 3OYFA 2CTCA 4MLOA 2R7UA 1HEVA 2M5XA 1LVKA 4NSQA 4O6JA 1TTYA 1WRJA 4MHNA 5F49A 3RYOA 2M8EA 3ABMH 3B3VA 2CO5A 4H4KC 4XLNF 3S1NJ 3G1LA 5FKKA 1KU9A 3WTXC 3ISXA 2ZCWA 3PNVA 3LNQA 2KDOA 4C3JJ 4A3DJ 3TMOA 3I5UA 2CYYA 5D5VB 1OR7A 1UZCA 4KISA 3HJEA 4LMYA 2NU0I 2K3PA 1RR7A 2JUCA 3T8TA 4A0XA 2HDDA 3DKWA 2IAIA 2HVSA 4ZTFA 2X48A 4OOIA 5DYMA 5AGEA 1E0EA 1Z9UA 3S1RJ 1OCZH 2AFOA 2ZPAA 3ECHA 3DLJA 1T56A 3M8FA 4RBOA 1BBYA 4R6TA 2HFHA 3G3SA 2VB6A 2WY8Q 2H5MA 3JW4A 1P7IA 1L0OC 3QU6A 4AC0A 3DV8A 2VQHA 5F6FA 2VJJA 3FM5A 4BJTA 5E20A 1AHDP 2GOXB 1AUGA 1KUXA 5HH1A 1VHSA 3F23A 2W0TA 3GBGA 2DMQA 5DS9A 5FB2A 4GDFA 2NSMA 4XKWA 4YRVA 3F6VA 1WK4A 1CX8A 4PV6A 4CHUA 4MMOA 2JVGA 2KZGA 3A0HC 1MH3A 4K30A 1CT0I 3U21A 1U9OA 2ZW5A 2DF5A 3H92A 1CGII 1TXRA 1P9QC 2Q2EA 2QECA 1PVEA 2CFXA 3C2GA 1Z9CA 1O3SA 4DW6A 3IU2A 6PAXA 3AG3H 2MC4A 3KEQA 3CF5F 4G7OF 4A39A 1K61A 2VXKA 3BP8A 1JQGA 1XE4A 3FMRA 3FEEA 4OIDA 4HNTA 1QSMA 2W85A 4WXHA 4OP4A 2CUEA 4P4JA 5IB0A 2LF7A 5M5WJ 2ZB9A 1HKSA 1PP7U 2JA2A 5K5OA 2OPTA 3GX4X 4U9ZA 3V7RA 1CJWA 2FE7A 2VKDA 5ELYA 3GTLJ 4F0YA 2W25A 2FOWA 2FNAA 3PL8A 3BTCA 4MIMA 2G3AA 3SZPA 2BW3B 1MMSA 3BWGA 1HDQA 2AXTC 1JTYA 1XRYA 3JRUA 6CPAA 1KGSA 4XNHB 1SGEI 1TWAJ 1XGOA 3TO9A 2B7EA 2E36A 3QYEA 1Y0UA 4XMYA 4KVOE 3K9TA 2R7WA 1WGXA 1PCEA 1SD4A 2DO7A 5ICCA 1IGNA 4HBLA 2V26A 2L4MA 3IKVA 3WTWC 4A93J 5D4RA 1VQ4I 1H0MA 3GZNB 4JLYA 2KIMA 4RB3C 1IO2A 1YJWI 5HDNA 2QQDA 3SJGA 4XPDC 2JA1A 3D5RC 3GWZA 1MBHA 2VRWB 4M3FA 1CG2A 1QMUA 2WV0A 2ZSIB 4A3GJ 2XUBA 1Y0YA 4CYNA 3G2BA 3ZQCA 2VC1A 1R57A 1UVFA 2DA5A 4UV9A 2BO9A 2DFEA 2CF4A 1DPRA 4B11A 2O7OA 3VB2A 2V6EA 4BDYA 5THWA 2DFHA 2UUZA 3EUKL 4RS8A 2JDCA 4YU9A 4HQMA 3H9GA 5KAIC 4G9YA 1HW1A 2XGCA 4IQJA 3S15J 1HLVA 2E5RA 3CJTB 3DPUA 2ABZA 3E6MA 1V5GA 2IPQX 3GFIA 1XS9A 1FZPB 2GM4A 2PRQA 4A31A 4A6DA 4KOUA 1FOXA 4QTRA 1X10A 3B8GA 4YFXF 3TFYA 4P9FA 4BS9A 1AKHA 3E59A 2M7AA 1I39A 2VOPA 3SEKC 3CMEI 3GEZA 2B4DA 1ON2A 3IC7A 5HDKA 1VQOI 3H5AA 3CXQA 1WJBA 3OYIA 3V8LA 2QM3A 4EATA 3A2KA 1WVRA 1TWCJ 2K3FA 3IH2A 1HBXG 1UAAA 2V1CC 2R7ZJ 1LB2A 2ME6A 2O6GE 3C1DA 3OVOA 4BHCA 4EVIA 1MBGA 2PMHA 4LK1F 2ENNA 3ESWB 3SZGA 1XMAA 4PJ0C 1KUYA 4AG7A 4CAEA 3V38A 5C88A 4DBQA 4BXUA 2E1MB 2ZEHA 3I3LA 1QRYA 2KDZA 2DPDA 2M2EA 3I58A 3V7SA 4XPKA 1ULKA 1FMWA 4KIGA 1LAPA 3EUHC 3CDIA 3I4PA 3JRDA 3D7DA 1SQHA 3LWFA 5D8NA 5JGFA 4AM3A 4FD5A 2EZHA 3R6SA 2M0CA 3R95A 2A6EF 1W7PB 2EWBA 1F43A 4BXFA 3P2FA 2GA2A 3OS0A 3S6GA 4CSWA 4A5MA 2EJRA 4GCVA 3KASA 1GXPA 1KBEA 3CMYA 4DZJA 2VKEA 2CWHA 2XRNA 3BI0A 2RDPA 2QA4I 5IYBJ 1VTNC 1ODDA 2F5EA 1HDUA 5HQ8A 1I3QJ 1OR7C 2JTVA 1P6RA 1U3EM 1FYBA 3KL9A 2K4BA 4HF1A 1AA7A 2WCYA 1YHQI 3D7GA 4LJZF 2N17A 3FKJA 3FXOA 2DJNA 3PSIA 1U5TB 1ULNA 4QC6A 1Y39A 1B72B 2FBHA 3TC8A 2DK8A 3BR1A 5JVGF 2IA1A 1TW3A 2PCUA 1G59A 3W6JB 2MH9A 4MCSA 3K4CA 4BHBA 1P0HA 5FROA 4E8OA 3CTAA 2P6FA 2KCXA 2FIWA 1Y9WA 2DOAA 1XGSA 1B1BA 2F6CA 2UXXA 3D67A 4IHSA 3L7WA 1F4KA 4UB8C 3Q9VA 2POKA 1V54H 2Z3KA 4NFRA 1E17A 3ZQ7A 2JRMA 4O5VA 2VL1A 1Q9BA 1UWYA 3WU0A 3ABUA 4CO8A 5HVQC 4BYYA 4JD6A 1CT4I 3GOXA 1ETQA 2LMDA 1POGA 2ECBA 1DPUA 4L8AA 1JKOC 2F8HA 5IB9A 3FMCA 2XEFA 4LX9A 1N25A 5A27A 2Z0ZA 1QNTA 5EZGA 1KMAA 2L7XA 4LFUA 1H89C 3RJPA 1M4LA 2XSJC 2GU2A 1SGQI 1BI1A 2Z9OA 4KYWA 1D1BA 3F0AA 3HOVJ 3R5BA 3QYFA 1JUPA 3EPZA 2WPXA 5IPAA 2EUIA 3W6SA 1T6SA 2X1EA 3H9QA 3LQQA 4BY7J 3DF8A 1M4GA 2OZHA 5F0HA 4P4BA 3FK6A 3WGIA 4PXEA 3UOEA 3V7ZA 4P55A 4Y49B 4JX5A 4NQWA 4FTHA 3IKTA 3G71I 1YR0A 1SFUA 4MXUA 4HF2A 3SXYA 3RNZA 2VUMJ 5F04A 1LR9A 2WBMA 2NVYJ 3SZTA 4BH9A 4PJJA 2QBYA 1DE4C 4I98B 4PFPA 1Y1VJ 4LB6B 3D0SA 1K6OA 2QQ8A 1O57A 3LSHA 2O8KA 2WGCA 3BCAA 4BD9A 2CWEA 4PXDA 4A3KJ 4D7NA 4CAWA 3P2HA 3DP7A 4LIUA 4C3HJ 5HLGA 3S8PA 9WGAA 3FYNA 1R23A 4HSRA 4OIPF 3CJQB 5DUKA 3L00A 3TJQA 3LSIA 1IY6A 2AFSA 1KQ9A 4E7KA 3VWEA 1I50J 2E7WA 1MMDA 3BR2A 2Q51A 2HI3A 2B3UA 3D8PA 4K3NA 2YU3A 4I76A 4C9YA 3OYDA 1FYMA 3CC7I 2HTSA 2L9VA 4RGUA 1CF7B 3W6VA 4MGRA 4M85A 2LC2A 4JZ0A 2BSWA 3LAJA
chains in the Genus database with same CATH topology
5DD4A 3C26A 5FVJA 4ONUA 2VEZA 1KA8A 4OADA 3MFKA 2OZGA 3RYPA 3BROA 2YX7A 2BBYA 3I54A 1EH6A 3G8WA 3QRFF 5C82A 5G22A 4KLWA 2NS0A 2ZMEA 2R1IA 3FNCA 1YLFA 1K78B 3L2CA 4QBJA 1ON0A 3FZVA 2ARHA 3SXNA 2J5PA 4RAZA 1PUEE 4L5IA 4ENJA 3DFGA 4RGXA 4EGZA 2Z99A 2KJCA 3TKYA 3ZMTA 5IT3A 2B5GB 3T8RA 2K7LA 1KYWA 3SHFA 5DWMA 1F1ZA 4CAFA 1QSNA 2P5KA 4EJUA 1W7PD 2UZKA 2BL1A 4L0YB 1M4DA 2XAFA 2ETHA 4IVNA 5EC4A 2H6CA 3W6XA 2XROA 2I00A 3BJ6A 2O0YA 1MDMA 2FT0A 4KUAA 1O3QA 3QOPA 3MZYA 5H84A 1D8KA 4BHPA 2EA4A 4DQ2A 1Z7UA 4KIBA 4WCGA 2ZXVA 2TDXA 5A28A 1IICA 2J8NA 2IL4A 1OPCA 4A0ZA 2NMTA 3U9GA 4B5PB 3R0AA 2QQ9A 2IJLA 3LA2A 1UHMA 4OLLA 4HOBA 3ZMVA 2GZWA 3WTUC 4OU0A 5LHHA 4R3KA 4M71A 1S3JA 5HDGA 2VXZA 1ZGJA 3S6KA 4ORFA 4UUVA 2XHKA 4CGZA 3BPXA 4K2EA 1OYYA 1W5TA 4AG9A 3BLNA 2DXQA 3CDHA 4M6XA 4UCMA 4KT5C 1S6LA 1X3UA 2A07F 2HEOA 2VODA 2P6SA 2Z3LA 3I71A 4E2AA 4Q48A 4UCPA 2L3DA 4KSAA 1XMKA 1XB4A 3DQVC 4PSWA 4IF4A 2Z3OA 3FIXA 2H09A 4NXYA 1GXQA 1DDNA 4AVAA 3IWZA 5ICFA 1IYLA 3L9FA 1IIDA 1P4WA 2HQRA 4KICA 2I79A 2A69F 1YTYA 4RB2C 1YIOA 3GUDA 3ZMDA 1R1UA 2PC1A 3R96A 4A33A 2C6YA 2P5VA 2CNTA 4L89A 4MFZA 2FSRA 4ESJA 1G3SA 1TLHB 5HLHA 5BWAB 4UVAA 3GXOA 3G3ZA 3E5UA 4C68A 1Z91A 2FL4A 4DNCA 4HX8A 3BPVA 1M44A 3DR6A 5E18F 2CNSA 2A5YB 2FMLA 5IX3A 2PG4A 3DNSA 1WWZA 3M9AA 1YK3A 3U2RA 4A0YA 3IWFA 3HSEA 1EH7A 2F2EA 3D5LA 1RUNA 2GWRA 2HUZA 2ISZA 3PFIA 1Z05A 4ON0A 3ZZIA 1F9NA 1HW5A 4R9MA 1R58A