3TO6A

Crystal structure of yeast esa1 hat domain complexed with h4k16coa bisubstrate inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
275
Chain Sequence
b'EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase ESA1
molecule tags Transferase/transferase inhibitor
source organism Saccharomyces cerevisiae
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
total genus 80
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to6A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to6A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to6A02
1S8NA 4IVNA 3QOPA 2E7XA 3SHFA 2XGXA 4EV0A 4NEXA 2O03A 3KKWA 2BE5F 4CS0B 3LD2A 2BGCA 4WXDA 4YG2F 2PMHA 1G3SA 1I27A 4JBAA 4EGYA 1Z91A 2QQBA 2XRNA 1MDMB 3W91A 1U5TB 4N9HA 3BDDA 1ZARA 4EJWA 5LGNA 5ILSA 2LKPA 4HA8A 1RO5A 4PK3A 4HV6A 1GVJA 3VWDA 2TDXA 3WTZA 3H92A 1CJWA 1V0CA 5F46A 2BYVE 2M45A 3H4QA 2BEOA 3DPTA 3IGRA 4XPDB 2XROA 3WGHA 1HQCA 2K02A 4HF1A 5IB0A 3G3SA 3R0JA 4M6XA 3B8GA 3HRMA 3I64A 1MKMA 2ZNZA 4Z2YA 5E96A 1ULYA 4MQVA 2G9WA 5HS7A 5D8KB 4XLPF 4HNYB 2OAZA 3MQ0A 1BIBA 5F48A 4PGGA 2E7WA 2DU9A 1KU2A 2Y48A 4OIRF 4BMHA 4B8XA 1DPUA 1IW7F 1TBXA 3SZPA 2FMYA 3KFWX 2HOEA 4KVXA 4HLYA 4WXCA 1MDMA 2FXAA 4QUSA 5E17F 3CUQC 2ZW4A 2P6EA 3O6BB 2WPXA 5J8CA 3WGIA 2X4HA 1OKRA 5BMZA 4LJZF 1TTYA 1PUAA 1O3RA 5DD4A 1K6OA 1EH7A 1SQHA 3WODF 4K2EA 3RJPA 2MA3A 4EJVA 2QUFA 4G9YA 1P4XA 1PU9A 1KQ8A 2Q7BA 3E5XA 5HLIA 1D3YA 5DD8A 4S05A 3VODA 1GXPA 3KETA 1QBJA 5DYMA 1IICA 1Z6TA 2IW5A 4MBUA 5D5XB 2OU2A 4UVBA 2FQ3A 2EA4A 3HOTA 4LK1F 4OADA 4M6YA 1P2FA 3GLXA 2O61A 3I58A 1ZGJA 1F9NA 2V1DA 2CG4A 4UWIA 1LQ1A 4ASNA 4P9FA 4MQ9F 3FMQA 2LNBA 1BJAA 3NEUA 2OZ6A 2A6HF 3R9FA 1B6AA 2QZ8A 1FZPB 4OU0A 3R6SA 3NQOA 4R87A 5D5WB 2M30A 2GXBA 1WI9A 1UB9A 1Q1HA 3BJ8A 1TW2A 4CXFA 3S6KA 3QP6A 4RB0A 3EETA 3ZN1A 2ZXJA 2B4DB 4U88A 4KIGA 4P96A 4AD9A 4I01A 2EVNA 4GS4A 3FF5A 3P2FA 2XUBA 5D5UB 1TLHB 4XRFA 2R7FA 1HW1A 3HSRA 1PP7U 5LEKA 4ZYHA 5HH1A 2Z10A 4R1HA 4P55A 3KP7A 3KP3A 3ULQB 1BN5A 3TO9A 4YFNF 2FS5A 1R00A 5TRDA 3GFMA 3SXOA 3T8RA 2W84A 3WE3A 1I1DA 1B6BA 2VONA 2OD5A 4M74A 3D3SA 4JQFA 3LODA 2W25A 4NCZA 5CVVA 4OAEA 5BPDA 4Q48A 3ZQ7A 3TGNA 1Z4RA 4IJAA 1KUVA 3WTWC 3GKRA 1R57A 2K7LA 1SD5A 2XAFA 1BIAA 2P5KA 2EV0A 2HWVA 1YTYA 1U5TC 4I02A 2W85A 2XKPA 3JVNA 1YS6A 1OPCA 1XGSA 3TO7A 4MNUA 3FZVA 3N7ZA 3GF2A 4Y49C 1YQAA 5DCFA 4NF1A 1YO5C 4F6AA 3E3VA 2ACJA 3EQLF 1CGPA 2M5WA 1NSLA 3L2CA 4HNWB 1G3YA 2DLLA 5CJ9A 1MD0A 1U6MA 1ZH5A 2PI0A 5AIQA 1S7KA 4NSQA 5DUIA 3PGPA 2ZCWA 2P4WA 2VOPA 3ABUA 1M4GA 3JSOA 2W57A 3F6VA 1TNTA 4AIHA 5ICFA 3HIFA 2AJ6A 4I98B 5LBQA 3E6DA 2PMUA 4KUMA 3ML6A 2FNPA 1I1SA 4QC6A 1FP2A 4KDPA 5BOXA 5L3CA 2KJBA 4U0VA 4D0PA 4QBJA 1S6LA 1XGNA 1IZ1A 3BP8A 3QAHA 1O7FA 2QECA 3HTUA 1QSTA 3ISPA 4XSXF 4KN4X 5CYVA 3C26A 2STTA 1VTNC 1YVOA 1R5HA 4OIQF 2P6SA 1IUYA 2Q2EA 3QRFF 2LF7A 1ODDA 1VHSA 1CF7B 4U0WA 4UXNA 2XAGA 1XDUA 4B5OA 1Z1DA 3OWCA 2XAJA 2AE6A 4DNCA 2CW0F 3PQKA 4Y15A 3QU6A 2NMTA 3GZ5A 1S7AA 3LA7A 4A0XA 2IP2A 2KJCA 4O6JA 1Z9CA 4H6ZA 4UV9A 3NE7A 1NMTA 4H0EA 3RTRA 5DWMA 1WQ2A 4I2OA 2FU4A 3I3GA 4LG0B 1BOBA 3E5UA 3K69A 1PP8F 1QSRA 1QNTA 4U7DA 3F3XA 1NHAA 2PC1A 4ESJA 2F5DA 5LHIA 4PSWA 2QM3A 4M9ZA 4YFKF 5A2QZ 1YIOA 2L54A 5LGTA 3IWZA 4N0BA 3W6JB 2PFBA 1HBXG 4G8XA 2EUIA 1S60A 4R3LA 2P6FA 3JW4A 3EY5A 3JTGA 1J5YA 1IXSB 3L00A 4IHTA 4YRHA 4GXOA 1UHMA 1AOYA 4ZYGA 4DQ2A 3V7RA 4N9IA 1ZGAA 3EDPA 5KVRA 1FYKA 2WPWA 3GYHX 1RNLA 3CLOA 4G6QA 2L4AA 3CUQA 4CAVA 2J8NA 2FF4A 2ESNA 3HRTA 3OV8A 3FHZA 2PDOA 4YFXF 1MJ9A 2XHKA 3RYOA 4LLLA 4GYIA 4LLGF 4WX9A 2ZW6A 4LK0F 4WWCA 4MJ8A 3DSBA 3HRSA 4L9NA 3T1BA 2UXXA 2PQ8A 4ENMA 2HTJA 2RC4A 3BJOA 2ELHA 4L18B 1KA8A 3P2HA 1MK4A 1V3FA 2VEZA 2K86A 3DF8A 2ZO4A 3EYYA 4CGZA 2OB0A 1ZLJA 2HQYA 2WC2A 3JAMZ 5L3EA 2I79A 2OBPA 4OIPF 3ZMUA 5D4SA 1BOAA 3F8FA 2JT1A 2QIRA 1YR0A 1B59A 4A5NA 4KOXA 1MJBA 2A68F 2Z0ZA 3P9KA 1H9GA 2ZBKA 2HZTA 2L01A 2ZJ2A 2VBQA 3L09A 2MD5A 4JXQA 4IUSA 1QSOA 1R22A 5EEHA 4HLXA 1R1VA 2FA5A 3RYPA 2J8RA 4CAWA 1LRZA 4KYWA 1YX0A 2HYGD 4HAMA 4BHPA 4MEYF 2F5IA 1S3JA 3DDDA 5H86A 1J75A 4UWJA 1RXTA 2VN2A 1GXQA 3FIXA 4RB2C 1P6RA 4G7HF 4L5JA 5E1ZB 1HKQA 2ARHA 2DK8A 5JR3A 2C6YA 3GUDA 2K4JA 2P7CB 3MZHA 5L3GA 3DXJF 2HKOA 2DPUA 3M1EA 4WK8F 1SD6A 3R61A 2DFIA 1IIDA 1QO0D 3DR6A 1XSVA 1HXDA 2KIUA 5LRRA 2DTRA 3TCVA 3ZMDA 2HGCA 5ILVA 3C3WA 3RDIA 5LHHA 3WTYC 1Z05A 2D1VA 2VXKA 4AB7A 2BL1A 2GAUA 5IT9K 5JPHA 5DCMA 4PDKA 1K79A 5F1RA 3D5LA 4OOIA 3K2ZA 3FYNA 1ZRDA 4XPKA 4L9VA 2K4BA 4HZFA 3VOEA 3FXRA 3SHPA 1G4DA 3N4MA 3T9YA 1ZREA 4O3MA 3RI4A 2OZUA 4HYEA 3SXYA 1VKCA 1YK3A 4R57A 2BSWA 1G6NA 1FYLA 1TQPA 5FD6A 4H89A 4G94A 1MGTA 1JGSA 4EGZA 2QBYA 1YVKA 3T8TA 3D2MA 1L3LA 5L3FA 1Y9KA 2YU3A 3HUGA 1N71A 1YREA 4ZBGA 2PR1A 1ZN2A 3ECHA 1SD7A 3DKWA 4FX0A 3R60A 4OIOF 2X0LA 1P4NA 1L0CA 3ZJ0A 5D5VB 2IA1A 4ESBA 2DPDA 4H6UA 2G3AA 2G7UA 2VE8A 2GA1A 1S7OA 3TQNA 3T0YA 4EQQA 1KZFA 3CXSA 5ICCA 3F8KA 1K4JA 3R95A 3KLNA 1FSEA 5J8FA 4ENNA 1T39A 3IKVA 3LAPA 2GZWA 1A04A 2HDCA 1BBYA 3PZJA 3F8CA 5CVJA 1BI0A 1EH8A 2L4MA 1Z7UA 3GYAA 1K78B 2A07F 3GX4X 1I6XA 1W5SA 3D0SA 3LAJA 4XLNF 4NQWA 2D4PA 1USSA 2JDCA 2L3DA 5FGMA 2R98A 2OA4A 2LSOA 2QENA 5DEQA 1S3ZA 4KOWA 2RKHA 2Z5UA 3E0KA 2P6TA 1YW8A 4FT8A 2REEA 5D6EA 5K5OA 1OYWA 3BY6A 3U1DA 1XCVA 3RKYA 4AVPA 2WV0A 4RAZA 1CM0A 3CO6C 3DPLC 3ZMSA 1OZPA 2J5OA 5LHGA 4IF4A 1XB4A 1FYMA 2JZYA 3TT2A 1QSMA 5AIPA 3TOAA 3I4PA 1J59A 3V7CA 1O3SA 2P0WA 3T90A 1ZHFA 2EV6A 1ON0A 4MHDA 4ZYEA 3UY5A 4EVIA 3R9GA 1XGOA 4RI1A 2FL4A 2FE7A 4JD6A 2IL4A 3ABTA 1FWZA 2I00A 3O3KA 2XKOA 1RUNA 4KIFA 3COAC 4ZYDA 4IHSA 4OMZA 2CY2A 1SMYF 4QWQA 5HDGA 3RPQA 4CICA 2ZW5A 4UVAA 2YX4A 3J80Z 4KVME 2VBWA 5HOOA 2HFHA 2ETHA 1FP1D 4RGSA 2DI3A 2MC3A 1BO4A 2FE3A 1BM9A 1O7LA 5J6XA 1U6GA 3QU3A 3FWEA 3HRUA 4LB5A 1DPRA 2KIMA 5D6FA 3IKTA 5TJJA 3WTXC 2AS5F 3ZN0A 4HX4A 3I5UA 4L0YB 1GHCA 5FD5A 2M87A 3M7GA 2M8EA 2HQRA 2P5VA 4LUAA 3MZYA 4PV6A 1P92A 2YX7A 2Y0MA 3WGGA 4LFUA 3I59B 1QZYA 3PFIA 1IB1E 3F22A 3M8FA 4KFCA 2W24A 4M85A 4R3KA 3KEQA 1Q2YA 4F0YA 1J2XA 2ZFWA 1ON2A 3PP9A 3S6FA 1FPQA 3G3ZA 5HDNA 1XMKA 3BZ6A 2NS0A 3SZTA 3P7NA 2X7BA 2XASA 2J5PA 2HEOA 4XBFA 1WKMA 4ONUA 4L9TA 2ZW7A 5LRSA 5FLXZ 2CSOA 4EM2A 1I5ZA 2ZXVA 5D4RA 4U7BA 2H6BA 3ZZIA 3K1NA 3V8IA 3WR7A 4GCVA 5KK1A 2RN7A 2VC0A 2MLGA 3EUHA 1FC3A 3DR8A 2DBBA 2QMLA 2V6CA 1LB2A 3SQNA 5I0CA 2EJRA 3GZ6A 4KN7X 1OYIA 2HYFA 4L5IA 1P4WA 4U9YA 4M71A 2FIWA 3RYRA 5K5QA 1EH6A 1BC7C 1YG2A 4PSXA 4M73A 3QB8A 4M3SA 1FBQA 4A6EA 3ECOA 2EV5A 2D1HA 3MFKA 3Q9SA 2GQQA 5KTDA 2B0LA 4WF2A 1XCBA 5IT9Z 1HW2A 1UCRA 4UVCA 1XD7A 3ERED 3KP6A 4LLNA 3LWFA 1W4MA 2R3SA 4F7ZA 1IN4A 4XNHC 3L9FA 5EBVA 1KYZA 1UFHA 1CF7A 3I71A 1IF1A 2FCKA 5F49A 3K1MA 2D2WA 2FSRA 1Q2DA 3E6CC 1WWZA 2OZGA 4JWPA 2VODA 4PGHA 2UXNA 5ED4A 3R96A 3V7SA 3MWMA 2IA0A 2VI7A 4WXHA 1QZZA 3C7JA 3KLOA 5HVQC 4PCQA 5HLHA 3R4KA 4EJUA 1S7NA 2P5LC 4MY0A 2MH9A 2QLZA 2MBFA 2CQKA 4RS8A 2FOKA 3WG9A 2B3UA 1LDDA 4E2AA 3GVAA 1REPC 5FVJA 2ISZA 3I9SA 3KP2A 2P7VB 2WWYA 4EM0B 2XIGA 2P8TA 5JVTA 2JPBA 1X3UA 1H9TA 3HYIA 1D8KA 3B73A 2FEZA 4M9XA 1I21A 4LMYA 3BJ6A 1IN6A 1UHWA 1FOKA 1F5TA 3H3ZA 2VOOA 5H6RA 2PEXA 1HKTA 1FLIA 3M8EA 5DWNA 4A2UA 1W7PD 2RQPA 3J7AO 1XDSA 1R5GA 3IC7A 3LA3A 1TW3A 4AVAA 5FFXA 2GWRA 2AXLA 2Z9OA 3R9EA 2L02A 5E1WA 1DP7P 2HQNA 3GFJA 4YFJA 5KTAA 4CAXA 4HQEA 4G6DA 4ZH4F 3EFAA 3MGDA 4KLVA 3EO4A 1SD4A 4JLYA 3J81Z 1IXCA 1JHFA 3M9AA 3F72A 3FM5A 2FXFA 2VQYA 5IV0A 1RZ4A 4YIFA 4OINF 3ELKA 1Y0UA 4HF2A 3WU1B 4WCGA 2UZKA 1WSUA 3K0LA 4E0AA 1FT9A 5CNPA 4ZZLA 3GW2A 5BS6A 3BOQA 2DAOA 1SFUA 4YGOA 5CVRA 2V1UA 3F23A 2HS5A 2VC1A 4KORA 1QSNA 4UA3A 3W6SA 1U5TA 1L0OC 4U5YA 1XIXA 2ATRA 2XAQA 2FNAA 1R58A 2VXZA 3K9TA 4L8AA 2VT2A 4HF0A 1IN5A 3VEPA 4MTDA 1ZRFA 4EJOA 1YS7A 3JUWA 2HR3A 2A5YB 1C0WA 2IJLA 3DEUA 4AVCA 3MAJA 3HTSB 1XN7A 1D8JA 4HNXB 2BUEA 4I49A 4LB6B 4B09A 3S2WA 3FNCA 1Y7RA 1LNWA 2EFWA 4TV7A 1KQ0A 3WTSC 3U9GA 3JSPA 3E6MA 1T38A 5H6QA 5ERIA 2REFA 3AAFA 3ROUA 2C27A 1ZG1A 4RB3C 1TQMA 4LD5A 5JI6A 1KU3A 2O3FA 5LLQA 4KOTA 2YSRA 2VBXA 2UWMA 4HBLA 1S7LA 4KUBA 4HW0A 4FD4A 4X5KA 3R0AA 1SMTA 2VBYA 2FT0A 1H0MA 3MEXA 4KICA 3D2PA 5HMNA 4RGUA 2V9VA 2MH2A 1BI1A 2EB7A 4AWXB 2FBKA 2EA2A 2XV4S 4FD7A 5C82A 5HDKA 4JXRA 2RVCA 4MGRA 3ZMZA 2B4DA 1GHEA 4CRZB 1YW7A 4S04A 4MI4A 3CUOA 3EXNA 2FMLA 5JHUA 2YPRA 4KVOE 1SFEA 2ZPAA 2HV2A 1T98A 1IN7A 2CNMA 4CZZA 4HDUA 3WU0A 2CGPA 3IHUA 3Q9VA 4IRIA 3DP7A 1XE4A 3RPUA 1STZA 1ZG3A 3LQRA 1USTA 2JLMA 2K27A 5E1XA 3E6BA 3LA2A 3MCZA 3GWZA 2FBHA 2EFPA 4Q5SF 4E70A 2ESHA 1R36A 2KRFA 2R1IA 5JFRA 4BHCA 3F0AA 1KYWA 2K5TA 4L0ZB 3TKYA 2H94A 1T0FA 2O0YA 4NB5A 4R79A 5DV5A 1KGSA 4J3GA 5E20A 4RS2A 1EV7A 3KP5A 1T2KA 4IXAA 4Y17A 4I0AA 2OQRA 2F5EA 4XNHB 4LX9A 2OQGA 4YIIA 1FSHA 5ISVA 2NRAC 1HW5A 2EFQA 5BQTA 3B02A 4RAYA 1OR7A 1RUOA 3WTVC 1WWXA 2VBZA 1M44A 2HKXA 3C1DA 5EC4A 3REOA 3HHHA 2G0BA 1YW9A 3BWGA 2CNTA 3FXQA 2VZYA 3JTHA 3I0TA 1U2WA 4GO1A 1U8RA 3KP4A 4FD5A 2E1NA 3HHGA 4A12A 1B1BA 1E2XA 2XAHA 3RKXA 4GYGA 2PSWA 2DW4A 2PLYA 3TE4A 2CWEA 4AG9A 1R7JA 2G3TA 2A6EF 4RGXA 1FX7A 2QQ9A 3H3UA 2PRBA 3S6GA 3F8MA 5F64A 4BYYA 3F8NA 4K30A 1KU9A 4MY3A 2R8VA 2QVOA 1YFHA 3BPVA 3G8WA 4CO8A 4ETSA 4PZJA 1JE8A 2Q0YA 2GA2A 3LSTA 3FMSA 3T5XA 1ZLKA 2R7HA 1DDNA 2NNYA 4KMUX 4FHTA 5IX3A 3V4GA 2P6GA 5GCNA 3IRQA 1F1ZA 2BEIA 2Q4YA 1QGPA 2ZMEB 4EVYA 3S6HA 3DFGA 1B4AA 2WTEA 4I09A 3VWEA 3BJ7A 3BPXA 2ISYA 2VE9A 3CTAA 1XSDA 1RIOH 4KMFA 1FBUA 3QPHA 2DQRA 3OOPA 1IN8A 3I59A 2V1XA 2M1BA 4E8OA 1YGHA 4RB1A 4CHUA 1KU7A 4OLLA 2JDDA 1FY7A 2IVMA 1IYLA 2LDUA 4P9UA 5ICGA 2ZKZA 4UNOA 1LDKB 4NXYA 4PK2A 3GY9A 1PUEE 4NHJA 4QVTA 4AVBA 2DO7A 2FRHA 5ILUA 3IRRA 1YLEA 2B3VA 2R7DA 2Z3YA 1P4AA 1Q2CA 1MZBA 1ON1A 4BAYA 2F5CA 3Q5FA 1IRFA 4KUAA 2STWA 3F6OA 1TQIA 4A0YA 4UV8A 1OYYA 2YR2A 2EFOA 3BLNA 4KNYA 4OMYA 3G73A 3P9IA 2OZHA 5H20A 2Z11A 5DUKA 1LVAA 1V4RA 1OMIA 1LDJA 3FX3A 3KZYA 4Q4ZF 1WK4A 4FX4A 1KQ9A 4XSZF 5BPIA 3FB3A 2Q0OA 3DQVC 1K7AA 1W7PA 2HTSA 3C18A 4IPAA 3LQQA 3W6XA 1R1TA 5E18F 4HOBA 1XMAA 2A3SA 1J4JA 1S5KA 3E97A 3HSEA 2PR8A 4CRYB 4HQMA 3TTHA 4L89A 2A61A 3KE2A 4HV5A 1O57A 2PN6A 2IRFG 2XVCA 2RDPA 4U9ZA 5HLGA 2EK5A 1LJ9A 4U0YA 2IT0A 1ZYRF 4L9JA 1BI3A 1KUYA 3V8JA 3CO7C 1R23A 4GGGA 4LGWA 4HX7A 5K5RA 3V8LA 2A4NA 4RGRA 2DK5A 4MTEA 5CLSA 2CO5A 3GXOA 1QQIA 2EWNA 5HS9A 1IAWA 2J8MA 4B5PB 5L3BA 1FBSA 1I12A 1J7KA 5C88A 2ADUA 4KT5C 5D8LB 5A2QK 3FBUA 3I53A 2GE3A 5F47A 2QWWA 1XF8A 3R1KA 4A6DA 5HS8A 3O2PE 4HDVA 4EMSA 2O6GE 1M4IA 3EC4A 2H6CA 5L3DA 2DQLA 1AWCA 4KOYA 4QB9A 4M9SA 3WTUC 1LEAA 4JK1X 2IA2A 2KCWA 5F6FA 5KTCA 4AIKA 1WRJA 2VT3A 4HX8A 4CYDA 3QPTA 5CVIA 2EFNA 2RGVA 3RIRA 4Q47A 3BJAA 4BH9A 2Q4VA 3CUQB 1ZRCA 1O3TA 4AIJA 1TNSA 3HSFA 3F8BA 2Z33A 1I1GA 4G7OF 2H5MA 4ZZDA 3DV8A 2QBYB 3BROA 5LEJA 1E17A 3EYIA 4BNCA 2OH1A 2ZMEA 5JQ4A 4MHGA 3J80K 1UFMA 2V79A 1IYKA 1NE9A 3F5BA 4IRGA 3RKWA 4CDGA 2Q04A 2B5GA 1BI2A 4UHTA 1XGMA 3TDUC 1RI7A 1YLFA 4BQAA 5DCMB 1J0RA 4XPDC 3IWFA 3FXUA 3L7WA 5IT3A 1K78A 3JAMK 4QLCU 2GIVA 4A5MA 3FXTA 4MEXF 4FD6A 2JEVA 3CXQA 2O8XA 4AG7A 4KOSA 4UUVA 3TDZC 1IXRC 2D4OA 2HUZA 2JRTA 2B5GB 3KEOA 3FM3A 3CXPA 1T6SA 1LEBA 1HKSA 4B5PA 2F5FA 2RV8A 5FB2A 3CDHA 1G3TA 3D8PA 1G3WA 4ENKA 2H27A 1PDNC 1ZG5A 3ZPLA 2KKOA 5AONA 4KLWA 2Q8KA 3I54A 3F21A 1S7FA 3CJNA 2CFXA 2VZZA 3GO5A 1JXSA 2JSCA 3ZMTA 1Z9UA 1XMTA 1J9IA 2B4BA 3KZZA 3U2RA 4Y49B 4R9MA 4IRHA 1Z6RA 2O28A 5CVUA 4HKFA 2QQAA 2E1CA 3K1PA 4ORFA 2BV6A 5FLXK 2DXQA 4XPLA 4P5OA 6PAXA 3N97A 5E8GA 3SFZA 1ONVA 2FSWA 4Y13A 4BXUA 5FO5A 3HOSA 2GXGA 4A0ZA 3NRVA 2CYYA 1HSJA 2FBIA 2Z99A 1XEBA 2ZNYA 3LFKA 4UBRA 4G7ZF 1B87A 2GANA 3GFLA 2NAZA 3KCCA 5DDGA 3FRMA 3V8KA 2NYXA 1QPMA 4I7HA 1IRGA 3PQJA 2D45A 1YYVA 1HSTA 4KOUA 4BHBA 3TO6A 1U3EM 4KOVA 3TOBA 2CNSA 5H84A 3VB2A 2FIAA 2BBYA 2NNNA 2QYOA 4O5VA 2DT5A 1B9MA 4JJXA 3K9UA 4IF5A 3GFIA 2RNJA 4R8HA 2G7HA 4EJTA 1MJAA 3ZMVA 4EM1A 2Q44A 3GEZA 2B58A 4KZTA 1KUXA 5K1YA 4KA4A 4ENJA 2COMA 2F2EA 1F4KA 3IL2A 1M4DA 3E5QA 3IWGA 3TFYA 5FFZA 2LF8A 5LGUA 2MLKA 1JHHA 3WTTC 1XSXA 3J81K 2H09A 1ZAOA 1W7PB 1O3QA 4KIBA 1M1DA 1TIQA 5EEGA 2JTVA 1DUXC 2PG4A 2PJPA 3W6KB 4II9A 3P9CA 3VFZA 3WE2A 2KIFA 3FMRA 1SAXA 3DNSA 3SXNA 1D5VA 2Y75A 5ICEA 2PBIA 1W5TA 4ESFA 1BC8C 1P0HA 2IPQX 1Y9WA 4ON0A 2JPCA 4I0BA 1Z4EA 4LG0A 4M72A 5E8IA 1SFXA 1U78A 1FNNA 3ZP5A 1B9NA 1S29A 1R1UA 3QP5A 2A69F
chains in the Genus database with same CATH superfamily
1WZ2A 1S8NA 4IVNA 3QOPA 2E7XA 3SHFA 2ELJA 2XGXA 2K85A 4EV0A 4NEXA 2O03A 1QVTA 3KKWA 2GBYA 2BE5F 4CS0B 1RKWA 3LD2A 2BGCA 2VKDA 3MD2A 1V5FA 4WXDA 4ANJA 3FC3A 1W0TA 4YG2F 1TT0A 2DFFA 4XLCA 3IUOA 3HKZN 3SJGA 3JTKA 2PJ2A 2PMHA 5J47A 4M6IA 4XRMA 1G3SA 1I27A 1QPIA 3A01A 3VSLA 4JBAA 2CFOA 1YLOA 4EGYA 1Z91A 2QQBA 2XRNA 4YELA 1MDMB 4BQQA 3ZQCA 2OC6A 3W91A 3H36A 4MIMA 1U5TB 1TC3C 5IY5H 2BVLA 4N9HA 3BDDA 4ZTJA 2CV1A 4CYCB 1FYBA 1ZARA 1MMNA 4UB6C 5GTHC 2ZEFA 3FMCA 3HGGA 3LACA 4EJWA 5LGNA 5ILSA 4GM5A 3WC6A 2ZXWH 2LKPA 4MFJA 4Y7NJ 5CPAA 2MG4A 4HA8A 5DTDA 1ULKA 4IHXA 1A6IA 4OIDA 5C3EJ 1RO5A 4PK3A 5LYDA 3GMEA 2V7FA 3NFZA 4HV6A 1GVJA 3K4LA 3GTGJ 4B43A 3VWDA 2TDXA 3WTZA 3H92A 1CJWA 1V0CA 3D00A 4X8IA 5F46A 1QZEA 2BYVE 2M45A 2GVIA 3H4QA 2R7RA 2BEOA 2IS2A 1JWQA 3DPTA 2ELKA 3IGRA 4XPDB 4A3KJ 4B11A 2XROA 3WGHA 1HQCA 2K02A 2X6XA 4HF1A 5IB0A 3G3SA 2P81A 3R0JA 4F9VA 4M6XA 3V38A 3B8GA 4BJ5C 2MC4A 3HRMA 3I64A 4MMOA 1MKMA 4P4IA 2N71A 2ZNZA 4Z2YA 3BR3A 5E96A 3S9NA 1YTPA 1ULYA 1WGXA 2NOGA 4MQVA 4AVBA 4CUGA 2G9WA 4AVZA 5HS7A 4CGMA 5D8KB 2CU7A 1FMVA 4XLPF 4HNYB 2OAZA 2IXSA 3MQ0A 1BIBA 5F48A 4PGGA 3K6GA 2A05A 2E7WA 2JWTA 2DU9A 1KU2A 2Y48A 4OIRF 2I5UA 4BMHA 2VJ5A 4B8XA 3PFOA 3DLJA 2XGCA 1DPUA 4CGPA 1OR7C 1IW7F 1LFWA 1TBXA 3SZPA 2FMYA 1U8BA 2B9SA 2K3PA 2HOEA 3KFWX 4KVXA 4XICA 4HLYA 3QQAA 4WXCA 1MH4A 2BOLA 2FXAA 1MDMA 3W2AA 3CZ6A 2VB6A 5E17F 1VNDA 3CUQC 4E7LA 2ZW4A 4QUSA 2R7ZJ 2P6EA 3O6BB 2CWHA 3CCUI 3S2HJ 2WPXA 5J8CA 3WGIA 2DB6A 1DGWY 2R7SA 1HLVA 2X4HA 4KITB 1OKRA 1XMBA 5BMZA 2C6CA 4D5CA 4LJZF 3GTLJ 1TTYA 1IV6A 1PUAA 4M3DA 4PQAA 5JLWA 3ZOBA 2K9QA 1O3RA 1Z77A 3A0HC 3ZGKA 3GLJA 3SI0A 4BU2A 3A9LA 5DD4A 1X1DA 1K6OA 5EX0A 1EH7A 1VQLI 1R0RI 1SQHA 3GTJJ 3PNTA 3WODF 4K2EA 3RJPA 1UAAA 1CP6A 2MA3A 4EJVA 2XSDC 1XFOA 3LFUA 5FKKA 1T08B 2CV0A 1ZK8A 2QUFA 3GTOJ 2PJ6A 4G9YA 3BG3A 1P4XA 1PU9A 3CQZJ 1KQ8A 2Q7BA 2KMOA 3CPXA 4ABZA 3E5XA 5HLIA 1D3YA 2HZDA 4RDUA 5DD8A 4S05A 4A93J 2YNDA 4C7HA 3VODA 4BL0B 1GXPA 3KETA 3G1OA 2OR4A 1QBJA 5DYMA 1IICA 4KS9A 2L9SA 1Z6TA 2IW5A 2Q4ZA 4CH7A 4A2ZA 1XMXA 2KT0A 4MBUA 5D5XB 2OU2A 3A03A 1LE8B 2VJIA 4UVBA 4BQNA 1JKPC 2FQ3A 2EA4A 3V7ZA 2QQ0A 3HOTA 1Z8LA 4LK1F 2OTLI 4OADA 4NFRA 4M6YA 1P2FA 2GLFA 3GLXA 2O61A 3I58A 1ZGJA 2OD1A 1F9NA 2V1DA 2CG4A 4UWIA 4B6ZA 3CC7I 2VKEA 1LQ1A 4ASNA 3QODA 4P9FA 3QWPA 2HXOA 4MQ9F 2EILH 5JVGF 2LY2A 3FMQA 3VPRA 3L2NA 2LNBA 3NWSA 3IFEA 2GKRI 1BJAA 5HLTA 2YU9J 2FNFX 3NEUA 1P9ZA 4W9YA 3BG6A 2OZ6A 4A69C 4QPOA 1QMUA 3RQ4A 2A6HF 3TW6A 4XOPA 2K9SA 1FAQA 1IY5A 4X0GA 2CWGA 2NVXJ 3R9FA 1B6AA 2QZ8A 2LBFA 2RIJA 1FZPB 4OU0A 3UFFA 3R6SA 1M8BA 4M6GA 3NQOA 2KDOA 1G8XA 2PJCA 1WPKA 4R87A 5D5WB 4UF4A 2Y69H 3BQYA 4UUSA 2E2HJ 1AHDP 2M30A 3E59A 1TF8A 4A39A 4JYWA 5D29A 2GXBA 5CKTA 2VUMJ 3EUKL 2F4IA 1WI9A 3CZXA 1UB9A 1Q1HA 3OYJA 3BJ8A 3ASNH 1TW2A 4UUSB 4CXFA 3S6KA 3QP6A 4RB0A 1XPXA 3EETA 3H9QA 3ZN1A 3OYKA 2CIJA 2ZXJA 4HEA2 4ZY0A 2B4DB 4U88A 2LOOA 2CQNA 3PSFA 4KIGA 1UJ8A 1XRYA 4P96A 4AD9A 4BD9A 2WB1A 4I01A 3DWLE 4RLQA 2L9NA 2EVNA 1AU7A 4GS4A 2OF7A 3ABMH 3FF5A 3P2FA 3U21A 2XUBA 1TLHB 5D5UB 4XRFA 2R7FA 2F5VA 4DZJA 3J7ZI 4MCQA 1HW1A 3S3MA 3HSRA 1PP7U 3OIOA 4ZYHA 5LEKA 5HH1A 2Z10A 4OAZA 4R1HA 4B14A 4P55A 4J01A 1ETOA 1AUGA 3KP7A 2L7KA 1UHAA 3KP3A 4OC3A 4P4FA 1BN5A 2NVYJ 3ULQB 1LANA 3TO9A 3N05A 4YFNF 4FUUA 4XOTA 2HDWA 4ZX9A 4CYNA 2FS5A 1MBHA 1R00A 2DOAA 2K40A 3BT9A 3GFMA 5TRDA 3SXOA 4RAFA 4A3DJ 3T8RA 2W84A 3WE3A 1PCEA 3E2IA 5JHWC 1B6BA 2VONA 1Y1VJ 2OD5A 4NDLA 1I1DA 3JRUA 4M74A 3OYIA 4JQFA 3GTKJ 4D7NA 3D3SA 3LODA 2W25A 5CBMA 4MFKA 4U87A 4NCZA 1DQUA 5CVVA 5E3QA 4OAEA 4JP0A 5BPDA 4MCSA 4Q48A 5FROA 4E4HA 3ZQ7A 1HDPA 3I4MJ 2ECBA 4DYQA 4N4OB 1AMPA 3TC8A 2X52A 3TGNA 1QVUA 2PVWA 1Z4RA 4MFEA 4IJAA 1KUVA 2DOEA 4XKVA 2L7ZA 3WTWC 1R57A 3GKRA 4WWVA 2K7LA 1I50J 1SD5A 5FRNA 4OC1A 4OC0A 2XAFA 1IUFA 1BIAA 2P5KA 2EV0A 2LY1A 4II2A 2HWVA 1ELLP 2DT6A 3IO1A 5GAHJ 1YTYA 1LPQA 1U5TC 4I02A 2F6CA 1K6YA 2W85A 2XKPA 3HB9A 2OVOA 3JVNA 1YS6A 2QGUA 1OPCA 1SGPI 3OYMA 1XGSA 5J3LA 2M0MA 4IO9F 4KSFA 3KHZA 2GOXB 4M3EA 3OL4A 4MNUA 3TO7A 3FZVA 3N7ZA 3OSFA 3KYCB 3GF2A 1ARLA 1IRZA 1FJLA 2NU3I 1WCMJ 3ESWB 1K7TA 5EG0A 3OYCA 4Y49C 1YQAA 3B2YA 4IKFA 5DCFA 4NF1A 3L2RA 3FJUA 4MO7A 1YO5C 4F6AA 3E3VA 2ARPF 4OC5A 2M8GX 2ACJA 4BUPA 1MIJA 3EQLF 3FXKA 5J1QA 2V9PA 3ZCOA 3D7DA 3B3TA 1CGPA 2M5WA 1NSLA 2NVTJ 1U0JA 1V1IA 3L2CA 3CJTB 3DKXA 2FQ4A 1AN1I 3HL2A 1HOMA 3TBIA 4HNWB 6CPAA 1G3YA 3CLQA 2DLLA 4BJTA 5CJ9A 1RR8C 1MD0A 2QSGX 2KMQA 1U6MA 1ZH5A 2PI0A 5AIQA 3FEDA 1S7KA 1MH3A 4NSQA 5DUIA 3PGPA 2ZCWA 3R5BA 3LOCA 2P4WA 2VOPA 7WGAA 3AL0C 3ABUA 1DU6A 3S93A 3F9KA 1M4GA 3HLPA 3OYAA 3JSOA 2W57A 3F6VA 4FQGA 1MBJA 1TNTA 4AIHA 5ICFA 3HIFA 1ZR2A 4I98B 5LBQA 3CC4I 2AJ6A 2ZEHA 3CDXA 3RSNA 2PJRB 4MHNA 3PBEA 2ZOFA 2IJZA 4CYPA 3E6DA 1POGA 5F08A 2V8VA 2PMUA 4KUMA 3ML6A 3S1NJ 2LUYA 2HOSA 1Y1WJ 1TBQR 1H88C 2FNPA 3SJXA 2X85A 1I1SA 1CG2A 4PFPA 3OMYA 3RZDJ 2DXIA 2V1CA 4QC6A 1FP2A 4KDPA 5BOXA 5L3CA 2KJBA 4U0VA 4D0PA 4QBJA 1S6LA 3M07A 1XGNA 2FOWA 3FBNB 3PM1A 3HPHA 3D67A 3D66A 1HF0A 5FUVA 1CQTA 2QKLB 4XN0A 1IZ1A 3BP8A 1ETWA 3QAHA 1O7FA 2QECA 3VYSB 1LAMA 3HTUA 4BDZA 1MMGA 3ISPA 2J9RA 1QSTA 4N4NB 4XSXF 4KN4X 4IX7A 2QQCA 1DGRM 5CYVA 3C26A 2STTA 2ORVA 1VTNC 1YVOA 1R5HA 1N25A 3GUXA 3DBRB 4OIQF 3B6CA 2P6SA 1IUYA 2Q2EA 3GCMA 2W1OA 3QRFF 1MSEC 2LF7A 1ODDA 1VHSA 2G0EA 4HNUA 2ODFA 4MFZA 1CF7B 4U0WA 2KL4A 2M9HA 5DM7F 7CPAA 4XRSA 9ANTA 1FEXA 4UXNA 2R93J 2CTBA 3VDXA 1DU0A 2TCTA 2WAFA 3GBGA 1M4LA 3D7HA 1J09A 5E3LA 2XAGA 1XDUA 4B5OA 1Z1DA 3CCJI 3OWCA 2XAJA 2CWFA 1VIXA 2AE6A 4C3JJ 2IAIA 1V55H 4DNCA 1WVRA 5CQEA 2CW0F 3DGVA 4LQ6A 3PQKA 4Y15A 4XN3A 3QU6A 4AIDA 2NMTA 3GZ5A 5THWA 1S7AA 3BCBA 5IP7J 4BY7J 4D9JA 2JA6J 3LA7A 1BW6A 1I6HJ 1Y0YA 4A0XA 5LYFA 2IP2A 2KJCA 4O6JA 1Z9CA 4H6ZA 4UV9A 3K70D 1RC9A 2DYRH 3NE7A 5HVHA 1NMTA 2CQQA 2PCUA 2M4GA 3S1RJ 4H0EA 3RTRA 4MRIA 4RAGA 5DWMA 2XB5A 1WQ2A 4I2OA 1PJUA 4ZYAA 2XEGA 1ETKA 4XLAA 3CT9A 2FU4A 1KMAA 3OXFA 3I3GA 1VQ7I 1BOBA 4LG0B 2PJ3A 2KP6A 5B5EC 4R8FA 3E5UA 3K69A 4DYOA 2VQLA 1PP8F 1QSRA 3KPHA 1QNTA 3PNVA 4U7DA 3WU2C 3F3XA 1CP7A 1NHAA 5EJCA 2PC1A 3BC8A 2F5DA 5LHIA 4ESJA 4B13A 2ZEGA 2LLKA 4PSWA 2DYSH 1OCPA 2QM3A 3K4BA 4M9ZA 2M3AA 1IDYA 4YFKF 3IP4B 5A2QZ 1YIOA 1RKTA 2L54A 5LGTA 3IWZA 5DS0A 4N0BA 2QKMB 3W6JB 2PFBA 1HBXG 4FASD 2QSHX 2JXDA 3D68A 2MFZA 4M6VA 4G8XA 3G1MA 3KYDB 1S60A 2EUIA 3DTEA 4HPQA 1XOVA 2YNCA 4R3LA 4ZY2A 2P6FA 3JW4A 1TBRR 3EY5A 3ZRGA 3JTGA 4A3GJ 2DF5A 5A28A 1J5YA 1IXSB 1W4RA 1IOIA 3L00A 3GTPJ 2KZGA 3I9V2 1VZ0A 4EEFG 3F0CA 3TL4X 4IHTA 4ZYQA 1EA3A 3HBLA 2WVJA 1Y6IA 1R4NB 4YRHA 3ZQLA 4GXOA 1UHMA 2LTPA 4UXIA 1HJAI 3VWBA 1AOYA 4ZYGA 1R3NA 2CUEA 3SDBA 2IBDA 1JKOC 4DQ2A 3V7RA 4N9IA 1ZGAA 2QQDA 2BY3A 3EDPA 1YMEA 2IGMA 5KVRA 4B6DA 1FYKA 1IDZA 1ORKA 2WPWA 3GYHX 5AG6A 1RNLA 1Z67A 3CLOA 1YE9A 2XPVA 4G6QA 3K7AJ 2L4AA 3CUQA 5KAFC 4BDYA 1Z5RA 1DTDA 2ANPA 2FF4A 2J8NA 4CAVA 1OFCX 2ESNA 2L8EA 2HVSA 4PXDA 1MBGA 3HRTA 3OV8A 5EZHA 3FHZA 1LOKA 2K5CA 2PDOA 4YFXF 1MJ9A 2XHKA 2DPSA 1T33A 2OOTA 3OR1C 3RYOA 1NG7A 3KZWA 2NVQJ 2IGOA 3K4CA 4GYIA 4LLGF 4LLLA 1U5KA 2KMRA 4WX9A 1IO2A 2ZW6A 4P4BA 4LK0F 4WWCA 4MJ8A 3DSBA 3HOZJ 3HRSA 1XG1A 4L9NA 3S8PA 2UXXA 3T1BA 1T95A 1YOVB 1D1CA 2PQ8A 4ENMA 2CV2A 5IYCJ 1TBOA 2HTJA 2QSFX 2RC4A 4NGMA 2HOTA 3BJOA 3KX2A 2ELHA 4A37A 1SAUA 2L7FP 4L18B 1KA8A 1DS3I 4BE0A 3PB7X 1ETVA 3P2HA 2XDVA 1MK4A 3VYRB 1V3FA 2VEZA 1IY7A 2K86A 2EK9A 5LRGA 3DF8A 3D5SC 3MZ8A 2ZO4A 4B47A 2E2IJ 1SFKA 2N52A 5EX3A 4A30A 4CGNA 3SEZA 3EYYA 4UXHA 3RU0A 2JW6A 1VHOA 1X3WB 5TGTA 2BY1A 4CGZA 4D7MA 3BHXA 2OB0A 2LYCA 1IW4A 1OCZH 1ZLJA 2CUFA 2ERWA 2HXIA 2HQYA 4UUTA 4B12A 2WC2A 3JAMZ 5L3EA 2VPLA 2F48A 1B72B 3LL7A 2I79A 2X6YA 1G59A 2OBPA 5LD2C 1X58A 2BVMA 4OIPF 1F2OA 3ZMUA 5D4SA 2H8RA 3B3WA 3FSYA 1IGBA 1TKFA 1AKHB 1LCPA 1BOAA 3F8FA 5F1JA 1E3OC 2JT1A 2LRDA 4E7HA 3ABKH 2JSPA 5M3MJ 2QIRA 1YR0A 1B59A 2Z3OA 4A5NA 4UFXA 4PFOA 4KOXA 3VATA 1MJBA 2A68F 2Z0ZA 1Q7LA 3P9KA 1Y56A 1JKQC 5HVGA 1H9GA 5IPAA 1JUMA 2ZBKA 2HZTA 2L01A 2ZJ2A 1NK3P 2VBQA 3L09A 2CS3A 3UEJA 2MD5A 3LWUA 2X1EA 3DPUA 3LMMA 4IUSA 4JXQA 1ZELA 1QSOA 3NH8A 1BPMA 1R22A 2X1CA 4OKOA 5EEHA 2NXNB 5LRKA 4HLXA 1GDTA 5K7ZA 1R1VA 2FA5A 3RYPA 3PL8A 4A3CJ 3BZCA 1TKHA 2J8RA 4CAWA 4P45A 5F04A 2O9LA 5C44J 4KYWA 1LRZA 1YX0A 1VQ5I 2HYGD 4HAMA 4BHPA 4MEYF 2F5IA 1S3JA 3DDDA 4C2ZA 5H86A 1J75A 1B8IA 5LRJA 4UWJA 1RXTA 2VN2A 2GOMA 1GXQA 2MYSA 3FIXA 4RB2C 2LY9A 2BY2A 1P6RA 3LSMA 4G7HF 2PJAA 4JCVE 4L5JA 5E1ZB 3IAM2 1HKQA 2ARHA 2DK8A 5JR3A 2C6YA 3FDYA 3GUDA 2K4JA 1AKHA 3D4UA 2P7CB 1XBUA 3MZHA 1RETA 3DXJF 2M34A 5L3GA 2YGWA 2HKOA 2KMUA 2DPUA 2GFQA 3M1EA 4WK8F 1K4SA 3ABLH 1XX5A 2ZEEA 2YUUA 1SD6A 3R61A 1B72A 2R5YA 2DFIA 4ZC3A 1IIDA 1QO0D 4E7ZA 4E1PA 2K9MA 3DR6A 3AFHA 1XSVA 1HXDA 3NA6A 2KIUA 5LRRA 2DTRA 3TCVA 3ZMDA 2K3FA 3QPSA 3SFIA 3L2VA 3TP0A 2HPMA 2HGCA 4C2MJ 5ILVA 3C3WA 1FARA 1Z2LA 3RDIA 1Z0XA 5LHHA 5LYLA 3WTYC 4S0HB 1Z05A 1I3AA 2D1VA 2WADA 3AG2H 2VXKA 4AB7A 1S5LC 2UUZA 3GOXA 3LSPA 2BL1A 2GAUA 5IT9K 5JPHA 4IL6C 1MBKA 3DBHB 5DCMA 3S1MJ 4PDKA 1WJDA 5K8OA 1K79A 5F1RA 3D5LA 2SGPI 4OOIA 3K2ZA 3FYNA 1ZRDA 4XPKA 4L9VA 2K4BA 4HZFA 4FTHA 2CJSC 3SJFA 3KY9A 1OVOA 2OJED 3S32A 3VOEA 1P7JA 1KWMA 5JHFA 1R6RA 3FXRA 2R7VA 3SHPA 3OY9A 1G4DA 3N4MA 3T9YA 4CGOA 2CUJA 2M5XA 4MFLA 3OYLA 5B1AH 1ZREA 2BOAA 4O3MA 1SGDI 3RI4A 2XGDA 2OZUA 4HYEA 3SXYA 1VKCA 1YK3A 4R57A 2BSWA 1G6NA 2CJJA 2CQ7A 3OYFA 1FYLA 2XGEA 1TQPA 5FD6A 4H89A 4JOMA 2E36A 4G94A 4BINA 2VL1A 1K83J 1MGTA 1JGSA 2V77A 1QHGA 4EGZA 2QBYA 1YVKA 3T8TA 2WZNA 2Z3KA 2KDZA 3D2MA 1L3LA 3FBIB 3BTIA 2Y30A 5L3FA 2IS6A 1Y9KA 2YU3A 3B3VA 3HUGA 1N71A 3UEYA 2NOJB 2CW8A 2SGEI 1YREA 2PR1A 1ZN2A 3ECHA 4ZBGA 2WB1N 1SD7A 2H1KA 2Q2EB 3PO3J 3DKWA 3SZGA 1AYEA 2HB6A 4FX0A 3R60A 4OIOF 2X0LA 4XKWA 1P4NA 2FVGA 1L0CA 3GB0A 1OISA 3ZJ0A 5D5VB 2IA1A 2DDBA 3MMYB 4ESBA 2DPDA 4H6UA 1XC5A 1X1AA 3W2VA 3KYLA 2G3AA 1RESA 2G7UA 2VE8A 3LSJA 1A31A 2GA1A 2OCCH 1S7OA 4JX4A 3T0YA 3TQNA 4EQQA 1KZFA 3DLAA 4F92B 3AL0B 3CXSA 5ICCA 3OSGA 3F8KA 1K4JA 1SANA 3R95A 2N8GA 4A3LJ 4R76A 3KLNA 1FSEA 5J8FA 3CF2A 4F55A 1XTAA 4ENNA 1T39A 3IKVA 3LAPA 2GZWA 1A04A 1BBYA 5IP9J 1AA7A 2E34A 3F8CA 5CVJA 2HDCA 2G9DA 3PZJA 3WT4A 1BI0A 4B3XA 1X2MA 1EH8A 2L4MA 2R0QC 1NXUA 3HUVA 2EO8A 3GTQJ 4O23A 1Z7UA 1D0YA 1K78B 2L9VA 3GYAA 2A07F 1P7IA 4A24A 3GX4X 1XX6A 2PJRA 1I6XA 1W5SA 3D0SA 4C7IA 1DS2I 3LAJA 3EUHC 2FD5A 2PJ5A 4JX6A 4X1EA 3AG1H 3FK7A 1IG7A 2R92J 3I3LA 4Q7AA 4XLNF 4NQWA 1WGTA 2D4PA 3K4NA 1USSA 4XR6A 2JDCA 4MLOA 4C9YA 2L3DA 5FGMA 3K70C 1JQGA 2R98A 2XEIA 4G1PA 1HDDC 3PDNA 2OA4A 2W7NA 2WAQN 2LSOA 2QENA 5K8PA 5I4MA 2DT7B 3CCMI 5DEQA 3PUFA 1S3ZA 1E3PA 2FUG2 5FLMJ 1BLLE 4KOWA 1PVEA 2RKHA 1F36A 2Z5UA 1VQMI 4YIRX 3E0KA 2P6TA 3BTLA 1YW8A 2DA5A 4FT8A 2REEA 3BR0A 2P6AC 5D6EA 1UVFA 5F0HA 5K5OA 1OYWA 3BY6A 3U1DA 1XCVA 3RKYA 1KBFA 2R7OA 3FXOA 1Z21A 4AVPA 2WV0A 1PPFI 4H2KA 4RAZA 1RR7A 1B8IB 2OTJI 1CM0A 3LSGA 2M0CA 3CO6C 2AFWA 4OC2A 4CAEA 3DPLC 3ZMSA 3SGBI 1X1CA 1OZPA 2J5OA 1JI8A 2VRWB 2JRMA 5LHGA 1MNEA 2E1MC 2JA5J 3HH2C 4IF4A 3MKLA 5M5XJ 1XB4A 2DPTA 2PE3A 1Z2IA 1S72I 3Q0VA 3H8GA 1FYMA 2JZYA 2PIZA 1WJBA 3TT2A 1QSMA 5AIPA 3TOAA 2DJNA 3I4PA 1J59A 3V7CA 1O3SA 1X1PA 2P0WA 1JUSA 4BJ6C 5J4VA 3T90A 3G6EI 1ZHFA 2EV6A 3OS1A 1ON0A 2LVSA 2WY7Q 4ZYEA 4EVIA 4MHDA 4YWYA 3R9GA 3UY5A 1XGOA 3I4NJ 4RI1A 2FL4A 2FE7A 4JD6A 2IL4A 3ABTA 2WSAA 1D0XA 2DFHA 1H8LA 1FWZA 4P4EA 4GI3C 4P44A 2I00A 4GFBA 5E3RA 3O3KA 3S17J 2X3TA 2XKOA 4KIFA 1RUNA 1ZLHA 3COAC 5AG4A 3OYGA 2DMNA 4QIWN 4ZYDA 2L9RA 4IHSA 4OMZA 2Q7SA 2CY2A 2Y2ZA 1SMYF 1S9HA 4QWQA 3OIQA 5HDGA 3RPQA 4AU7A 4CICA 2ZW5A 4FE7A 3IV5A 2D5VA 1BUSA 2DA2A 2L0KA 4UVAA 1XS9A 2YX4A 3J80Z 4KVME 2VBWA 5HOOA 2JBJA 2HFHA 2ETHA 4E1RA 3KR4A 4KSAA 4EATA 4WP4A 2ID6A 3OWTA 1FP1D 5M5WJ 4RGSA 2DI3A 2MC3A 1BO4A 2FE3A 2R5YB 1BM9A 1ELMP 1O7LA 5TISC 1Y8RB 2CMPA 4AYBA 1N77A 3K4JA 4IEJA 5J6XA 4Y33A 2I3CA 4ONWA 1U6GA 3DU5A 3IH2A 3QU3A 3FWEA 3HRUA 4LB5A 1DPRA 2KIMA 3JRBA 1OMUA 2LEOA 5D6FA 1IV8A 1ENHA 3IKTA 5TJJA 4JYKA 2KRHA 3WTXC 2AS5F 1X4OA 2DKVA 2V6EA 2XRCA 3ZN0A 1CX8A 3DTKA 4HX4A 1HDUA 1WJCA 3I5UA 4YRVA 5HNFA 4L0YB 1GHCA 5FD5A 2M87A 3HPGA 2VKVA 3M7GA 2M8EA 2HQRA 2P5VA 2WGCA 4LUAA 3MZYA 3TEDA 4PV6A 1P92A 2YX7A 2Y0MA 3RCOA 4X3RA 4XK4A 3WGGA 4LFUA 2MGQA 3QOEA 3I59B 3S1QJ 4RA2A 1SVOA 3NARA 1QZYA 3QYEA 3CMYA 4ZI6A 1FMWA 3PFIA 2V8GA 1IB1E 3IEHA 3F22A 1GVDA 3M8FA 3CMEI 4F91B 2WAQA 4KFCA 2W24A 4M85A 4R3KA 3KEQA 4RUHA 3IIBA 1T8IA 1Q2YA 3CJRB 1J2XA 4F0YA 2ZFWA 1ON2A 3LSRA 1GYTA 3PP9A 2AQEA 2FX0A 3RNZA 3A4CA 4A95A 4NGRA 3OYNA 3S6FA 1FPQA 2QJ8A 3G3ZA 2DEAA 5HDNA 1JGGA 1XMKA 3VH9A 3BZ6A 1CT4I 2NS0A 3SZTA 1TXRA 3P7NA 2X7BA 3G71I 3HXLA 2XASA 2IGNA 3CCLI 2EZKA 1UMQA 4NBQA 2J5PA 2HEOA 4XBFA 2QPOA 4CCJA 1WKMA 3L2WA 1I39A 2E1OA 3HOYJ 2KZVA 4ONUA 4L9TA 2ZW7A 5LRSA 5FLXZ 2CSOA 4EM2A 1I5ZA 2ZXVA 5D4RA 2F8HA 4U7BA 2H6BA 4I76A 3RO0A 4DYRA 3B4VC 3ZZIA 5I0CA 3K1NA 5C4XJ 3V8IA 4GCVA 1A2ZA 3WR7A 3MKWB 5KK1A 4UFWA 2RN7A 2HVRA 2VC0A 2MLGA 4UCNA 3EUHA 1FC3A 2M7BA 1SGNI 3DR8A 1VQNI 2DBBA 2VQHA 4OVOA 1DE4C 2O53A 1MBFA 2V6CA 3SQNA 2QCOA 1LB2A 3QPLA 3UGIA 2QMLA 4NJQA 2DOFA 4C68A 2EJRA 3GZ6A 4KN7X 1OYIA 1TGSI 5J1YA 2HYFA 3RAMA 1JUPA 1YX3A 4F0XA 2AFSA 1YRNA 4L5IA 1P4WA 2Z3LA 4M71A 4U9YA 2FIWA 4ZGYB 5K8MA 1TWHJ 4EMEA 4L9MA 1Y0RA 4FISA 3RYRA 5K5QA 3OVOA 1EH6A 2EPFA 2DA3A 1BC7C 3HOWJ 5JGFA 1YG2A 2JK3A 4PSXA 4M73A 1PYTB 3QB8A 2EWBA 4MHYA 4M3SA 1FBQA 4A6EA 2Z3PA 3ECOA 2EV5A 2D1HA 3MFKA 2LD5A 2C1CA 4F52A 5HQ8A 5EF6A 3CP8A 4A3MJ 1F57A 3Q9SA 2GQQA 4W97A 2B0LA 3BZKA 4WF2A 1XCBA 2RREA 5IT9Z 2GREA 3RBUA 5BWAB 3CCVI 1QQ9A 1ZTRA 1HW2A 1UCRA 3C2GA 4UVCA 1XD7A 3ERED 3KP6A 4LLNA 2DMTA 2YS9A 3LWFA 1W4MA 2R3SA 4RBOA 4F7ZA 3OL0A 2W48A 2Y0SA 2YQPA 2KIQA 4V2FA 2KCXA 3DU6A 3IH4A 4NJRA 1IN4A 2F4MB 2MSYA 2PJ4A 4XNHC 3L9FA 2OV7A 4A3IJ 2CH0A 2C6GA 5EBVA 3DKYA 1KYZA 2Y0SN 2LFBA 1PTRA 1UFHA 1Z3XA 4KT6A 3D1NI 1CF7A 1IOFA 4YU9A 1PUFA 3BR2A 3OXLA 1GT0C 3I71A 3TP3A 1IF1A 3H8EA 2F4OB 2AFZA 3LSKA 2JYYA 2FCKA 2ZOGA 5F49A 3K1MA 2D2WA 2HU9A 2FSRA 1Q2DA 2XF7A 3KHXA 2BXYA 3E6CC 1GUUA 2CF4A 2DA6A 1WWZA 2OZGA 1X74A 2VODA 4PGHA 4JWPA 1YJ9I 2ZEDA 2UXNA 5ED4A 2E5RA 3R96A 3V7SA 5FJ8J 3N5FA 3MWMA 4A3EJ 3VDUA 2IA0A 2VI7A 4WXHA 5HVFA 1QZZA 3C7JA 2K9LA 1ZG8A 1OQYA 5D8NA 2W00A 5G21A 3KLOA 5HVQC 3NE8A 4PCQA 5HLHA 1TWCJ 2JA1A 1Z8XA 3R4KA 2PJ8A 5JM6A 3FVLA 4EJUA 2PIYA 2V53A 1S7NA 2VASA 2VIXA 2P5LC 2MH9A 1D5YA 2PVVA 2ZEPA 1PYVA 4DOZA 3S14J 2QLZA 5JLXA 3SJEA 2MBFA 2CQKA 4RS8A 1X3ZB 2FOKA 3BI1A 3WG9A 1M1EB 4F3QA 3KR5A 4HGUA 3KL9A 2B3UA 1KZHA 2SGQI 3TJQA 1N13A 1LDDA 3B3SA 4E2AA 1CPXA 1U9NA 3GVAA 1REPC 1HDQA 4ZTFA 2ISZA 4WJBA 5ELYA 5HI7A 3I9SA 5FVJA 4NGQA 2IS1A 3KP2A 2P7VB 2V26A 3BI0A 4DJLA 1W3SA 2WWYA 4EM0B 2NS7A 2XIGA 2P8TA 2WY8Q 4E7JA 5JVTA 1YHQI 2DJIA 2GIZA 2JPBA 3H0DA 4CCOA 1X3UA 2IMOA 2HQAA 3S3NA 1H9TA 2V4JC 2VJ4A 3HYIA 1D8KA 3B73A 4E6KG 2FEZA 3D7GA 2BXZA 4F8ZA 5EMIA 3CDLA 4MFQA 1TWGJ 4M9XA 4ZX8A 4KJZA 1I21A 3Q3SA 4LMYA 3BJ6A 4MFDA 2HDDA 1IN6A 2Y31A 4DYCA 3OYBA 4NNJA 3HKZA 1UHWA 1TF9A 4BBRJ 1FOKA 1F5TA 3H3ZA 2VOOA 2VPRA 1D1AA 5H6RA 2PEXA 1HKTA 1X1BA 1VDDA 4ZDPA 3MN8A 4XQFA 3AKZA 2FJ1A 4XNFA 1HPTA 4BKXA 3M8EA 1FLIA 5DWNA 4A2UA 1W7PD 4D5FA 2RQPA 2R7UA 3GLLA 4RM2A 3J7AO 1XDSA 1R5GA 2UZ3A 3OS0A 1R43A 2CUZA 3IC7A 1G2HA 3LA3A 4FAIA 1TW3A 2EZLA 5F0FA 4AVAA 1BR1A 5FFXA 2VQGA 3MRUA 2GWRA 2AXLA 2Z9OA 3DCFA 3R9EA 2L02A 3GZNB 5E1WA 3FXLA 1DP7P 1ZLIA 2HQNA 1LR8A 3GFJA 4YFJA 2PJ1A 5KTAA 1CT2I 2ICWG 4HQEA 1WKXA 2AFOA 2PRQA 4CAXA 3M1CA 4G6DA 4ZH4F 1VQ9I 3EFAA 2O5RA 3IU1A 3MGDA 4KLVA 1Z7LA 2V9KA 2VLAA 4E7KA 4LIUA 1MW7A 3EO4A 1SD4A 3ONQA 4JLYA 3J81Z 4A31A 2A6TA 2JA8J 4XL9A 1IXCA 2W82A 1JHFA 1JJ8C 3M9AA 3F72A 3FM5A 5E3PA 2FXFA 2VQYA 5IV0A 2E19A 1RZ4A 4YIFA 4UCPA 3UGDA 4OINF 3M4OJ 5G22A 3UNGC 4BGDA 4EFDA 1TIHA 2XPWA 3ELKA 1Y0UA 5KNLA 4UXJA 4B10A 3WG7H 3LSHA 2R7QA 4W1UA 2Y9ZA 4HF2A 4FBEA 3WU1B 3C2BA 4WCGA 2CW7A 2LKXA 2UZKA 4UFVA 1WSUA 4DGWB 3K0LA 4E0AA 4BEHA 1FT9A 5CNPA 4FETA 1EKEA 4ZZLA 2AFUA 3GW2A 5BS6A 2LB7A 3BOQA 2DAOA 1SFUA 4YGOA 5CVRA 1ZG9A 3T8WA 1YJNI 3F23A 2V1UA 2HS5A 5DAEA 2ZEOA 4MXUA 1WHUA 1PUFB 2VC1A 4KORA 2OPTA 1QSNA 2Q51A 4CYCA 1SFOJ 3FECA 4UA3A 3W6SA 1U5TA 3LNQA 4TWEA 3HGYA 3SGQI 1VHEA 3H8FA 3K4MA 3IU2A 1L0OC 4HG2A 3SYTA 3CC2I 4U5YA 1WFXA 2LG4A 2R5ZA 1XIXA 1OMTA 2ATRA 2XAQA 2FNAA 4NC8A 1R58A 2V1NA 5FKNA 2VXZA 3BJIA 3A02A 3K9TA 2VT2A 4L8AA 4HF0A 4L5EA 4P1WA 1GV2A 1IN5A 3WHCA 2E2JJ 1VQ8I 3VEPA 4MTDA 3JRIA 1YU6C 3O8GA 2EBJA 2TRTA 1ZRFA 4IZZA 3SI1A 4EJOA 1MNMC 1YS7A 2RAEA 3H3VK 3JUWA 2HR3A 3IWEA 2A5YB 2O7OA 1C0WA 1Y1BA 2IJLA 3DTIA 3DEUA 4AVCA 1E3HA 3MAJA 3HTSB 4GDFA 2WYRA 2JN6A 3VYTB 1XN7A 3H5RA 3ZQIA 5IOYA 1D8JA 4HNXB 4CYOA 5GAGJ 2R5ZB 2R7TA 3G1LA 2LBFB 2BUEA 4V2GA 1ZGWA 4I49A 4NGPA 2NS8A 4XKCA 4LB6B 4G6TB 4B09A 3PSIA 3S2WA 4E7IA 5E3MA 3FNCA 2ECCA 3FF3A 1YQEA 1Y7RA 1GV5A 1LNWA 1YRNB 2EFWA 1K7VA 2WA0A 4TV7A 1KQ0A 3WTSC 3U9GA 3JSPA 2ODDA 5JH9A 3E6MA 2KLOA 2B63J 1T38A 5H6QA 5ERIA 2REFA 3AAFA 3ROUA 1Y1CA 2C27A 2PJ9A 2PMZN 1ZG1A 1LFPA 2Z3MA 3ISZA 3JRGA 4MFPA 4RB3C 1TQMA 1CT0I 1A36A 4LD5A 5GTIC 1KU3A 4XM3A 2O3FA 3CMMA 5JI6A 3R5DA 4NGSA 4XLHA 2VJJA 4XLEA 3ZR8X 5LLQA 4KOTA 2YSRA 2VBXA 4IHMA 2UWMA 3SEKC 4HBLA 1S7LA 4K3NA 4HW0A 4FD4A 4KUBA 2ABZA 5FKMA 3PEIA 4X5KA 2ENNA 2I8DA 2NU1I 3R0AA 3D7FA 5B3SH 1SMTA 2VBYA 2FT0A 1H0MA 3MEXA 1R49A 4KICA 4C2TA 3D2PA 5HMNA 3H1CA 4RGUA 4IQJA 2V9VA 2MH2A 1BI1A 1QU3A 2LREA 4FE4A 3OXGA 2V8HA 3NWTA 2EB7A 3ISXA 1KONA 4AWXB 4DZPA 3PIPF 5CCLA 1R5ID 2OUMA 2NVUB 4Y4RA 3S3OA 1Z8WA 2EA2A 2FBKA 2JA7J 2XV4S 4FD7A 5C82A 5HDKA 4JXRA 2HPIA 4JZ0A 2RVCA 3K2AA 4MGRA 4X2TA 3ZMZA 2B4DA 3OR2C 4XKBA 1ARMA 1Z3YA 1GHEA 4CRZB 1YW7A 4I99C 4S04A 2ZJPF 5F0CA 1VQOI 4MI4A 5FUWA 3CUOA 2IQ6A 3EXNA 3IC1A 2FMLA 2NSMA 3DBLB 1TZLA 3GTMJ 2GKTI 5JHUA 2YPRA 1V54H 2LC2A 2ME6A 4KVOE 2BO9A 1SFEA 2A20A 1R9TJ 3M8JA 4ZDLA 2ZPAA 4HNVA 1FIPA 1T98A 2HV2A 4B4CA 1IN7A 2CNMA 4CZZA 5HXDA 4HDUA 2ZSIB 1XA6A 2XRLA 3WU0A 1UUCA 2CGPA 1VI0A 3IHUA 3Q9VA 4IRIA 3DP7A 1M8CA 1XE4A 4NGTA 4P6YA 4UCMA 2XSJC 3RPUA 1K61A 3A1YA 1N78A 3JRAA 1STZA 1ZG3A 4OC4A 3LQRA 4CCKA 1USTA 1Q1VA 2COBA 2AFMA 2NU0I 2K27A 2JLMA 3PRTA 2CRGA 3G4SI 5E1XA 2PX9A 3E6BA 4UIAA 1YX5A 1O4XA 1ZR4A 3ERMA 4AM3A 3LA2A 3MCZA 3GWZA 2FBHA 2Z2SB 4BEHB 2EFPA 4Q5SF 2Y9YA 4E70A 4CAFA 1P9GA 1YW4A 3WC5A 3JRCA 2N17A 2ESHA 1R36A 1RPWA 2KRFA 5J1RA 5JFRA 4BHCA 1BPNA 2R1IA 3F0AA 5CQGA 1KYWA 2K5TA 4L0ZB 2DFEA 3WHBA 1MBEA 3TKYA 2XPUA 1ERDA 3CCEI 5GP9A 2H94A 3M3YJ 1T0FA 2PMZA 3NH4A 2O0YA 1MNDA 4NB5A 4R79A 5DV5A 3QWLA 4HSTA 1KGSA 4J3GA 4PXCA 3ZQFA 4XMYA 3QNVA 4GXHA 2QA4I 5E20A 3H9GA 1SEUA 2DTZA 1EV7A 4RS2A 2UV1A 3KP5A 2W0TA 1T2KA 1I3QJ 4PJNA 4IXAA 2BW3B 1QHHD 4Y17A 4I0AA 2DDAA 1NUBA 4TNUA 1IRXA 2LKSA 2OQRA 2EBIA 2F5EA 4XNHB 1TP4A 4DBRA 4LX9A 3H5AA 2LK2A 2OQGA 4YIIA 1W5CC 4B3AA 1VQ4I 3CCQI 1FSHA 5ISVA 1YI2I 2NRAC 2EZHA 2LH9A 3TMOA 1FT7A 1HW5A 2EFQA 1HC8A 4ZY1A 3ZQGA 5BQTA 4C30A 3B02A 1TOTA 3EPZA 1RTQA 2C6PA 4RAYA 5FKOA 4CGLA 1OR7A 3CPAA 3FISA 5KCMA 3ZQQA 3A0BC 2XAUA 2AHQA 4PK4A 5F27A 1WWXA 5EGOA 3QYFA 2VBZA 3WTVC 3OYDA 1RUOA 1M44A 2HKXA 3C1DA 2GM4A 2ENZA 4AUXA 1UVGA 4FWUA 4YEJA 5EC4A 3REOA 2VI6A 3HHHA 3SEQA 1WI3A 2DN0A 2G0BA 1YW9A 3BWGA 2CNTA 3FXQA 2VZYA 4PUSA 3OL3A 3JTHA 3I0TA 3JRHA 1U2WA 3FIWA 4GO1A 1U8RA 3KP4A 2NU2I 4FD5A 1BJZA 2E1NA 3HHGA 4A12A 4F93B 1B1BA 1X2NA 3H5ZA 1UHSA 1E2XA 2XAHA 1UG0A 2EIKH 4GYGA 3RKXA 2JUCA 4UEZA 2PSWA 1T56A 2HC9A 1YJWI 3WABA 4UB8C 3OOUA 1TL8A 1VQKI 2HI3A 2QEXI 4XRSG 5EZGA 2UVOA 2E73A 3BXMA 2H1LA 2DW4A 4J19A 2JQ7A 2PLYA 3TE4A 4NQWB 1WJAA 2CWEA 5IYBJ 4AG9A 1ETXA 1R7JA 3SDGA 3I1UA 2G3TA 1BMOA 4Y3OA 2A6EF 4RGXA 2QF7A 1SC7A 1FX7A 2GU2A 2QQ9A 4RMNA 2L5QA 5G1ZA 3H3UA 2ZSHB 2VL8A 1HCRA 5E79C 2PRBA 3S6GA 3F8MA 5F64A 4BYYA 3F8NA 3Q0UA 3MEKA 4K30A 1KU9A 4MY3A 3HOUJ 2R8VA 2QVOA 1YFHA 3BPVA 1LFUP 4CO8A 4ETSA 4PZJA 2IS4A 3RKQA 3G8WA 5AG5A 5G20A 1X4PA 1JE8A 1CGII 2Q0YA 2GA2A 4HRIA 4ITVA 5J4YA 3K2KA 2QQEA 3LSTA 1PTQA 4R6TA 4BACA 3CMAI 1LVKA 3FMSA 3UKGA 3T5XA 1ZLKA 1K4TA 3G2BA 3PB9X 2R7HA 2GLJA 1CE3A 1E0EA 3HM5A 1DDNA 2NNYA 1ACIA 2AO9A 5GADJ 2I10A 4KMUX 1SVMA 4NGNA 2K9HA 3FX6A 4FHTA 3JRFA 5M3FJ 5IX3A 1D1BA 1LKXA 3V4GA 4AYBN 2P6GA 5GCNA 2EINH 3IRQA 1F1ZA 1ZG7A 2BEIA 1BR4A 2Q4YA 3MN2A 1QGPA 2ZMEB 2JMWA 4FCYA 4EVYA 4NC7A 3S6HA 3BR6A 1W36C 2V1CC 3CDIA 2Z1DA 4IOCF 3RQIA 3I55I 3TW7A 4QSHA 3DFGA 1IC8A 1B4AA 4BY1J 2WTEA 4I09A 3VWEA 2JVHA 1VGYA 3BJ7A 3BPXA 2ISYA 2VE9A 3CTAA 3S2DJ 3BTJA 5KAIC 1XSDA 5EEAA 3BR1A 1RIOH 4IHYA 5EDNA 3A01B 3ASOH 1VF9A 3JCUC 2GLOA 2XC7A 4KMFA 1FBUA 3B3CA 3QPHA 2AFXA 2DQRA 2F7VA 3OOPA 3QAYA 1IN8A 2DA4A 3I59A 2V1XA 4LITA 2M1BA 4E8OA 4Z6YA 5FKLA 4RB1A 4BE2A 1YITI 1ZKGA 4CHUA 1YGHA 1KU7A 4OLLA 1X19A 2JDDA 5IOZA 1FY7A 1JT0A 5FLVA 2IVMA 2PJBA 5FUYA 3HZJA 1IYLA 1PJRA 2LDUA 4P9UA 1WJEA 4AXVA 3V42A 1FOXA 5ICGA 2ZKZA 4UNOA 1LDKB 4A33A 4NXYA 4PK2A 3GY9A 1D0ZA 3O8HA 1PUEE 4BBSJ 4NHJA 2LR8A 5B66C 3HDDA 4QVTA 1W1WE 1FIAA 1S20A 2DO7A 2FRHA 5ILUA 3IRRA 2GKVA 1YLEA 2R7DA 2B3VA 3PB6X 2Z3YA 4JX5A 1P4AA 2B0UC 3B6AA 2DCEA 1Q2CA 2QVPA 1MZBA 1ON1A 3CD6I 4QPQA 4BAYA 4CYQA 3KQZA 4UY8I 2F5CA 3BG7A 3Q5FA 1IRFA 1BR2A 4KUAA 1T0FC 4DBQA 2STWA 3F6OA 1ZQ3P 4V19K 1A5JA 4DJAA 1TQIA 1Q9BA 3KI9A 5KTDA 4A0YA 4Y52J 3KZIC 4H4KC 1OYYA 2YR2A 1Y0NA 2EFOA 3IAS2 4UV8A 5K7HA 4KNYA 4OMYA 3BLNA 3G73A 1MMSA 5A27A 3K10A 1W0UA 3P9IA 1SGYI 4Q36A 2KFDA 1BW5A 2XB0X 4PJLA 2DA1A 3KQXA 3EUAA 1ULNA 2OZHA 5H20A 2Z11A 5GPAA 5DUKA 4AMLA 1LVAA 1V4RA 1OMIA 3PIOF 1LDJA 3PUBA 3FX3A 3KZYA 4Q4ZF 1WK4A 2ZJRF 4FX4A 1KQ9A 1OCTC 4XSZF 2WBMA 5BPIA 3W6VA 3VE5A 1X12A 2Q0OA 3DQVC 4NC6A 2YNEA 3FB3A 1K7AA 1IY6A 1W7PA 2HTSA 3C18A 4IPAA 3FSXA 1YSJA 4PJJA 1OCCH 3LQQA 3W6XA 1U9OA 1R1TA 1V5GA 2MW8A 5E18F 3JREA 4C3HJ 8CPAA 4HOBA 1OCOH 2O4HA 1HA8A 1XMAA 2RFHA 2A3SA 1LFBA 1J4JA 1JT6A 4X6AJ 4G12A 1S5KA 2N1AB 3E97A 3Q0WA 3HSEA 4AC0A 2PR8A 4HQMA 3TTHA 4CRYB 4L89A 4PXBA 2EH3A 2A61A 4P10A 4UEEA 3KE2A 2RB7A 3MKZA 2M4KA 3C2HA 4HV5A 1YIJI 1O57A 2PN6A 2IRFG 2JEWA 5C4JJ 9WGAA 2XVCA 2RDPA 2VKHA 1WGCA 2HQ5A 3DEWA 1IU8A 4OIWA 2LMDA 2E35A 5HLGA 4U9ZA 2EK5A 3FXJA 3HC7A 4RM3A 2H8WA 3PB8X 3E7LA 1LJ9A 4U0YA 4BXXJ 2IT0A 3QYBA 1H0ZA 1NTCA 1ZYRF 1K7UA 3IWWA 2L2OA 4L9JA 1TURA 1BI3A 3OS2A 3V8JA 1KUYA 3UR3C 1NH3A 1TT5B 3HJEA 5B1BH 4A38A 2B7EA 1CGJI 3CO7C 1R23A 4GGGA 4LG3A 4BXFA 4MCRA 4LGWA 5GAEJ 4HX7A 1XJOA 4DUKA 5K5RA 3V8LA 2A4NA 4RGRA 2DK5A 5HODA 4MTEA 5CLSA 3L1PA 1EE3P 4ZDOA 2CO5A 1BAVA 3GXOA 1QQIA 1XBTA 2EWNA 5HS9A 2ME0A 1IAWA 2J8MA 3MKYB 4B5PB 5L3BA 1FBSA 1I12A 2NYQA 2L7XA 1J7KA 5C88A 2ADUA 4CSWA 4HNTA 2A5WA 4KT5C 5D8LB 1FOYA 3FKJA 2ORWA 5M5YJ 5A2QK 3FBUA 4RN7A 3I53A 4NUBA 2GE3A 5F47A 5F09A 2QWWA 2XF5A 1VQ6I 3CCSI 4MPIA 1XF8A 2HOAA 3R1KA 1TWAJ 4A6DA 5HS8A 3O2PE 1A6QA 2KPMA 2JVGA 4EMSA 4HDVA 2O6GE 2DMQA 2RQQA 3JRDA 1M4IA 3WC7A 4IK2A 3OIPA 3FHNA 3EC4A 2H6CA 5L3DA 4OMEA 3HG9A 2DQLA 2KQRA 3SJMA 1AWCA 4KOYA 4QB9A 1FNOA 3BG9A 4M9SA 3WTUC 4MHZA 2JZMA 4F9UA 2XEFA 2ZELA 1LEAA 4JK1X 2EK8A 1ULMA 2IA2A 3BTCA 3FKIJ 2KCWA 5F6FA 5KTCA 4AIKA 4C2YA 3S9LA 3VSKA 1LR7A 2CTCA 3B35A 2KISA 1WRJA 2VT3A 4HX8A 4CYDA 3QPTA 4GRIA 4DIQA 3AG3H 1EJ9A 1JKRC 2YNCC 5CVIA 2E5ZA 4XONA 2EFNA 2JA2A 2RGVA 4M3FA 1IJWC 3RIRA 4XORA 4ZJZA 4Q47A 3BJAA 1DP3A 2HYJA 4BH9A 4IHWA 3CUQB 1ZRCA 3QTLD 1LUJB 1O3TA 2Q4VA 1V5EA 4AIJA 1TNSA 2CXAA 2V8DA 3HSFA 5EYRA 3F8BA 3W2WA 2Z33A 4A94A 2ROWA 1I1GA 2SGDI 2HNHA 2MABA 2ZFUA 4G7OF 4A32A 4LIVA 2H5MA 4R7MA 4ZZDA 3DV8A 2QBYB 3BROA 1CSOI 5EGOB 5LEJA 2BHYA 1E17A 1CHOI 2DA7A 1N75A 3EYIA 4BNCA 2OH1A 3B7IA 2ZMEA 4PPZA 4LQGA 3FXMA 1NSAA 3NH5A 4MHGA 3J80K 5JQ4A 1UFMA 4CZCA 3CF5F 1X4SA 2V79A 3KIOA 1MT1A 3IH3A 4OWRB 4CCMA 1IYKA 3DEEA 1NE9A 3F5BA 4IRGA 4Q38A 3R5CA 3RKWA 3AG4H 4IAVA 4CDGA 2ELIA 2Q04A 4B1RA 1R71A 2B5GA 1BI2A 4UHTA 1H8AC 1XGMA 3TDUC 1RI7A 5FRMA 2EZIA 1YLFA 3D5RC 4BQAA 5DCMB 2JBKA 4M6HA 4BQOA 2X48A 1J0RA 3LSIA 5E3OA 4XPDC 3IWFA 3FXUA 2VQCA 3L7WA 3LMSA 2L7MP 1OLTA 5IT3A 4XIDA 4A3FJ 1ETYA 2J9AA 1CBXA 1K78A 5FUXA 3JAMK 4QLCU 2ZMEC 2GIVA 4IQ4A 4A5MA 1WJFA 3P5JA 4E7SA 1NK2P 5CCMA 2Z3NA 1RRJA 3FXTA 4MEXF 4FD6A 1JTYA 2JEVA 1RFHA 3CXQA 2Q1ZB 2O8XA 1A35A 3CESA 1ZO0A 4AG7A 4M3GA 1LR9A 4KOSA 5BNGA 1WH7A 4UUVA 3L2UA 3TDZC 1IXRC 2YUSA 4C2UA 2D4OA 2HUZA 2JRTA 2B5GB 3KEOA 3BLYA 3FM3A 3CXPA 1T6SA 2X6OA 1HKSA 2ZJQF 2F5FA 1LEBA 1HEVA 4B5PA 2DMPA 1EF4A 1Z8TA 2R7WA 1X10A 2RV8A 5FB2A 3CDHA 3RPUD 4B44A 3H5NA 5E3NA 5K7FA 1SGQI 4OP4A 1G3TA 3D8PA 1G3WA 4ENKA 2BY0A 3X2QH 1FTZA 3UOEA 2H27A 1PDNC 1OYVI 4Z65A 1OCRH 1ZG5A 1WJ5A 3ZPLA 2KKOA 5AONA 3RZOJ 4KLWA 2Q8KA 3I54A 1Y7EA 2ZB9A 3F21A 3FK6A 2SGFI 1S7FA 2E5NA 3CJNA 4D1QA 4IHVA 2CFXA 4CA0A 2VZZA 3HUGB 2GXAA 1Y39A 3PBBA 3GO5A 1JXSA 4BE1A 2JSCA 1MMDA 3ZMTA 2X9DA 2BZTA 2IGKA 5AGEA 1GLNA 1Z9UA 1XMTA 1J9IA 2B4BA 4C3IJ 5LFAA 3FH4A 1YW6A 5DM6F 1TWFJ 2OCEA 3KZZA 2XF6A 3U2RA 4UEFA 3DLLF 4Y49B 3KEYA 2E60A 4R9MA 4IRHA 1Z6RA 3CJQB 1BA5A 2O28A 5CVUA 1JTXA 2WUUA 2W4SA 4HKFA 2QQAA 1UWYA 2E1CA 2PJ7A 4QTRA 3GIUA 2R4GA 3U1KA 2VXDA 1WTJA 3K1PA 1UELB 4ORFA 2BV6A 2E71A 1BL0A 5FLXK 1ITYA 1IGNA 4UIBA 2X6WA 2DXQA 5DS9A 4SGBI 4XPLA 2ID3A 4P5OA 6PAXA 1F43A 2BHZA 3N97A 3CXLA 2AXTC 5E8GA 3SFZA 2BW3A 1ONVA 3PFEA 3S9MA 2FSWA 4PXEA 2IEKA 2M2EA 4Y13A 4BXUA 1KBEA 2PJ0A 4KISA 3CCRI 4IOAF 5FO5A 1QRYA 3HOSA 3OYHA 2GXGA 2R7XA 4A0ZA 4B48A 3NRVA 2X51A 4CCLA 1APLC 5LYIA 2CYYA 4PJ0C 1HSJA 1TKJA 1Y8QB 5IP6A 3PO2J 2FBIA 2Z99A 1SGEI 1Y8FA 2KRCA 1XEBA 2ZNYA 1OJLA 3LFKA 1UZCA 2RNGA 1CPSA 4PJMA 4UBRA 4KSIA 4MCPA 3HEFA 3FEEA 4HSRA 1MSFC 4G7ZF 1B87A 2EIJH 1Z7KB 2GANA 3GFLA 2NAZA 4M3BA 3KCCA 1HEEA 5DDGA 4J00A 4LOCA 3FRMA 4HPSA 3V8KA 2MD0A 2NYXA 3IJ3A 1QPMA 2JUGA 4I7HA 2ZEMA 2ZENA 1IRGA 2Q43A 3SI2A 3PQJA 2D45A 1YYVA 2WAEA 1HSTA 2E1MB 2X1DA 4XLFA 3W3CA 3VYUB 4BHBA 3OYEA 2O8KA 3PJRA 3TO6A 4KOUA 1U3EM 4KOVA 3TOBA 5CPRB 3S15J 2CNSA 5H84A 3VB2A 3L2QA 2FIAA 2BBYA 2NNNA 2QYOA 3BQZA 3UGLA 4O5VA 3VDPA 2DT5A 1PCAA 4C2XA 1B9MA 4JJXA 3K9UA 4IF5A 2M7AA 3GFIA 2RNJA 3BG5A 4R8HA 5IB9A 1S7EA 2EIMH 2F3CI 3RZAA 2CQXA 5EG0B 2G7HA 3K4KA 4EJTA 2J87A 1MJAA 4RLFA 3ZMVA 4EM1A 2Q44A 3GEZA 3NAUA 2B58A 4KZTA 1FOWA 1KUXA 1NG6A 5K1YA 4II3A 4KA4A 3J7AY 2NU4I 3PB4X 4A3JJ 5GPCA 1P9QC 4BBHA 4ENJA 2COMA 2DODA 3PFYA 2F2EA 3PNYA 4A3BJ 3BCAA 3ZXSA 1F4KA 2QQ8A 5IYDJ 1OBRA 1R79A 3IL2A 1M4DA 3HOVJ 3E5QA 1SVLA 3J7YJ 3IWGA 3TFYA 1UG2A 5FFZA 3MVPA 1F2PA 2POKA 2LF8A 2AQFA 3CP2A 5LGUA 3H35A 2MLKA 1JHHA 3E0JB 3WTTC 2QYVA 1XSXA 3J81K 2H09A 2XEJA 1ZAOA 1ETQA 2K9NA 1W7PB 3E1SA 3I56I 2ZC2A 1W36D 1JJ6C 1FTTA 4CCNA 4DW6A 1O3QA 3KGQA 3CCYA 1TBNA 4KIBA 2EQRA 3JR9A 1V1HA 2ZXHA 3H0GJ 2KMPA 5HNHA 2ZXIA 1SGRI 1M1DA 1WH5A 1TIQA 5EEGA 5J40A 1VQPI 2JTVA 1DUXC 1QA6A 3KASA 2PG4A 2KHMA 2HVQA 3H9JA 3S16J 2PJPA 2LP0A 2JJ7A 3ZQHA 3A2KA 1LAPA 2BUSA 3W6KB 2DMUA 1H89C 4II9A 4CPAA 3P9CA 2Z16A 3VFZA 3WE2A 2KIFA 3FMRA 4EWTA 1SAXA 2B8TA 1VFCA 4FKDA 1LE8A 3DNSA 4I6ZA 1R4MB 3SXNA 3TX8A 1D5VA 5AG7A 4BS9A 2Y75A 4P4JA 5ICEA 5J1UA 2PBIA 1W5TA 4ESFA 3HOXJ 1BC8C 3R5AA 1P0HA 2IPQX 1Y9WA 4ON0A 2JPCA 4P4DA 4MHPA 3VARA 5KHDA 2WCYA 4OAYA 2WV1A 4I0BA 3BR5A 1Z4EA 4LG0A 5K8NA 4M72A 5E8IA 5H2FC 1SFXA 1TUSA 1HDLA 1U78A 1FNNA 3ZP5A 1B9NA 1S29A 4MY0A 1R1UA 2DIPA 3QP5A 2A69F 1MMAA 2BCOA
chains in the Genus database with same CATH topology
1S8NA 4IVNA 3QOPA 2E7XA 3SHFA 2XGXA 4EV0A 4NEXA 2O03A 3KKWA 2BE5F 4CS0B 3LD2A 2BGCA 4WXDA 4YG2F 3JTKA 2PMHA 1G3SA 1I27A 4JBAA 4EGYA 1Z91A 2QQBA 2XRNA 1MDMB 3W91A 1U5TB 4N9HA 3BDDA 1ZARA 4EJWA 5LGNA 5ILSA 2LKPA 4MFJA 4HA8A 1RO5A 4PK3A 4HV6A 1GVJA 3VWDA 2TDXA 3WTZA 3H92A 1CJWA 1V0CA 5F46A 2BYVE 2M45A 3H4QA 2BEOA 3DPTA 3IGRA 4XPDB 4B11A 2XROA 3WGHA 1HQCA 2K02A 4HF1A 5IB0A 3G3SA 3R0JA 4M6XA 3B8GA 3HRMA 3I64A 1MKMA 2ZNZA 4Z2YA 5E96A 1ULYA 4MQVA 2G9WA 5HS7A 4CGMA 5D8KB 4XLPF 4HNYB 2OAZA 3MQ0A 1BIBA 5F48A 4PGGA 2E7WA 2DU9A 1KU2A 2Y48A 4OIRF 4BMHA 4B8XA 1DPUA 4CGPA 1IW7F 1TBXA 3SZPA 2FMYA 3KFWX 2HOEA 4KVXA 4HLYA 4WXCA 1MDMA 2FXAA 4QUSA 5E17F 3CUQC 2ZW4A 2P6EA 3O6BB 2WPXA 5J8CA 3WGIA 2X4HA 1OKRA 5BMZA 4LJZF 1TTYA 1PUAA 1O3RA 3A9LA 5DD4A 1K6OA 1EH7A 1SQHA 3WODF 4K2EA 3RJPA 2MA3A 4EJVA 2QUFA 4G9YA 1P4XA 1PU9A 1KQ8A 2Q7BA 3E5XA 5HLIA 1D3YA 5DD8A 4S05A 2YNDA 4C7HA 3VODA 1GXPA 3KETA 1QBJA 5DYMA 1IICA 1Z6TA 2IW5A 4A2ZA 4MBUA 5D5XB 2OU2A 4UVBA 2FQ3A 2EA4A 3HOTA 4LK1F 4OADA 4M6YA 1P2FA 3GLXA 2O61A 3I58A 1ZGJA 1F9NA 2V1DA 2CG4A 4UWIA 1LQ1A 4ASNA 4P9FA 4MQ9F 3FMQA 2LNBA 1BJAA 3NEUA 2OZ6A 2A6HF 3R9FA 1B6AA 2QZ8A 1FZPB 4OU0A 3R6SA 3NQOA 4R87A 5D5WB 2M30A 2GXBA 1WI9A 1UB9A 1Q1HA 3BJ8A 1TW2A 4CXFA 3S6KA 3QP6A 4RB0A 3EETA 3ZN1A 2ZXJA 2B4DB 4U88A 4KIGA 4P96A 4AD9A 4I01A 2EVNA 4GS4A 3FF5A 3P2FA 2XUBA 5D5UB 1TLHB 4XRFA 2R7FA 1HW1A 3HSRA 1PP7U 5LEKA 4ZYHA 5HH1<