3TO6A

Crystal structure of yeast esa1 hat domain complexed with h4k16coa bisubstrate inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transferase inhibitor
molecule keywords Histone acetyltransferase ESA1
total genus 80
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to6A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to6A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to6A02
2WV0A 1S3JA 3FM5A 1SMYF 5DUIA 4CAVA 1MJ9A 3P2HA 4UVAA 2IT0A 1Y9WA 4OLLA 1OPCA 1FPQA 2CFXA 2VZZA 5LGNA 2W57A 1YFHA 3FM3A 3GFIA 4HX7A 1QSMA 3J80K 1PU9A 3DEUA 2PJPA 1MJAA 2HTSA 2LKPA 2G3TA 4E0AA 2KJCA 3AAFA 3JAMK 4LB5A 1YW7A 1V4RA 4KUAA 2I00A 1B9NA 1OYYA 2DQLA 4MQVA 4QWQA 3H4QA 5F47A 5FB2A 3R9GA 1GVJA 1IB1E 2MLGA 3I53A 3U1DA 2IJLA 3MFKA 3HSEA 1QSRA 3D3SA 4WF2A 2V1UA 4ESBA 3KFWX 2DT5A 5F46A 2QIRA 5J8CA 2XKOA 1ON0A 2J5PA 1R22A 3VWDA 2OBPA 4GGGA 3I0TA 1XEBA 1KQ0A 3TO6A 2VBYA 4ORFA 5IX3A 3R4KA 4KUBA 1O7FA 2QLZA 4UXNA 1K7AA 3F21A 3B73A 2H6BA 2CW0F 3TFYA 4L89A 1P2FA 5D5UB 1RZ4A 2M1BA 1U8RA 4H6ZA 3F6OA 1F9NA 4GCVA 1K78A 2K5TA 3JAMZ 4BAYA 1Z9UA 5ISVA 2JDCA 1SQHA 5L3DA 2EV5A 4MNUA 4JWPA 2AJ6A 2I79A 3M9AA 4I0BA 2M5WA 2YX7A 2FT0A 4XPKA 4I2OA 2HTJA 3WTVC 1I5ZA 1FYMA 4LMYA 1MDMB 2G0BA 2OAZA 1MDMA 3DF8A 2EFPA 1FP2A 3N4MA 1QSTA 4GYGA 2E7WA 2OD5A 1D8KA 5D8LB 3JTHA 3MEXA 1DPRA 4U9ZA 2JPBA 4RB3C 3SQNA 5DWNA 2D1VA 2XASA 4G7ZF 1M4DA 3EO4A 3V8LA 3U9GA 2STTA 1S7OA 5LEJA 1YVOA 1W7PD 2DO7A 1OZPA 1QZYA 3J81Z 4KIGA 3IC7A 3GVAA 1V0CA 1S7LA 3FMRA 3BY6A 2CG4A 4G94A 2STWA 2FEZA 1W4MA 1WWZA 3ZJ0A 2KIUA 5C88A 4PSWA 5JPHA 3CTAA 5EEGA 2Z0ZA 1IN4A 1R1TA 2OB0A 2RVCA 1XSXA 4RB0A 5D6EA 3KEOA 1H9TA 5LHIA 3M7GA 1B6BA 3JVNA 3FX3A 1UB9A 1EH8A 4B5PB 3HRSA 1YX0A 3P2FA 3EXNA 2FE3A 4M85A 1W5TA 3BP8A 3B02A 1K79A 3PQKA 2PG4A 2VOPA 4O5VA 3E0KA 1HBXG 3GZ6A 3RTRA 3R9FA 3V8IA 3GX4X 2CO5A 4A0YA 1IXRC 2AS5F 3KZZA 3HRTA 4OU0A 2EB7A 2B4BA 2A69F 4AVPA 2J8RA 2ARHA 3HRUA 1YQAA 2JT1A 2Q0OA 1UFHA 4I49A 3BJ8A 3RIRA 4I09A 3DV8A 3OOPA 3DSBA 2O8XA 4KOTA 1VTNC 3HSRA 4AG9A 1USSA 4S04A 2IL4A 1ZN2A 3C3WA 2PC1A 1B9MA 2AE6A 4WX9A 1D5VA 4A2UA 3BWGA 1AWCA 3F8KA 2Z33A 1REPC 1DP7P 4L9JA 3F8FA 2QQ9A 1HSJA 3IWZA 1NHAA 3TDZC 1CJWA 1LB2A 2A4NA 4I01A 2E7XA 1BBYA 3WU0A 2XAQA 3R9EA 1OMIA 2FIWA 5KTCA 2D1HA 1YLFA 2FU4A 1TW2A 3ML6A 3TQNA 4HOBA 2IW5A 2ATRA 2FNAA 2C6YA 1R1VA 4N9IA 2UWMA 2B0LA 3GUDA 3QPHA 5CJ9A 3I9SA 1MK4A 3MZYA 5JR3A 1ZG5A 2YPRA 1HKQA 1EV7A 3E5QA 1FY7A 1RUOA 2ZCWA 4EGZA 2ZPAA 5HS7A 3HTUA 4BH9A 2VZYA 3TO7A 1BOAA 4EJTA 3BJOA 3CUOA 3CJNA 4KUMA 4G6QA 1HW1A 5E1XA 5E1ZB 5DV5A 1NMTA 3CXSA 5BOXA 2D4OA 3SXYA 2RDPA 1J59A 4LLLA 1U5TB 4M9SA 5J8FA 5FFZA 4XNHC 3EQLF 4UWIA 4HX4A 4N0BA 3E3VA 2HKXA 5AIQA 1IUYA 1S6LA 3E6CC 2QM3A 5HLGA 1MD0A 3LA2A 5FD6A 4G6DA 1QBJA 3K9UA 3CDHA 1K6OA 1WK4A 4FHTA 1LQ1A 2VXZA 2CNTA 1STZA 1KU7A 2F5FA 2XVCA 3IKTA 4CAXA 4L5IA 3F72A 4BNCA 1XMTA 2GQQA 2FF4A 3VOEA 3HHHA 2PEXA 4QC6A 4LJZF 2O28A 1IW7F 4M9ZA 3REOA 3P9KA 2CWEA 2X7BA 5I0CA 2G9WA 2JEVA 4HNXB 2QUFA 1S8NA 1I21A 5LLQA 3ZMDA 3FBUA 3KKWA 2O0YA 3DKWA 4AVCA 3T1BA 1JHHA 2DAOA 2IA0A 5DD4A 3OV8A 1TNSA 3Q9VA 5CVIA 3I3GA 5IB0A 1M1DA 2CQKA 1S60A 2ZKZA 4UHTA 2IA2A 2M8EA 3TCVA 1DUXC 3FXUA 2JLMA 3I58A 3CUQA 3S6KA 3C7JA 4JLYA 1TLHB 2P6GA 4K30A 1YVKA 1ZRCA 2VBXA 2PSWA 3R61A 5HS8A 1WKMA 2QWWA 3EDPA 5ED4A 1ZGJA 5L3EA 3ZMVA 3K1MA 1KYZA 3WG9A 4ZYHA 1ZAOA 3MCZA 3SZPA 3VFZA 5E20A 1ON1A 2HWVA 2RV8A 2RNJA 5DDGA 4HYEA 3W6KB 3FF5A 3TTHA 4HF1A 4LG0B 1IXSB 1BO4A 4JJXA 4JXRA 3FZVA 4NB5A 4BYYA 2LNBA 5H84A 3EC4A 2R7HA 2GXGA 3KP6A 1G3WA 3I54A 1KA8A 4KN7X 1MKMA 2BE5F 2VE8A 4RS2A 1M4GA 4CDGA 3WTYC 2VONA 1I12A 2QYOA 2W84A 3TDUC 3GW2A 5J6XA 4A12A 1BIBA 2HDCA 4EVYA 1T38A 3GFMA 4LK0F 1R1UA 2H94A 3FNCA 1U6GA 4PV6A 4IHTA 2HGCA 1QQIA 1P0HA 4I7HA 3FMQA 1SD7A 5HDKA 3K1NA 1FBUA 1Z7UA 1IYKA 1IF1A 4HV5A 4D0PA 2AXLA 2QZ8A 3TGNA 1O3SA 4LGWA 3F22A 4FD7A 2VE9A 3O2PE 4J3GA 4R3KA 3W6XA 4Z2YA 3ERED 4RAYA 2VT2A 2FIAA 2NRAC 1PP7U 1BC8C 4TV7A 4EVIA 2V1XA 2XV4S 4HW0A 1RI7A 4RB2C 2PQ8A 1P92A 4KOWA 1SMTA 4BHPA 2ESNA 3DPLC 4LK1F 2H6CA 3DQVC 4F7ZA 3GO5A 3MZHA 4B09A 3CLOA 3ECHA 2XHKA 2YX4A 3ZPLA 1DPUA 1L0OC 3FXQA 4AIHA 2K27A 5ICCA 4ETSA 1RNLA 2IP2A 2KCWA 3SZTA 2HYFA 2X4HA 2VODA 4NCZA 4XSZF 4UNOA 2A07F 2EA2A 1U5TA 4U9YA 1KQ9A 2HUZA 2UXXA 2A6HF 3PZJA 1W7PA 1CGPA 2FXAA 4M6XA 2GIVA 3V7CA 4ONUA 4F0YA 4WK8F 1ON2A 4YIIA 1JGSA 4KIFA 4M72A 2O03A 4A6EA 1TNTA 2DW4A 3LFKA 3SXOA 3E97A 2Z10A 1M44A 2ADUA 2B3UA 4AB7A 2PN6A 2HFHA 3QRFF 5DCFA 1Z4EA 1LEAA 5HLIA 1ZGAA 3W91A 1TIQA 4HDUA 1WWXA 3R0JA 4OIQF 1L0CA 1J2XA 5F6FA 4CRZB 3EUHA 3HIFA 5FGMA 2L01A 1XN7A 5K5QA 3BROA 3CO6C 2NNNA 4MEXF 2OZGA 3K2ZA 4PSXA 1P4WA 2H5MA 1T0FA 4ZZLA 1S7NA 1XGNA 2Z9OA 1HQCA 1ZHFA 5DCMA 1B6AA 1HW2A 3VB2A 5E8GA 4WXDA 2XKPA 2EK5A 3IWFA 1VKCA 5D6FA 4EJUA 4U88A 4NXYA 2B3VA 1Q2YA 4R87A 2DPDA 2DI3A 4HF2A 3ZMUA 2XROA 3WGGA 3ABUA 2FS5A 2XUBA 1FYKA 3F8MA 3QPTA 3MQ0A 4I98B 2EA4A 3GXOA 5HMNA 2P6SA 4KVXA 2ZXVA 4OMYA 2HOEA 4U0VA 4KMUX 4H6UA 4ENNA 3KLOA 3OWCA 4HLXA 2D2WA 5BPIA 2PBIA 2LDUA 2V1DA 2BBYA 2O61A 4EV0A 4PK3A 3S6FA 2CYYA 2IRFG 2MA3A 4LD5A 1T98A 2KKOA 3KEQA 2KJBA 2Q0YA 4IVNA 3NE7A 4QBJA 2CSOA 1KUYA 4CHUA 2PMHA 4R8HA 3LD2A 4MY0A 2BEOA 1R57A 4II9A 2ISYA 1FYLA 1XCBA 3BJ7A 4RGUA 3IL2A 4L9VA 4HNYB 3TKYA 2FL4A 2QBYA 3ZP5A 3DPTA 4BHBA 2A61A 1ZH5A 4LX9A 1V3FA 1LDDA 3I64A 3ZN1A 4ZH4F 3FXRA 2FMLA 3D0SA 1XDSA 5LHGA 4A0ZA 3J7AO 3PP9A 2B4DB 3PQJA 4EJVA 5HS9A 3ULQB 3KZYA 1RUNA 1FP1D 4M9XA 5D4SA 1Y7RA 3GYHX 2K7LA 2LF8A 2OQRA 4FX0A 4AWXB 4OADA 2FBIA 3WTUC 3LSTA 5C82A 1IZ1A 5K5RA 4ZYGA 4XPLA 1IN7A 3EETA 3GFLA 4ASNA 2YR2A 2ZXJA 3L2CA 2EFOA 2K4BA 3MGDA 4KVME 4HX8A 1G4DA 4O6JA 4MTDA 5ILUA 4Q4ZF 5KTAA 2FE7A 3T9YA 5IT3A 2GA1A 1Q1HA 5LRRA 1W7PB 4L5JA 3PFIA 1FSEA 3VEPA 2FA5A 4HV6A 1UHWA 3QAHA 1LJ9A 3GWZA 1UHMA 2L3DA 1G6NA 3ISPA 4IF4A 1K4JA 3GKRA 3BPVA 2WC2A 2FSWA 5DCMB 4FD6A 4NQWA 4WCGA 2Y75A 3H92A 3PGPA 1LVAA 2ZJ2A 2R3SA 4MHDA 2H09A 4WWCA 2ZW4A 4RAZA 3J80Z 2ETHA 4EM2A 1SFEA 2QECA 5BMZA 4KFCA 2VOOA 2VEZA 1YG2A 3GYAA 5FD5A 1YW8A 4QUSA 4ZBGA 1FBQA 3V8KA 1FSHA 4CYDA 2EFNA 3DNSA 3GZ5A 4HBLA 4G9YA 3DR8A 5A2QZ 1EH7A 4EM1A 4HF0A 2RN7A 4LG0A 4KLWA 4JQFA 5LBQA 3BDDA 4YFKF 4RB1A 5EBVA 2ZW5A 4GXOA 2OZUA 4RS8A 4Y13A 1KZFA 2GANA 3G3SA 2V6CA 4KDPA 4HKFA 1KU9A 4P55A 2D4PA 4YG2F 4A6DA 1WRJA 1T6SA 1J7KA 3E6DA 2P6EA 3QP6A 1BM9A 4YRHA 1QO0D 2JZYA 2GXBA 2B58A 1IN6A 4YIFA 4HA8A 3F23A 1S5KA 2GAUA 4LFUA 4XLPF 1B1BA 3QB8A 2NYXA 3E6BA 3K1PA 3KP3A 3P9IA 3IRQA 2Q4VA 2B5GB 4U7DA 2F5EA 1G3YA 1YK3A 3RPQA 5KTDA 4MEYF 2WTEA 3KP2A 5KVRA 5E8IA 1SD4A 4UV9A 4HDVA 3S2WA 3ABTA 1QNTA 3D5LA 2DK8A 3KP7A 5KK1A 1Z05A 2MH9A 4G7OF 1JE8A 1IIDA 1J9IA 3Q9SA 4XLNF 4ENKA 3V4GA 3CUQB 4KZTA 1P4AA 2UZKA 1I1DA 4OAEA 2XRNA 4AIKA 1Z6TA 5DD8A 3HSFA 2VN2A 1IRGA 3IGRA 1PUEE 3LAJA 3DFGA 3WGHA 4ENJA 4LUAA 4OIPF 1BOBA 2GZWA 3F0AA 1BJAA 1ZLKA 3Q5FA 3L9FA 1UFMA 4CICA 5L3GA 4IPAA 4FX4A 4OIRF 1I1GA 3D2MA 1Z1DA 4YFJA 3R96A 2GWRA 4HNWB 3RJPA 2EVNA 2PLYA 3ROUA 4BQAA 4IRIA 2ELHA 4OINF 1LRZA 4X5KA 3DDDA 1SFXA 2W25A 1D3YA 1U78A 2F5CA 3LA3A 5JHUA 2BSWA 3K9TA 4R1HA 1IICA 1S7KA 3IRRA 1P6RA 1BI1A 4O3MA 3T0YA 4LLNA 1HSTA 3E5XA 2O6GE 2KRFA 1EH6A 1VHSA 1SFUA 1AOYA 5F48A 4A5NA 2FRHA 1YR0A 2BL1A 5JVTA 5LEKA 1FNNA 2MD5A 3FXTA 2DXQA 4L0ZB 4AVBA 4XBFA 3T8TA 1HW5A 4ZYEA 4IJAA 3CO7C 5H6QA 3DR6A 1XMKA 2ZMEA 2RQPA 1J0RA 1G3SA 2FOKA 1CF7B 1F5TA 2PFBA 3WE3A 1WQ2A 1BIAA 3LQQA 4WXHA 2Z11A 1XGMA 3G8WA 3FWEA 2P0WA 1O3RA 3GY9A 2P7VB 2HV2A 1HKSA 4Y17A 3KETA 2L4MA 4KORA 2QQAA 4PCQA 5GCNA 1P4XA 2R7DA 5D4RA 4H0EA 3FHZA 2BEIA 5AIPA 2OZHA 4MY3A 4ZYDA 1Z9CA 1SD6A 2DU9A 2WPXA 1RO5A 3M8FA 3EYYA 2LSOA 1MGTA 4G7HF 2CY2A 3W6SA 4PDKA 3M1EA 5DYMA 3FRMA 3MAJA 3V8JA 5K1YA 3ECOA 1ZARA 3F8CA 4ESJA 4MJ8A 1PDNC 2Z5UA 3V7RA 2FCKA 4FD4A 1TQPA 2P6TA 3WTXC 4B5PA 1IAWA 2HKOA 1KUXA 1FT9A 1YS6A 4KOUA 4L9TA 2EFWA 4ESFA 2UXNA 1N71A 5CYVA 1L3LA 2MBFA 4R3LA 3P9CA 2J5OA 5JFRA 2ZW7A 3F5BA 2X0LA 4R79A 2W85A 3C26A 5H20A 3S6GA 3ZMZA 2QENA 4XSXF 4PGGA 2QVOA 2ESHA 3J81K 3QU3A 1RIOH 2DQRA 1FOKA 5E1WA 2MLKA 5DEQA 1T2KA 2DPUA 2IA1A 3KE2A 2JPCA 1HXDA 1R5GA 4RGXA 1ZREA 4XNHB 3JSOA 4ENMA 1B59A 1YIOA 1ZRDA 1QPMA 2P6FA 2HR3A 3CXQA 1U6MA 3R95A 1Y9KA 3SHFA 3L7WA 3WODF 4KVOE 5F64A 3KP5A 2ZNZA 2FQ3A 4JXQA 2VI7A 4U7BA 4M71A 3E5UA 1UCRA 1ZG1A 1Z4RA 3BLNA 5BS6A 1JXSA 4M74A 3DXJF 4L18B 1PP8F 4AVAA 3S6HA 4EGYA 2ZFWA 1E2XA 2PDOA 5LHHA 2Q4YA 1TQIA 4M73A 1DDNA 1ZRFA 1RXTA 4OOIA 5IV0A 1S7FA 2CGPA 2HQYA 4A5MA 3P7NA 2DK5A 4IF5A 2HZTA 1XIXA 3T90A 4QLCU 2OH1A 4LB6B 1ULYA 2CNSA 1XGSA 1I1SA 5HDGA 4IRHA 5HH1A 1QGPA 5JQ4A 4ON0A 2ACJA 1B4AA 2G7HA 2A3SA 4DQ2A 5HDNA 5TRDA 3JSPA 3WR7A 1Y0UA 4RI1A 3QU6A 4ZZDA 1ONVA 2XAFA 2EJRA 4OMZA 1X3UA 3N97A 4KN4X 1OYIA 6PAXA 1TBXA 3BJ6A 1XGOA 2FBKA 5E17F 3I5UA 2OZ6A 1YTYA 2HS5A 5L3FA 2W24A 4CGZA 1J4JA 3O3KA 1CM0A 2M30A 4CS0B 3IHUA 5HOOA 2K02A 3HYIA 4PZJA 5FFXA 5H6RA 4P96A 5HVQC 3TOBA 3F8BA 3U2RA 3COAC 1PUAA 2R7FA 4R57A 5F1RA 2DLLA 2GA2A 2MH2A 4HZFA 1FLIA 1R7JA 3LAPA 1SAXA 1O3QA 4JD6A 3I4PA 1GXPA 4GO1A 2PR8A 1R58A 2FBHA 2EV6A 2Q2EA 1GHCA 5JI6A 2MC3A 3BZ6A 2FNPA 2P5LC 1KU2A 4IRGA 4KOVA 2P4WA 4KOSA 2EFQA 4MQ9F 3E6MA 4BMHA 4GYIA 1Z6RA 1Q2DA 1BI0A 3KP4A 3RKYA 3GFJA 4NF1A 1P4NA 1MZBA 4U0YA 5CNPA 1GXQA 5ERIA 2VBWA 1KQ8A 3WTZA 4A0XA 5D5WB 4MTEA 2QMLA 1O7LA 1YS7A 3WTSC 3D2PA 4P9UA 1YGHA 3UY5A 5EC4A 3ZMTA 4L9NA 3R0AA 3FMSA 1LNWA 2WWYA 1OR7A 4B8XA 3BJAA 4JK1X 1IXCA 3NQOA 1BC7C 2EV0A 2P7CB 1HKTA 5LGTA 3ZMSA 1F4KA 4I02A 4HQEA 2KIFA 4Q47A 5BQTA 2FMYA 4IHSA 4RGSA 3L09A 4M3SA 2XGXA 3VWEA 4XPDC 1H9GA 1W5SA 1YYVA 1XD7A 3H3UA 2COMA 3C18A 5D5XB 2JDDA 4CAWA 2P5KA 2PRBA 1LDJA 5TJJA 2YU3A 3HRMA 3JW4A 1QZZA 3QP5A 3NEUA 4HLYA 1LDKB 4U5YA 4CO8A 2HYGD 3ELKA 4XRFA 2ZMEB 4FT8A 4MI4A 4HQMA 3NRVA 5IT9K 2QQBA 3C1DA 5ILSA 5LGUA 3BPXA 3RI4A 2M45A 4YGOA 1I27A 1XSDA 5A2QK 1NE9A 4M6YA 2VT3A 4L8AA 5H86A 4Y49C 4Y49B 2TDXA 5CVVA 4KICA 4BHCA 3HUGA 2PR1A 4RGRA 1S7AA 4Q48A 1F1ZA 3QOPA 3SFZA 3TE4A 3R6SA 4AIJA 1FC3A 2P5VA 1LEBA 3K0LA 2F5IA 1TTYA 3W6JB 4U0WA 5DUKA 1XE4A 1ZYRF 4UA3A 1U5TC 1J75A 3WTTC 3TT2A 5LRSA 3RYOA 2Y48A 3GEZA 3ZZIA 3D8PA 2XAGA 3LA7A 4Q5SF 1CF7A 4YFXF 4PGHA 2JRTA 2ZW6A 3T5XA 1YO5C 3KLNA 1O57A 2PI0A 3G73A 2NAZA 2L4AA 1R5HA 1KGSA 5L3BA 3GF2A 3RYPA 1K78B 4CXFA 4KOXA 3I59A 3RKWA 5CVRA 3ZN0A 2EWNA 2REEA 2DFIA 2RC4A 4QB9A 2FXFA 1R23A 3HOTA 3LWFA 1XMAA 2XIGA 2G3AA 3TO9A 2PMUA 2ISZA 3EYIA 1IYLA 1A04A 3F6VA 5CLSA 3WE2A 4L0YB 2E1NA 5D8KB 4IUSA 2F5DA 1I6XA 4P5OA 4QVTA 5ICEA 4UVCA 2REFA 5CVJA 1ODDA 3IKVA 2HEOA 4CZZA 2GE3A 2Z99A 2Q44A 3HHGA 2L02A 4AD9A 3VODA 5D5VB 4CRYB 4UWJA 2QBYB 3R1KA 4AG7A 4NHJA 2H27A 4Y15A 4E70A 2K86A 3JUWA 2P8TA 1ZLJA 4E8OA 3G3ZA 2IVMA 2Z3YA 2J8MA 5K5OA 2CNMA 4UBRA 3FIXA 4KOYA 3EFAA 5FLXZ 2KIMA 1YREA 4E2AA 4NSQA 2VBZA 3RYRA 4R9MA 3RKXA 3SXNA 5ICGA 1O3TA 3WTWC 2FSRA 1R00A 2LF7A 2NS0A 5FVJA 1XDUA 1T39A 2EUIA 3F8NA 1BI3A 1YW9A 2J8NA 2B4DA 2WPWA 5BPDA 2NNYA 4LLGF 3L00A 2HQRA 2JTVA 1FZPB 4IXAA 4MHGA 3DP7A 2OU2A 1FX7A 2XAHA 5L3CA 5CVUA 3HOSA 2A6EF 3MWMA 2Q8KA 3B8GA 1IN8A 1XSVA 3I71A 3WGIA 3T8RA 3JTGA 4B5OA 1D8JA 2Q7BA 2ZO4A 2YSRA 3ZQ7A 2A5YB 2RGVA 2R98A 1WI9A 1KUVA 3M8EA 1YLEA 5AONA 4UV8A 4KYWA 1BI2A 4P9FA 4EMSA 2VXKA 2VC0A 5F49A 4KT5C 1KU3A 3RPUA 4KLVA 3RDIA 2ZNYA 2HQNA 4S05A 2OQGA 4PK2A 2V9VA 1OKRA 2R1IA 3H3ZA 5E96A 4XPDB 4EM0B 3V7SA 1GHEA 1M4IA 3CXPA 4BXUA 1QSOA 4N9HA 4HAMA 2B5GA 3FYNA 1SD5A 4UUVA 2BV6A 4YFNF 2VC1A 1JHFA 1XF8A 1IN5A 1Z91A 3HTSB 2L54A 3BOQA 2VQYA 5FO5A 3LODA 2Y0MA 5IT9Z 1ZG3A 1J5YA 3SHPA 4KMFA 2K4JA 4NEXA 2NMTA 2Q04A 1FBSA 1NSLA 1IRFA 4DNCA 5E18F 3TOAA 1C0WA 3I59B 1MJBA 5EEHA 4G8XA 1XB4A 3GLXA 4I0AA 4GS4A 1TW3A 1U3EM 2OA4A 3WU1B 1U2WA 3FB3A 2E1CA 2M87A 4KIBA 1Q2CA 2G7UA 4MBUA 2ZBKA 2F2EA 2C27A 4EQQA 1R36A 2IPQX 3EY5A 3F3XA 2V79A 4KA4A 3KCCA 3CUQC 2DBBA 2D45A 1OYWA 4EJWA 1E17A 2DTRA 3O6BB 4MGRA 1USTA 4OIOF 3R60A 4JBAA 4H89A 4EJOA 2R8VA 4KNYA 1XCVA 5HLHA 5DWMA 1TQMA 3N7ZA 5ICFA 1KYWA 2BUEA 2VBQA 1S3ZA 1H0MA 5FLXK 5ILVA 4UVBA 3K69A 4FD5A 1BN5A 2JSCA 3IWGA 1S29A 1WSUA 4K2EA 3LQRA 4F6AA 1FWZA 1G3TA 4WXCA 2BGCA 2BYVE 2A68F 2O3FA 1QSNA 2RKHA 2XAJA 1B87A
chains in the Genus database with same CATH superfamily
2WV0A 5J1YA 2PJRA 1S3JA 3FM5A 3RBUA 1SMYF 1CP6A 4A3MJ 5DUIA 4CAVA 4P1WA 1MJ9A 1NH3A 2R7QA 3PNYA 3P2HA 4UVAA 2IT0A 1Y9WA 4OLLA 3SI2A 1OPCA 4HSTA 5E3OA 1W0TA 1PVEA 1FPQA 2CFXA 2VZZA 4D9JA 5LGNA 2W57A 1HDPA 2DOAA 3FM3A 3GFIA 1V5FA 4HX7A 1T56A 3J80K 1YFHA 1PUFB 1QSMA 3K2KA 5HODA 1VQNI 1PU9A 1V1IA 4MFDA 3DEUA 2PJPA 1MJAA 1SC7A 2HTSA 2LKPA 4II3A 1CHOI 5EYRA 4FTHA 3GLLA 2G3TA 3CJRB 4E0AA 3S2DJ 2IQ6A 2H8WA 2EK8A 2KJCA 4AVZA 3AAFA 1U5KA 3SJEA 3GTQJ 3CF2A 5CQGA 3JAMK 4LB5A 3E7LA 3HGYA 4A3GJ 2L7ZA 1YW7A 5DTDA 3PJRA 3AG3H 1V4RA 5F0HA 1LE8B 1N13A 4KUAA 2I00A 1B9NA 1OYYA 2DQLA 2X1CA 4MQVA 4QWQA 5K7FA 2DF5A 3H4QA 4BU2A 1R79A 2HUZA 5F47A 5FB2A 3R9GA 4D5CA 2E2JJ 2MC4A 1GVJA 1CBXA 1H88C 1IB1E 2Z3PA 4AXVA 2MLGA 3I53A 3U1DA 4ZTJA 4CCMA 3BTLA 1LR9A 2IJLA 2HC9A 2AFZA 4E6KG 2JVGA 3FBNB 3R5BA 4KJZA 3MFKA 3HSEA 3ZGKA 1Y0NA 1ETYA 1QSRA 3D3SA 4WF2A 3CCQI 2V1UA 1T0FC 2BOAA 3CD6I 4R6TA 4ESBA 3KFWX 2DT5A 3DLAA 4GFBA 5F46A 2GLOA 2QIRA 4CAEA 4C2ZA 4B3XA 5KCMA 2CQ7A 2OTJI 5J8CA 3KYLA 3IWWA 1MBJA 2XKOA 3UGDA 2J5PA 1ON0A 1R22A 1HDQA 4XRMA 3VWDA 2OBPA 4GGGA 3I0TA 1XEBA 1KQ0A 3TO6A 2VBYA 3GTOJ 4ORFA 5IX3A 2R5YA 3GMEA 1Y1BA 4KSFA 3R4KA 4KUBA 1O7FA 2QLZA 4UXNA 1K7AA 2R7UA 2NVTJ 1H8LA 2L7FP 2DODA 3F21A 3B73A 3PB7X 2H6BA 2CW0F 1VQ9I 2FD5A 3TFYA 4IKFA 4L89A 1P2FA 3IWEA 4E7JA 5D5UB 2Y0SA 1RZ4A 2M1BA 2BUSA 3LFUA 1U8RA 1VQ6I 1PCAA 1G8XA 3EUHC 4H6ZA 4JOMA 3QQAA 3F6OA 1F9NA 5FKOA 4GCVA 3MKWB 3UOEA 3VDUA 1K78A 4P4JA 2K5TA 2SGQI 3D7DA 1A5JA 3BI1A 3JAMZ 2L9SA 3GTJJ 3H3VK 4A24A 2HVQA 2PCUA 4BAYA 1OBRA 1Z9UA 1R43A 2ZEGA 5E3MA 5ISVA 4DBQA 1SQHA 2JDCA 5L3DA 2YNDA 2EV5A 4MNUA 3WG7H 5B1AH 5J47A 2AJ6A 2I79A 1LAPA 4JWPA 1D1BA 3AL0C 1V54H 3M9AA 2SGDI 4I0BA 1B8IB 2M5WA 2YX7A 2FT0A 2K5CA 4XPKA 1VQPI 4I2OA 2HTJA 3WTVC 1LR7A 1I5ZA 1FYMA 4LMYA 1MDMB 3JRBA 2DMQA 1JI8A 4W97A 3M4OJ 2G0BA 2OAZA 1MDMA 3DF8A 2EFPA 1FP2A 3N4MA 3GZNB 3CMYA 4DYRA 1QSTA 4GYGA 4X1EA 2E7WA 2XEFA 1BA5A 1GUUA 2OD5A 1D8KA 4MHPA 5D8LB 3JTHA 5IY5H 3MEXA 1DPRA 3BCAA 4OC5A 4U9ZA 2JPBA 4RB3C 3S1MJ 1DTDA 4XLEA 4CYQA 3SQNA 2ZFUA 5DWNA 2D1VA 4X2TA 3PIOF 4BEHA 2XASA 4G7ZF 5KNLA 2QPOA 1ENHA 1M4DA 4UUSB 3EO4A 4XKBA 3V8LA 4LITA 3U9GA 3A0HC 2STTA 1S7OA 4R7MA 5LEJA 1YVOA 5J3LA 3OWTA 1W7PD 2DO7A 2N52A 1OZPA 2UV1A 2JA2A 1QZYA 3J81Z 3WC5A 3DKXA 1EF4A 4KIGA 3CXLA 2JBJA 2K3PA 3IC7A 2EZLA 2LB7A 3L2NA 3GVAA 5CCMA 1V0CA 2NU1I 1S7LA 3FMRA 1SFKA 3BY6A 2R7ZJ 2CG4A 2AO9A 4G94A 5EX3A 1ZLIA 3FB3A 4H4KC 3D5SC 1GLNA 3BT9A 2STWA 4C3IJ 4JCVE 2FEZA 1DU0A 4KS9A 4P4FA 1W4MA 4X6AJ 2NXNB 3HDDA 1WWZA 2V8DA 3ZJ0A 1N77A 4M6VA 2KIUA 2VKHA 4JX5A 5C88A 1MNMC 4PSWA 5JPHA 1LFPA 5K8OA 3CTAA 3HEFA 5EEGA 4E1PA 2Z0ZA 1IN4A 1R1TA 2OB0A 2DA2A 3FSYA 2RVCA 1CP7A 1XSXA 4RB0A 5C44J 2R7SA 5D6EA 3KEOA 1H9TA 2DIPA 5LHIA 1X10A 2CUEA 3FH4A 1T33A 1P9ZA 3M7GA 4A69C 5LYIA 4NGMA 3D1NI 1B6BA 3QODA 1WVRA 1QHGA 3JVNA 4PXEA 2CWGA 1WGTA 4XK4A 3NH4A 3FX3A 3H5AA 4XR6A 1UB9A 1EH8A 5LFAA 4B5PB 5FRMA 1R5ID 1I3AA 3HRSA 1YX0A 3P2FA 4DJLA 4KISA 5HQ8A 3EXNA 2FE3A 4M85A 4RUHA 1FIAA 1W5TA 3BHXA 3OOUA 5HLTA 3BP8A 4UCNA 3B02A 1K79A 3PQKA 1TWHJ 2PIYA 3FMCA 4RN7A 2PG4A 2VOPA 4O5VA 3ZOBA 3E0KA 1HBXG 1X1AA 2ZXIA 3GZ6A 3SGBI 3RTRA 3R9FA 3N5FA 3PIPF 2QCOA 3V8IA 4I76A 1YW4A 3GX4X 3E2IA 2CO5A 2RNGA 4X3RA 1XRYA 2VJ4A 4MCRA 4A0YA 2XF5A 4XLAA 1IXRC 2DTZA 2AS5F 4ZI6A 2ZOFA 3KZZA 1UELB 3DPUA 3HRTA 4OU0A 2EB7A 2B4BA 3HL2A 4PJLA 1OR7C 3OYLA 4EEFG 2HVSA 2A69F 4AVPA 2J8RA 2ZEFA 2ARHA 3HRUA 1RFHA 3V7ZA 3UEYA 1WH5A 1YQAA 3UGIA 1RKWA 2JT1A 2Q0OA 1UFHA 5IP7J 4I49A 4BD9A 1JTXA 3DBLB 1OMUA 3BJ8A 2PJRB 3RIRA 3RPUD 4I09A 2VI6A 3DV8A 4YIRX 5J1UA 4R8FA 2CUZA 2ROWA 3TC8A 2QSHX 3OOPA 3DSBA 2BVLA 1A6QA 1X4OA 2ODDA 3IV5A 1Z8LA 3PBBA 2O8XA 4KOTA 2DKVA 2KRHA 4CCLA 3OYIA 1VTNC 1GYTA 3HSRA 4AG9A 3PFOA 1USSA 1VF9A 4S04A 3AG4H 2IL4A 1ZN2A 4CUGA 3PEIA 3C3WA 2PC1A 1B9MA 2AE6A 4OMEA 3U1KA 4WX9A 2VB6A 3BG9A 2CQXA 4A2UA 1D5VA 3BWGA 1AWCA 3F8KA 1X3ZB 2Z33A 2DXIA 3Q0VA 2F7VA 2BW3A 2GLJA 4A33A 1REPC 2HDWA 2Q7SA 4MFPA 2NYQA 1DP7P 3FSXA 4L9JA 3HM5A 3F8FA 3OSFA 2ENNA 2QQ9A 3SFIA 1HSJA 3IWZA 1NHAA 3TDZC 5C4JJ 1VHEA 3RO0A 1CJWA 1LB2A 2XSJC 2A4NA 4I01A 2FVGA 2E7XA 1XFOA 3IU1A 2EILH 1BBYA 3WU0A 2XAQA 3DTKA 3HBLA 1MMGA 3R9EA 5A27A 1OMIA 2FIWA 2XF6A 5KTCA 2D1HA 2ODFA 2Z16A 2VL8A 1ZR4A 4MXUA 3DBRB 3H5NA 1MIJA 1YLFA 2FU4A 3DEEA 2Y30A 3DWLE 5EMIA 1TW2A 2QJ8A 3ML6A 3VDXA 3TQNA 4UIAA 5AG4A 4HOBA 3V42A 1R4MB 3CMMA 2QEXI 3PB8X 2KL4A 2HPMA 2IW5A 2ATRA 2FNAA 1ERDA 5HVHA 1Z3YA 3TMOA 2Q2EB 3S93A 2C6YA 4V19K 5GTHC 1ZO0A 2ZXWH 5F04A 1R1VA 4N9IA 3BR5A 3K4LA 1R6RA 2ZJQF 2UWMA 2B0LA 5JLXA 4HNUA 3GUDA 4L5EA 3QPHA 5CJ9A 3I9SA 1MK4A 1LKXA 3AG1H 2NU0I 3MZYA 5JR3A 1ZG5A 2YPRA 4OP4A 1ETVA 1HKQA 5K8PA 2CXAA 2CU7A 1Z67A 1EV7A 2NOGA 3E5QA 4XN3A 1FY7A 1RUOA 2ZCWA 1NK2P 3WT4A 4EGZA 3OSGA 1OCPA 2ZPAA 1NG6A 3BG3A 3LSMA 3IIBA 5HS7A 1ULNA 5E79C 3HTUA 4BH9A 2UVOA 1K83J 1X4PA 2CRGA 2VZYA 1GVDA 2XGEA 2M8GX 3TO7A 1BOAA 4B44A 1J09A 2BOLA 1G59A 2KPMA 3BJOA 3CUOA 3CJNA 4EJTA 1PTRA 2R4GA 1FOWA 5HVFA 2VPRA 1MSEC 4KUMA 4G6QA 1HW1A 3PB9X 4BY1J 5E1XA 5E1ZB 1Z77A 1V1HA 5DV5A 1NMTA 3SDBA 1RC9A 4OC2A 4MLOA 2MSYA 3CMAI 3CXSA 1OFCX 1X1CA 1RKTA 1KWMA 4A32A 3PFEA 1JKQC 2WUUA 5BOXA 2D4OA 3KQZA 3SXYA 2RDPA 1IJWC 1JKOC 2GLFA 3A01A 1V5EA 2EIKH 2NVUB 1J59A 2W00A 4LLLA 3CT9A 1U5TB 3F0CA 4WP4A 4M9SA 5J8FA 5FFZA 1YJ9I 4XNHC 1LR8A 1Q1VA 3EQLF 2KT0A 4UWIA 5FUXA 4HX4A 4N0BA 5IOZA 2X1DA 2HKXA 3E3VA 5AIQA 5EZGA 5GAHJ 3AKZA 1A35A 1IUYA 2ZC2A 1S6LA 4J01A 3GCMA 2DB6A 3E6CC 5J1RA 2QM3A 5HLGA 4TNUA 1MD0A 4UUSA 1TZLA 3LA2A 5FD6A 3EUAA 4G6DA 1QBJA 2AFXA 3TEDA 2X1EA 3CDHA 3K9UA 1K6OA 3DLLF 2Y9ZA 1WK4A 1ETWA 4AYBN 3MKZA 4XIDA 4FHTA 5A28A 2A6TA 1LQ1A 2VXZA 1CX8A 2CNTA 1STZA 1ZR2A 1KU7A 2F5FA 3UGLA 2LC2A 2VUMJ 1JTYA 2XVCA 4CH7A 3IKTA 4XKVA 1VHOA 4CAXA 1IU8A 4NGQA 4L5IA 3F72A 2CWFA 2QYVA 1BPNA 3K2AA 4BNCA 1XMTA 2GQQA 5CPAA 2DMUA 4A93J 2Q51A 3A0BC 2E5RA 2FF4A 2CQNA 3VOEA 3HHHA 2LG4A 2PEXA 2VKVA 3VE5A 4DGWB 4Y33A 2NU3I 3MN8A 2KIQA 3H35A 4QC6A 4LJZF 2O28A 1IW7F 4M9ZA 3REOA 3P9KA 2CWEA 2X7BA 5I0CA 2G9WA 2KCXA 2JEVA 2ZJPF 4PK4A 4PFPA 2M9HA 2QUFA 1S8NA 1I21A 5LLQA 4HNXB 3ZMDA 3FBUA 3KKWA 2O0YA 3DKWA 2POKA 4AVCA 3CC4I 1JHHA 2DAOA 3T1BA 3CCLI 2W1OA 1TT0A 2IA0A 2EZIA 2TRTA 3OV8A 5DD4A 5KAIC 1TNSA 3Q9VA 1N75A 1Z0XA 5CVIA 3I3GA 5IB0A 2ERWA 2CQKA 1M1DA 1ZKGA 2JA7J 4MFZA 1S60A 3IAS2 2ZKZA 4UHTA 1A2ZA 2IA2A 2M8EA 3TCVA 1DUXC 2P6AC 3FXUA 2EH3A 3DTIA 3IH4A 3I58A 3SDGA 3CUQA 4NQWB 3TBIA 2JLMA 3B2YA 3S6KA 3HXLA 3C7JA 1QQ9A 4JLYA 2E2IJ 2EINH 1TLHB 2JXDA 2P6GA 4K30A 2VQLA 1UVFA 1YVKA 1ZRCA 2VBXA 2PSWA 4R76A 5J40A 4NGTA 1CT2I 3R61A 3ABKH 2QF7A 5HS8A 1O4XA 4K3NA 4UFVA 1PYTB 5K7ZA 1WKMA 2QWWA 3EDPA 5FJ8J 4LQGA 5ED4A 1ZGJA 2KRCA 5L3EA 1ZG7A 4M6HA 3QPSA 4LIVA 3ZMVA 2GU2A 3K1MA 1WTJA 2BXYA 4P4IA 1KYZA 3WG9A 1ZAOA 3MCZA 4ZDLA 4ZYHA 2JA8J 3SZPA 3VFZA 2L7XA 3E59A 2IMOA 3KGQA 5LRJA 2ABZA 5E20A 2IAIA 4C2UA 1R49A 1ON1A 2Q1ZB 4C30A 2HWVA 2RV8A 2RNJA 5F27A 2WVJA 5DDGA 4HYEA 3W6KB 3FF5A 5EGOB 1LE8A 4HF1A 4LG0B 3TTHA 5EZHA 1WH7A 2OUMA 4UB6C 3BR0A 1UUCA 1IXSB 4DUKA 2ORVA 3CCRI 1BO4A 4JJXA 4CGLA 2NU4I 1FTTA 3VATA 1A6IA 4JXRA 3FZVA 4NB5A 2K9HA 2ZEDA 2Y2ZA 2LNBA 4BYYA 4IO9F 1YTPA 2CMPA 3HJEA 5H84A 4XNFA 3EC4A 3OYAA 2R7HA 4O23A 2GXGA 1ZK8A 1G3WA 3KP6A 4JYKA 3I54A 1KA8A 4KN7X 2NU2I 2KMRA 1MKMA 2BE5F 2VE8A 2GOXB 4RS2A 1M4GA 1T8IA 3SI1A 4XONA 4CDGA 3WTYC 2VONA 3BQZA 1I12A 1H89C 4GM5A 3UEJA 2BW3B 2QYOA 2W84A 3TDUC 3GW2A 5J6XA 4A12A 1BIBA 4JYWA 4PJMA 2HDCA 4EVYA 3BR3A 3H9JA 3GFMA 1T38A 1R3NA 4LK0F 3TW6A 1R1UA 2H94A 3FNCA 1U6GA 4PV6A 3FF3A 3CDIA 2CV1A 2V8VA 2MD0A 2KHMA 3W2VA 4IHTA 2EO8A 2HGCA 5EJCA 4OKOA 4F92B 2LREA 2Z3MA 1QQIA 5G22A 3SJGA 1VNDA 3L2QA 3JRHA 1P0HA 2BVMA 3K4BA 4I7HA 3OYDA 2HOTA 2X52A 4A31A 3KR4A 4BE0A 3FMQA 1SD7A 1N25A 3QYBA 4OVOA 4BJTA 2GM4A 3NH5A 2JZMA 3A02A 3BQYA 5HDKA 3ZQCA 1VQ7I 3K1NA 2QA4I 3B6CA 1DS2I 1X12A 1FBUA 3VYTB 2GKRI 2VKEA 1Z7UA 2W82A 3G6EI 1IYKA 1IF1A 3BG5A 4HV5A 2AXLA 4D0PA 2QZ8A 3TGNA 2AQFA 1O3SA 1IGNA 3OYJA 4LGWA 3CCYA 5J1QA 3GTLJ 3F22A 3SJXA 4FD7A 2VE9A 3O2PE 1Y1CA 4F8ZA 1PJRA 4AIDA 4J3GA 2JA6J 3NE8A 4R3KA 3W6XA 4Z2YA 3LOCA 4RA2A 1K6YA 2OVOA 1OCOH 3ERED 4RAYA 2VT2A 2OPTA 2FIAA 4ZDOA 4MHZA 2NRAC 1PP7U 1D1CA 1BC8C 4BQQA 1E0EA 4TV7A 4ZX8A 4MFEA 4EVIA 3J7YJ 3K7AJ 4D1QA 4UEEA 2V1XA 4B3AA 5HXDA 4PJJA 2XV4S 3GB0A 5G20A 3PL8A 4HW0A 1UJ8A 3VYUB 1ETQA 2NS8A 3S16J 3IUOA 2QGUA 1RI7A 4RB2C 2PQ8A 1BAVA 5EEAA 2ID3A 2ZEPA 3LNQA 1P92A 4KOWA 1SMTA 4BHPA 2ESNA 3DPLC 3M3YJ 1OCCH 1WJDA 4LK1F 2EIJH 1ACIA 2DEAA 1ELLP 2UZ3A 3DKYA 2H6CA 3DQVC 1BR4A 4F7ZA 1HDDC 3GO5A 3MZHA 1UG2A 4FKDA 2R0QC 3VARA 4B09A 3CLOA 1Y1WJ 1TBRR 1UVGA 1MNDA 3ECHA 3VSKA 5K7HA 2XHKA 2YX4A 2YUUA 3H5ZA 4B48A 4ITVA 2R7VA 1D1AA 2WSAA 3ZPLA 3NA6A 1DPUA 1L0OC 4YU9A 3FXQA 4AIHA 2K27A 5ICCA 1U8BA 3DCFA 4ETSA 1RNLA 4RAFA 2IP2A 3P5JA 3SZTA 2KCWA 2YNCC 4JZ0A 5EDNA 2HYFA 2V1CC 5F08A 3S3MA 2X4HA 4J19A 2VODA 2BY2A 4XSZF 4NCZA 5JGFA 4UNOA 2A07F 2EA2A 4D5FA 1U5TA 3OYEA 4U9YA 1KQ9A 2E35A 3LSGA 2GXAA 1MH4A 4A3FJ 2UXXA 1DQUA 4BBSJ 2A6HF 2PMZA 3S1RJ 1VQLI 1IY6A 1F2PA 2XEGA 1W7PA 3PZJA 1LFBA 4Z6YA 1CGPA 2FXAA 4Y52J 4CCKA 1PJUA 4M6XA 1MT1A 2GIVA 2F5VA 3V7CA 4ONUA 4A3JJ 3ERMA 2Z3NA 4F0YA 4WK8F 1ON2A 3K70C 1Z2LA 1TBQR 2Y31A 4YIIA 1JGSA 3OR2C 4KIFA 4M72A 3SEKC 2O03A 1DU6A 4A6EA 2CV2A 3E0JB 3BG7A 1TNTA 1Y0YA 3TL4X 3A4CA 1NTCA 1SVLA 1VQ5I 4FISA 2DW4A 3LFKA 3JRCA 4BDYA 3SXOA 3W2WA 4DOZA 3E97A 2Z10A 1M44A 2F8HA 2ADUA 2B3UA 1FIPA 2YUSA 4PJ0C 4AB7A 2PN6A 2IGKA 2HFHA 3L2RA 5DCFA 3QRFF 2M5XA 2BCOA 1Z4EA 1LEAA 2HNHA 5HLIA 1X3WB 1ZGAA 2E2HJ 3W91A 4DZJA 1AYEA 1TIQA 4HDUA 1WWXA 3R0JA 4OIQF 3LMMA 1L0CA 1J2XA 5F6FA 3ABLH 1SVMA 4CRZB 1F36A 5AG6A 3CP2A 1GV2A 2XB5A 3KEYA 3EUHA 3HIFA 5FGMA 2L01A 3HG9A 5IP6A 1XN7A 1VFCA 1EE3P 1TKJA 5K5QA 2QQ0A 2K9NA 2RQQA 3BROA 3DU5A 3JRGA 4CGOA 3CO6C 1R71A 1QHHD 1EJ9A 2NNNA 4MEXF 1F57A 2CUFA 5GAGJ 2OJED 3TW7A 3CC7I 1TF9A 4IQ4A 2OZGA 2WAQN 3BTJA 3K2ZA 4UXJA 4PSXA 1P4WA 3I9V2 1F2OA 1T0FA 4DZPA 4ZZLA 2H5MA 1S7NA 1XGNA 2FNFX 1XC5A 2Z9OA 1HQCA 1ZHFA 2N8GA 1ARMA 1QMUA 1S20A 5DCMA 1B6AA 2M0CA 1HW2A 3VB2A 5JM6A 1U9OA 1WJBA 5E8GA 3LSIA 4WXDA 3S9NA 2XKPA 5FLMJ 3CCMI 1WGCA 4X8IA 3VH9A 2EK5A 2FUG2 3IWFA 4LIUA 2KDOA 1CT4I 1VKCA 5D6FA 4EJUA 3G1OA 1YX3A 4U88A 2B3VA 2WYRA 4NXYA 1Q2YA 4R87A 2DPDA 3HGGA 2DI3A 4HF2A 1Y1VJ 3ZMUA 3DU6A 2XROA 3WGGA 5GTIC 1FMVA 2HOAA 3ABUA 2E1MB 4XICA 2FS5A 4DYOA 2XUBA 1BR1A 1FYKA 3F8MA 3QPTA 1AN1I 4A95A 3MQ0A 4I98B 2EA4A 1RTQA 3B35A 2PJ2A 3QNVA 1TGSI 5AGEA 1LPQA 3GXOA 5HMNA 4A3KJ 3EPZA 2P6SA 5CBMA 5GPCA 4KVXA 2M3AA 2ZXVA 2BHZA 3OL0A 4OMYA 2HOEA 3SGQI 4U0VA 4Q36A 4I6ZA 3S1QJ 2CJJA 4KMUX 1CQTA 4XL9A 4H6UA 7WGAA 3MRUA 4OIDA 4ENNA 3KLOA 3NWTA 3OWCA 4HLXA 2D2WA 3BJIA 2V4JC 2COBA 5BPIA 2VQCA 2Z2SB 2PBIA 2XRLA 2LDUA 4F3QA 1APLC 1M8CA 4QSHA 3CESA 2V1DA 2BBYA 2O61A 4XOPA 4EV0A 2H1KA 3FECA 4PK3A 3S6FA 3ZQGA 2CYYA 1MMDA 2I3CA 2IRFG 4UXHA 2MA3A 4LD5A 1VQ4I 3BXMA 2BXZA 4PFOA 1T98A 2L9NA 2KKOA 3KEQA 2KJBA 2Q0YA 4IVNA 2YNEA 3NE7A 2KISA 3O8HA 3PSFA 2CSOA 1KUYA 2HU9A 4QBJA 2PMHA 4R8HA 4CHUA 3LD2A 4G1PA 2BEOA 4MY0A 2ORWA 1R57A 4II9A 2DCEA 3H0GJ 4OAZA 2ISYA 1KBEA 2OOTA 4L9MA 4QTRA 1FYLA 1I39A 1XCBA 3BJ7A 4RGUA 2I8DA 1A36A 3IL2A 1AA7A 4L9VA 3EUKL 4W9YA 2C1CA 4A30A 2PJ8A 3PO2J 5E3RA 1YJNI 3JRUA 4HNYB 3TKYA 3KYCB 3N05A 2QBYA 2C6GA 3S1NJ 2FL4A 3ZP5A 4Z65A 3DPTA 1UHAA 4BHBA 2A61A 1AHDP 1ZH5A 4GI3C 2R7RA 4LX9A 1V3FA 1LDDA 3I64A 3ZN1A 4ZH4F 3FXRA 2AFWA 2ZSIB 2FMLA 3D0SA 2EZKA 3D4UA 1XDSA 5LHGA 4B10A 3LSHA 4AC0A 2VIXA 1SAUA 4QPOA 4A0ZA 3J7AO 1W4RA 2B4DB 3PP9A 4MMOA 3PQJA 4EJVA 2IS1A 3S3OA 5HS9A 1YW6A 3ULQB 1SGEI 1Y8QB 3KZYA 4XOTA 1RUNA 3H8FA 1FP1D 2QQ8A 4M9XA 3QOEA 5D4SA 4DW6A 3CCUI 1QPIA 5EX0A 1Y7RA 2R7XA 3GYHX 3L2UA 2E36A 1Y39A 2K7LA 2N1AB 2R5ZB 1GDTA 2LF8A 2OQRA 1JGGA 4FX0A 4PJNA 4M6IA 2ZENA 4AWXB 4ZYQA 1OCRH 4OADA 1OISA 5D8NA 2FBIA 2ZB9A 3LSTA 3WTUC 4RAGA 2R5ZA 3S14J 2W0TA 5C82A 4CGPA 1IZ1A 3IH3A 5K5RA 2Q43A 2MYSA 4ZYGA 3UFFA 3HUVA 4XPLA 3GFLA 3EETA 1IN7A 4ASNA 3JTKA 2YR2A 4BY7J 1TUSA 4P4BA 4BGDA 2ZXJA 3L2CA 1HEVA 1FMWA 2EFOA 2K4BA 3MGDA 3K4CA 5GADJ 1ARLA 3OXLA 2SGEI 4RLFA 2IBDA 4KVME 2LMDA 4HX8A 3VPRA 3JRDA 1G4DA 1Z8WA 4O6JA 2WZNA 5HNHA 4MTDA 5ILUA 1NUBA 4Q4ZF 3S17J 5KTAA 3I55I 3OS1A 3K4MA 2DA3A 2FE7A 2RREA 5IT3A 1U9NA 1K7UA 1P9QC 1RPWA 2PJ1A 2A20A 1TP4A 2CW8A 2GA1A 1Q1HA 1RR8C 1LFUP 1ZG9A 5LRRA 5F1JA 1W7PB 2C6CA 4L5JA 3PFIA 1TKFA 2IXSA 1TBNA 1FSEA 2HQAA 3VEPA 2KZGA 1LVKA 2SGFI 1G2HA 2O53A 2FA5A 4M3DA 4HV6A 1UHWA 3QAHA 4AMLA 4UXIA 4BUPA 1LJ9A 3GWZA 1UHMA 2L3DA 1G6NA 3ISPA 4IF4A 1B72B 2KP6A 3RQIA 1FAQA 1K4JA 3D7GA 2UUZA 2AFOA 3GKRA 2FQ4A 3BPVA 1AKHB 2V1NA 1JT6A 2WC2A 3KI9A 2FSWA 4ANJA 5DCMB 4FD6A 1S9HA 3BCBA 3R5AA 1QVTA 4NQWA 4WCGA 1ITYA 2Y75A 3H92A 2NVXJ 4FUUA 3PGPA 3C2HA 1LVAA 4Q7AA 2NOJB 3ZR8X 5AG5A 2ZJ2A 3VYSB 4WWVA 2R3SA 3OY9A 2KMOA 4JX6A 2WAEA 4MHDA 2H09A 4WWCA 1PPFI 3H8GA 4B6ZA 4QPQA 2ZW4A 4RAZA 3J80Z 1HOMA 1X2NA 2ETHA 4EM2A 1Z21A 1SFEA 2QECA 5BMZA 4KFCA 2VOOA 3CMEI 2N17A 2EWBA 1JJ6C 2VEZA 2LKXA 4B47A 1YG2A 4BXXJ 5IPAA 3GYAA 3D5RC 5FD5A 1YW8A 4XLFA 3AG2H 2VL1A 2B8TA 1VQOI 3D7HA 4QUSA 4ZY1A 2ELIA 4ZBGA 5LYFA 1FBQA 2AFUA 3V8KA 3OYHA 4OC1A 3OR1C 1FSHA 4CYDA 3KYDB 4UCPA 4YWYA 3H8EA 3OYCA 2WAQA 4OAYA 3PUFA 2EFNA 3DNSA 3GZ5A 4HBLA 3JRFA 4G9YA 3DR8A 5A2QZ 1EH7A 2LTPA 2WAFA 4EM1A 2XAUA 3H36A 1E3PA 2BY3A 3OIPA 2RN7A 4HF0A 2JVHA 3K4JA 4JQFA 4LG0A 4KLWA 5LBQA 1YX5A 3BDDA 3VSLA 4YFKF 4RB1A 1FTZA 2VRWB 2ZW5A 5EBVA 4CCJA 5FKKA 4GXOA 2OZUA 4RS8A 4Y13A 3R5CA 1KZFA 2GANA 1UAAA 3RZAA 4CAFA 4HSRA 3GUXA 3G3SA 3OMYA 2V6CA 2E5ZA 1K4SA 4KDPA 1H8AC 1XOVA 4E1RA 4HKFA 1MSFC 2Y9YA 5JHWC 3OL3A 1ULKA 4H2KA 1KU9A 4P55A 4EATA 2D4PA 1WCMJ 4YG2F 2X6WA 2B7EA 4ZYAA 4A6DA 1EKEA 1WRJA 1T6SA 1J7KA 3E6DA 2IEKA 4E7KA 5G21A 4BS9A 2P6EA 3QP6A 2H8RA 1BM9A 3FXMA 4YRHA 4AVAA 1QO0D 2IGMA 2JZYA 3KY9A 2ZEEA 3KZIC 2GXBA 2B58A 3PDNA 1IN6A 1MH3A 4Y7NJ 4YIFA 4HA8A 4A3CJ 3PB4X 3F23A 3KR5A 3FXOA 2GAUA 4LFUA 4XLPF 1IRZA 2XRCA 1B1BA 1S5KA 3QB8A 4MFQA 2NYXA 4NFRA 3RAMA 3E6BA 2XF7A 4GRIA 3VWBA 3IEHA 1TF8A 3J7ZI 2XEIA 3K10A 5JH9A 3K1PA 3QWLA 4MFKA 3KP3A 2X6XA 3P9IA 2L9RA 3IRQA 2Q4VA 3Q0UA 3SEZA 5HNFA 2B5GB 4U7DA 2F5EA 1G3YA 5FUWA 1YK3A 3KQXA 2WY8Q 3RPQA 3RZDJ 3WABA 1CGII 1SGQI 1BR2A 4IOCF 2ZEMA 5KTDA 4MEYF 2QQEA 2ZEHA 2WTEA 4E7SA 5FUVA 1YSJA 2X48A 5GP9A 2LBFA 1UG0A 3KP2A 1B8IA 5KVRA 5E8IA 1SD4A 3PB6X 4UV9A 2YU9J 1BPMA 4HDVA 7CPAA 3S2WA 3ABTA 4MCPA 1TURA 5JVGF 1XG1A 3L1PA 4LG3A 1QNTA 3D5LA 2DK8A 3KP7A 4UUTA 2XPWA 5CPRB 2L0KA 5KK1A 3GLJA 1Z05A 2VPLA 2MH9A 1WPKA 4FASD 2LLKA 4G7OF 1JE8A 1IIDA 1YE9A 1JKRC 1J9IA 3Q9SA 3SEQA 4XLNF 1JUMA 3RQ4A 1X1BA 2ENZA 4ENKA 2ME6A 1TKHA 3V4GA 3CUQB 1CPSA 4FBEA 1KONA 4KZTA 2VJ5A 3CQZJ 5FKLA 5FRNA 1FOXA 3DBHB 5FLVA 1BJZA 1UMQA 3LMSA 4CYOA 1P4AA 2UZKA 1I1DA 4OAEA 2XRNA 2DDAA 4AIKA 1E3OC 1Z6TA 5DD8A 1SVOA 3QYEA 1ZLHA 3HSFA 5IP9J 2LEOA 5F09A 2VN2A 5D29A 1IRGA 1SGYI 3IGRA 1PUEE 3GTKJ 3LAJA 2HZDA 3DFGA 3WGHA 3FJUA 4ZX9A 5EG0A 4ENJA 4FWUA 4LUAA 2CJSC 4OIPF 1BOBA 2GZWA 1XJOA 2ELJA 3F0AA 4HPQA 4EFDA 1BJAA 1ZLKA 4A3DJ 2GBYA 4PUSA 1A31A 3PNVA 3Q5FA 3L9FA 1JWQA 3ABMH 1MBKA 2LY9A 1UFMA 4CICA 1S5LC 5L3GA 2JEWA 2M7AA 2WGCA 3IO1A 4FAIA 4IPAA 5M3FJ 4FX4A 1HEEA 5IB9A 1OQYA 2WADA 1ULMA 4OIRF 5AG7A 3IAM2 1YI2I 1VGYA 1I1GA 1AUGA 1Z1DA 4HRIA 3D2MA 4IAVA 3JR9A 1LANA 5DS0A 4CPAA 4BBRJ 4YFJA 2X9DA 2L7MP 1UZCA 1WI3A 4HG2A 3JRAA 3R96A 3I4NJ 2GWRA 3LSRA 2LH9A 2NSMA 3ZQFA 3ZQLA 3ZRGA 1CSOI 3RJPA 5DS9A 2PLYA 2EVNA 4HNWB 2PIZA 4B12A 4IOAF 1TIHA 3DGVA 3ROUA 4BQAA 3S2HJ 4IRIA 2ELHA 2R93J 1CT0I 4OINF 1LRZA 4X5KA 1T08B 3DDDA 3BZCA 1SFXA 2W25A 2Z1DA 1D3YA 3BR1A 3HB9A 1MNEA 1U78A 1OYVI 1W36D 3HKZA 2V8HA 1TT5B 2F5CA 1WFXA 3LA3A 5JHUA 2BSWA 3K9TA 4R1HA 4F91B 3MEKA 4YRVA 3IRRA 1IICA 1S7KA 1P6RA 1BI1A 2W4SA 3K4KA 2QKLB 4O3MA 3HOYJ 3T0YA 4LLNA 2ANPA 2RIJA 1HSTA 3E5XA 2O6GE 3HC7A 2KRFA 2VQHA 1EH6A 1VHSA 1SFUA 1AOYA 3LSPA 3KHXA 2HI3A 4A5NA 5F48A 3OYKA 2FRHA 3GTGJ 4AYBA 1D0YA 1YR0A 4U87A 1IV6A 2VLAA 5KAFC 3T8WA 3CDXA 1EA3A 4A3EJ 2BL1A 4NJRA 3OIOA 5EGOA 5JVTA 5LEKA 1FNNA 3PNTA 2MD5A 3HOZJ 4C7HA 3FXTA 2DXQA 3KX2A 3DTEA 1HDUA 5E3PA 5K8MA 2G9DA 4MCSA 4XORA 2XSDC 4L0ZB 1OMTA 4C2TA 1M4LA 4PQAA 3NFZA 4AVBA 5FROA 1PUFA 3WU2C 2AXTC 1W36C 4XBFA 2CH0A 3T8TA 1HW5A 4ZYEA 2E60A 3C2BA 1YQEA 2K9QA 4IJAA 2Z3OA 1K61A 3CO7C 4M6GA 5H6QA 1VQMI 3DR6A 1XMKA 2ZMEA 2RQPA 4A3BJ 1X4SA 1J0RA 1Y8RB 3CF5F 1LAMA 1G3SA 2FOKA 1CF7B 1F5TA 2PFBA 3WE3A 1WQ2A 3CDLA 2OC6A 4IL6C 1BIAA 3LQQA 4V2GA 4WXHA 4XKWA 4JP0A 4BQNA 2V8GA 2Z11A 1XGMA 1XMBA 2EK9A 1HF0A 1IOIA 3G8WA 3FWEA 2P0WA 2V6EA 3O8GA 1O3RA 3GY9A 2P7VB 2HV2A 1HKSA 5GPAA 4Y17A 2IJZA 1IW4A 4P45A 2GVIA 3KETA 3HUGB 2L4MA 1TWFJ 2HXOA 4KORA 2QQAA 1Z8TA 4PCQA 2JMWA 2R92J 2JK3A 5GCNA 1P4XA 2R7DA 5D4RA 4H0EA 4W1UA 3FHZA 2BEIA 4QIWN 3G4SI 2OV7A 2ECCA 3BG6A 4LOCA 3PUBA 5AIPA 3AL0B 2OZHA 3KHZA 4FETA 4ZYDA 4MY3A 1Z9CA 2A5WA 1SD6A 3OYMA 1YHQI 4IK2A 3FVLA 2DU9A 2F4IA 1X1PA 2X6YA 1W3SA 1FNOA 4RM2A 3FXLA 3UKGA 1UHSA 2WPXA 4IHWA 1YMEA 1HA8A 5FKMA 2ZMEC 3E1SA 1RO5A 2DA7A 3M8FA 3EYYA 2LSOA 4XQFA 1MGTA 4G7HF 2CY2A 3W6SA 2LOOA 1FJLA 1PCEA 1TBOA 4PDKA 3M1EA 2V1CA 5DYMA 3FRMA 3MAJA 3V8JA 1IDYA 1TOTA 5K1YA 3ECOA 5CCLA 1ZARA 3UR3C 3F8CA 2GOMA 3SYTA 4ESJA 4MJ8A 3D66A 1PDNC 1UWYA 2AFMA 2Z5UA 1IG7A 3V7RA 3IJ3A 2FCKA 4FD4A 3KZWA 3LSKA 1TQPA 2P6TA 2O4HA 2JYYA 4ZJZA 1V55H 2KMUA 3WTXC 4B5PA 1IAWA 1DS3I 2HKOA 1KUXA 1FT9A 1YS6A 4KOUA 3QPLA 4RM3A 4L9TA 2EFWA 1JKPC 2JBKA 2JUGA 4ESFA 2UXNA 1N71A 2LRDA 5CYVA 1L3LA 3K6GA 1MBGA 2MBFA 4R3LA 3P9CA 3TP3A 2J5OA 1XBUA 3B3SA 5JFRA 2D5VA 2XC7A 5B1BH 3W6VA 2ZW7A 3F5BA 2X0LA 2O5RA 2W85A 4R79A 2DOFA 2KMQA 2ZELA 4A94A 3MKLA 3C26A 5H20A 3S6GA 3MZ8A 3ZMZA 1JJ8C 1ORKA 4UFWA 1X2MA 2QENA 4XSXF 4CYCB 2CV0A 2ECBA 4PGGA 2QVOA 2ESHA 4MHYA 3J81K 3QU3A 3VDPA 2VASA 3WC6A 3HH2C 1ELMP 4B1RA 1RIOH 2DQRA 3OVOA 4Y4RA 1FOKA 5E1WA 2MLKA 4CCNA 5DEQA 4FE7A 3FISA 1T2KA 2DPUA 1SGNI 2EZHA 2IA1A 4ZY0A 5M5WJ 4BJ5C 3FXKA 3KE2A 2JPCA 1ETXA 1HXDA 1R5GA 3FDYA 4RGXA 1ZREA 4XNHB 5DM7F 3JSOA 4ENMA 2Z3LA 1RETA 3HLPA 1B59A 1YIOA 3ZQHA 3A03A 1XBTA 2OTLI 4LQ6A 2E34A 4AM3A 1ZRDA 1QPMA 2M34A 3TJQA 2P6FA 2DA1A 2HR3A 5H2FC 2PJ7A 3CXQA 2ID6A 2Y69H 1NXUA 4BQOA 1VDDA 4BXFA 4F0XA 1U6MA 1E3HA 3R95A 3CC2I 2VJJA 1Y9KA 2PJ9A 3SHFA 3L7WA 4EWTA 2B9SA 1VQ8I 3WODF 3G71I 5F64A 1P7IA 4A3LJ 1RESA 2PVVA 3IFEA 4KVOE 2WB1A 5GAEJ 4XRSA 1BUSA 3KP5A 1NSAA 2ZNZA 2FQ3A 2KLOA 4DIQA 4JXQA 2TCTA 2VI7A 3ZCOA 1D0ZA 4XLHA 2DPSA 4U7BA 1ZGWA 2JW6A 4M71A 3ISXA 4P44A 3E5UA 1MBHA 1UCRA 1ZG1A 5TGTA 1Z4RA 1OCTC 1HC8A 3D68A 3BLNA 3Q0WA 1Z2IA 5BS6A 1JXSA 4M74A 3DXJF 3LSJA 3OYBA 1PP8F 4L18B 2HB6A 3OS0A 2O9LA 2B0UC 3S6HA 4P10A 1WHUA 4EGYA 5BWAB 3BR6A 2ZFWA 5FUYA 2EPFA 1FYBA 2G0EA 1E2XA 4AUXA 4SGBI 5LHHA 3CLQA 2HVRA 2PDOA 2L5QA 2Q4YA 4A39A 1IRXA 1TQIA 4M73A 3CJTB 1P7JA 3ESWB 4C7IA 1DDNA 2QQCA 1ZRFA 1RXTA 1WJCA 4OOIA 5IYBJ 5IV0A 2XB0X 1S7FA 2CGPA 3HOUJ 2HQYA 3B3CA 1OCZH 1XX5A 3K4NA 4A5MA 2KFDA 4ZY2A 3P7NA 2DK5A 1X74A 1FOYA 4IF5A 2HZTA 4E7HA 1XIXA 4RMNA 5G1ZA 3T90A 8CPAA 2JJ7A 2ZXHA 3ASOH 4QLCU 1Z7LA 9WGAA 2OH1A 3H1CA 4LB6B 1ULYA 2CNSA 2LY2A 1POGA 2W48A 1QZEA 1XGSA 2XPUA 3RZOJ 1I1SA 3DLJA 5M5YJ 3SJMA 3L2WA 1KBFA 2PJ6A 4RBOA 1X58A 5HDGA 2EQRA 4IRHA 1YJWI 5HH1A 1QGPA 4A2ZA 2WA0A 4ON0A 5JQ4A 1MMSA 2QSFX 2ACJA 3WC7A 2WY7Q 1IUFA 4NC8A 4D7NA 1B4AA 3M1CA 3G1LA 2G7HA 2A3SA 4DQ2A 5HDNA 2O7OA 5F0CA 5TRDA 3JSPA 3WR7A 1FT7A 1Y0UA 4RI1A 3QU6A 1ONVA 2LR8A 4ZZDA 2XAFA 3S9LA 2EJRA 4OMZA 1X3UA 3N97A 1WZ2A 2Z3KA 4KN4X 1OYIA 1PYVA 2A05A 6PAXA 1TBXA 2K9LA 3BJ6A 1XGOA 2FBKA 5E17F 4DJAA 1D5YA 3I5UA 3H5RA 2OZ6A 3KIOA 2JWTA 3QWPA 5KHDA 3HOVJ 3AFHA 4IZZA 3KL9A 1Y56A 1QVUA 2SGPI 1YTYA 1LCPA 2HS5A 4DYQA 2W24A 3FBIB 5L3FA 4CGZA 1WKXA 2QQDA 1OVOA 3O3KA 1CM0A 1J4JA 2M30A 2BY0A 3ZQIA 2PJ5A 4OC0A 4CS0B 3IHUA 5HOOA 2K02A 3HYIA 4UFXA 1YRNA 1YU6C 4CGMA 4PZJA 5FFXA 3J7AY 3SZGA 2PJ0A 3LACA 5H6RA 4P96A 5HVQC 1Z5RA 3TOBA 3F8BA 3GTMJ 3U2RA 3COAC 1GV5A 1T95A 2R7FA 1PUAA 2IS6A 4R57A 3RNZA 5F1RA 2M4GA 2DLLA 4Y3OA 2GA2A 2DA5A 2MH2A 1SGRI 4HZFA 1FLIA 1R7JA 2WBMA 3LAPA 1SAXA 4A38A 1SANA 2MABA 1O3QA 2DYRH 3UNGC 4JD6A 3I4PA 1GXPA 4GO1A 3KPHA 3NWSA 4J00A 4UIBA 3MVPA 1LOKA 2QVPA 2NS7A 2PR8A 1ETKA 2CUJA 1R58A 2FBHA 2EV6A 1ZELA 2Q2EA 1GHCA 4UEZA 5JI6A 2MC3A 2ZEOA 3BZ6A 4BACA 3B7IA 2LKSA 4G6TB 2KDZA 2FNPA 2P5LC 4TWEA 1KU2A 2RFHA 4IRGA 4KOVA 2BHYA 2P4WA 2ZJRF 4KOSA 2EFQA 2MGQA 3S15J 3GTPJ 4MQ9F 3KASA 3E6MA 4OC3A 4BMHA 4GYIA 1Z6RA 2LP0A 3HOWJ 3T9YA 1Q2DA 1BI0A 3A1YA 3KP4A 4C3HJ 3HPGA 3S32A 3K70D 2ELKA 1QRYA 3RKYA 2NVQJ 3GFJA 1V5GA 4NF1A 1P4NA 4HNTA 1MZBA 3CP8A 4U0YA 1I50J 5CNPA 4F9VA 3PO3J 3B3VA 1SGPI 1GXQA 4MPIA 4HEA2 1FEXA 1IY5A 4OWRB 4PPZA 5ERIA 3D7FA 2DA4A 2VBWA 3JCUC 1KQ8A 2R7WA 3WTZA 2XGDA 4A0XA 5D5WB 4MTEA 1IDZA 2QMLA 2JUCA 1O7LA 1YS7A 3WTSC 3D2PA 5F0FA 4P9UA 5EF6A 1YGHA 3I56I 3UY5A 1I3QJ 2LUYA 5EC4A 2CFOA 3ZMTA 3PM1A 4L9NA 3R0AA 4IX7A 1D0XA 3FMSA 1X1DA 1JT0A 1LNWA 3NAUA 2WWYA 1OR7A 4XMYA 3RKQA 1Q7LA 4B8XA 3BJAA 4JK1X 1IXCA 3NQOA 1BC7C 2EV0A 2P7CB 1N78A 1HKTA 1XX6A 2J9RA 4NC6A 4KITB 5LGTA 2GFQA 3ZMSA 1M1EB 1F4KA 4I02A 4HQEA 1TL8A 1CGJI 2KIFA 1R9TJ 4OIWA 4Q47A 5BQTA 2FMYA 4IHSA 2L7KA 4RGSA 4DBRA 2LVSA 3L09A 4D7MA 2XGXA 4KT6A 4CYCA 1TC3C 4M3SA 4MHNA 3OXFA 3FXJA 3VWEA 4XPDC 1H9GA 1W5SA 1YYVA 4C2XA 2YGWA 1XD7A 3H3UA 3S3NA 2COMA 4NGRA 5I4MA 3C18A 5D5XB 2PX9A 5FKNA 2E73A 2JDDA 4CAWA 3ONQA 2HXIA 2P5KA 1QA6A 1OLTA 2PRBA 1LDJA 1LFWA 2XDVA 5TJJA 2PRQA 2DOEA 3HPHA 2YU3A 2J87A 4MIMA 3HRMA 4ZTFA 3JW4A 1QZZA 3QP5A 3NEUA 3BTCA 4XLCA 1W0UA 4EMEA 4HLYA 2MFZA 1LDKB 4HPSA 5THWA 4U5YA 4CO8A 2HYGD 2F4OB 3ELKA 2ZMEB 4FT8A 4XRFA 2ZSHB 1Z8XA 3CPAA 4MI4A 4C9YA 4HQMA 2V26A 3NRVA 3PFYA 5IT9K 2QQBA 3C1DA 2QKMB 3OYNA 5ILSA 5LGUA 3BPXA 3RI4A 2M45A 2PVWA 5LD2C 4YGOA 1I27A 1XSDA 2DPTA 5A2QK 1K4TA 2W7NA 4M6YA 4N4OB 2VT3A 1NE9A 1MW7A 5B3SH 4L8AA 1XTAA 3I3LA 5H86A 4Y49C 4Y49B 3S9MA 2TDXA 3FIWA 5CVVA 1JQGA 4KICA 4IEJA 4BHCA 3HUGA 1B72A 4RGRA 2PR1A 5ELYA 2JA1A 4B43A 2O8KA 4UB8C 3VYRB 3FK7A 3QTLD 1S7AA 4Q48A 3ISZA 1AKHA 1F1ZA 2FOWA 3QOPA 3SFZA 3TE4A 3R6SA 2PJCA 4AIJA 4B4CA 1FC3A 1TWAJ 2FX0A 3M8JA 2P5VA 1LEBA 1Y6IA 4A37A 3K0LA 1CG2A 2F5IA 1JUSA 1TTYA 2NVYJ 4ONWA 2DMPA 3W6JB 4U0WA 3X2QH 5DUKA 2CTCA 1XE4A 1YIJI 2V9KA 1ZYRF 4E4HA 4UA3A 2HDDA 3GBGA 1U5TC 1J75A 3WTTC 3LWUA 5LRSA 4BDZA 2V53A 3RYOA 1BW6A 2Y48A 3TT2A 1TXRA 3GEZA 3BTIA 2X51A 2ARPF 2LK2A 4F93B 2YNCA 3ZZIA 4NJQA 2EBJA 3D8PA 2XAGA 2PJ3A 4V2FA 2DJNA 1VZ0A 3LA7A 1IO2A 2I10A 4Q5SF 3CZXA 2HOSA 1CF7A 3A9LA 2CWHA 4YFXF 3QYFA 5BNGA 2F4MB 4PGHA 4NGNA 2JRTA 5J4YA 1IGBA 2ZW6A 1F43A 3T5XA 2F48A 4F52A 1YO5C 3KLNA 1MMAA 1O57A 2KQRA 2PI0A 1HLVA 3RU0A 4S0HB 5E3LA 3G73A 4ZGYB 4X0GA 2CW7A 1S7EA 2NAZA 2L4AA 1R5HA 1KGSA 2V7FA 5L3BA 5M3MJ 3GF2A 3RYPA 2LFBA 1YITI 3IC1A 5JHFA 1K78B 3S8PA 1NK3P 2AFSA 4CXFA 4KOXA 3I59A 3RKWA 4BE2A 5CVRA 4MRIA 4Q38A 3ZN0A 2EWNA 4B14A 5CQEA 2REEA 2DFIA 2RC4A 4B13A 4IHXA 4QB9A 2OD1A 2FXFA 4IQJA 1R23A 1XPXA 3L2VA 4JX4A 3HOTA 4M3FA 3LWFA 1XMAA 3JREA 1MMNA 1IOFA 2XIGA 1NG7A 3IP4B 2X3TA 2G3AA 2C6PA 4BINA 5CKTA 4KSAA 2X6OA 3W3CA 3TO9A 2PMUA 1WJAA 2ISZA 3EYIA 2GREA 1IYLA 1ETOA 1A04A 3F6VA 2F6CA 3BC8A 5CLSA 3ASNH 3WE2A 4L0YB 3HZJA 2J9AA 1DP3A 2E1NA 5D8KB 4ZDPA 3A01B 2K9MA 4IUSA 2FJ1A 4UF4A 2OR4A 2F5DA 1I6XA 4P5OA 4WJBA 2PJBA 4QVTA 5ICEA 4UVCA 4BEHB 2REFA 5CVJA 3FKJA 1ODDA 3IKVA 1S72I 2HEOA 1WJEA 4CZZA 4NGSA 2GE3A 1YLOA 2CQQA 2Z99A 1IC8A 2MG4A 2Q44A 5LRKA 4MCQA 1Z7KB 3B4VC 5TISC 3HHGA 2DMNA 2L02A 2ME0A 3FEEA 4AD9A 3F9KA 3VODA 5D5VB 4CRYB 4RLQA 4UWJA 2E19A 1HPTA 5IYCJ 2QBYB 1QU3A 2GKTI 3MKYB 1YOVB 1DGRM 4P4EA 3R1KA 4AG7A 4NHJA 2H27A 2DFEA 4HGUA 3FX6A 4Y15A 9ANTA 3DEWA 4E70A 4FCYA 2E71A 2DT7B 2K86A 3JUWA 1Y0RA 3FK6A 2P8TA 1ZLJA 3FC3A 2MW8A 3FHNA 3H0DA 4FE4A 3CCSI 1Q9BA 3G3ZA 2HYJA 4E8OA 2IVMA 5B5EC 2CIJA 2Z3YA 3G1MA 2J8MA 5K5OA 2CNMA 4UBRA 3FIXA 2WCYA 4KOYA 3EFAA 1TWGJ 2DFFA 2M4KA 5FLXZ 3CCVI 2QSGX 2BO9A 2DFHA 2EIMH 2KIMA 1YREA 4E2AA 4XM3A 1BLLE 5C3EJ 4C68A 4HNVA 2DT6A 4ZC3A 1R0RI 4NC7A 4NSQA 2VBZA 3RYRA 3B3TA 4R9MA 3RKXA 2XGCA 3SXNA 3JRIA 5ICGA 3PBEA 3H9GA 1K7VA 3IU2A 2JN6A 1O3TA 3IH2A 3WTWC 2FSRA 1R00A 2EBIA 1SEUA 2LF7A 2NS0A 5FVJA 4MFLA 3D67A 3QAYA 1XS9A 3NARA 1XMXA 1XDUA 1T39A 1Y8FA 4BKXA 4C2MJ 2EUIA 4OC4A 3OS2A 4XKCA 2JQ7A 1Z3XA 1CE3A 1U0JA 2PE3A 5M5XJ 3F8NA 3SI0A 3RSNA 4BJ6C 1MBEA 5EG0B 1BI3A 3OYGA 1WJ5A 4GDFA 4RDUA 5IYDJ 1YW9A 5J4VA 5DAEA 2BY1A 4NDLA 2J8NA 4CCOA 2B4DA 1HJAI 2WPWA 5BPDA 2P81A 2NNYA 2L9VA 2PMZN 4LLGF 3A2KA 3L00A 1GT0C 2HQRA 2JTVA 2VJIA 4IXAA 1FZPB 4MHGA 2B63J 2ZOGA 3DP7A 4IHMA 2OU2A 1FX7A 1R4NB 2XAHA 5L3CA 2DMTA 5CVUA 3CCEI 1VQKI 4UCMA 3HOSA 2A6EF 4CYNA 2BZTA 2GIZA 3MWMA 5LRGA 2Q8KA 1DGWY 1BMOA 4CGNA 3B8GA 2RAEA 1FARA 1IN8A 1VI0A 1SGDI 4XRSG 4DYCA 3FEDA 1XSVA 2DYSH 3I71A 3MN2A 1K7TA 1M8BA 3WGIA 3T8RA 3MD2A 3JTGA 4B5OA 4P6YA 1HDLA 1D8JA 2LY1A 4A3IJ 2CTBA 2Q7BA 2ZO4A 2YSRA 3ZQ7A 1JUPA 2A5YB 2RGVA 2R98A 4F9UA 2YS9A 1WI9A 2HPIA 1KUVA 3M8EA 1YLEA 5AONA 2JSPA 2LYCA 3PSIA 4UV8A 1BL0A 3BR2A 4KYWA 1BI2A 1VIXA 3BI0A 2WV1A 3GIUA 4P9FA 4EMSA 2LD5A 2E5NA 4BL0B 2VXKA 2VC0A 5F49A 4YEJA 2AQEA 4KT5C 2HQ5A 2KMPA 1KU3A 3RPUA 4KLVA 3RDIA 2ZNYA 2ICWG 3TP0A 2IS4A 3C2GA 2HQNA 4S05A 2OQGA 4E7IA 4PK2A 3MMYB 3PRTA 4XN0A 2IGOA 4E7ZA 2V9VA 4B11A 1OKRA 4MFJA 4IHYA 4G12A 3G2BA 2VXDA 3WHBA 2R1IA 3H3ZA 5E96A 4XPDB 2DDBA 4EM0B 2OCCH 2GKVA 5DM6F 3GOXA 3V7SA 3WHCA 2R7OA 1GHEA 1KZHA 4M3EA 1M4IA 2L2OA 1TWCJ 4BXUA 1QSOA 3CXPA 5HVGA 4N9HA 4HAMA 5LYLA 4YELA 2RB7A 2XPVA 1HCRA 4C2YA 2B5GA 2K3FA 4C3JJ 3FYNA 2IGNA 4IHVA 1SD5A 3ZQQA 4F55A 3B6AA 1IY7A 3OL4A 3I1UA 4UUVA 4FQGA 2BV6A 2E1OA 2VC1A 2LBFB 1JHFA 4YFNF 1XF8A 1IN5A 1Z91A 2M0MA 3CZ6A 2L54A 3HTSB 5JLWA 2R5YB 3BOQA 2XEJA 4PXCA 4NUBA 3SJFA 2I5UA 2VQYA 2K40A 5E3QA 5FO5A 3LODA 2Y0MA 5IT9Z 1ZG3A 1J5YA 2K85A 1ZQ3P 3SHPA 4CYPA 4KMFA 2K4JA 4GXHA 2Q4ZA 2X85A 3BLYA 1SFOJ 2NMTA 1FBSA 2Q04A 1IRFA 4NEXA 1NSLA 4DNCA 5B66C 1YRNB 4CSWA 5E18F 1ZG8A 3TOAA 1C0WA 3I59B 4NBQA 1KMAA 1AMPA 1MJBA 2OF7A 5K8NA 5EEHA 1RRJA 2L8EA 4G8XA 2N71A 3HKZN 2DA6A 4MO7A 2Y0SN 3ZXSA 1W5CC 1XB4A 3GLXA 1OJLA 4I0AA 2WB1N 1AU7A 4GS4A 3FKIJ 3OIQA 4PXDA 1TW3A 1U3EM 4AU7A 2OA4A 4NNJA 3WU1B 1RR7A 1U2WA 1X19A 2AHQA 2M87A 4E7LA 2E1CA 3Q3SA 4KIBA 3RCOA 2JA5J 1Q2CA 2G7UA 2K9SA 3OXGA 3I4MJ 2R7TA 3B3WA 3NH8A 4MBUA 2ZBKA 2F2EA 1BW5A 2C27A 4EQQA 2CF4A 1R36A 2IPQX 3OYFA 2IS2A 2VQGA 2YQPA 3EY5A 3F3XA 2V79A 4KA4A 3KCCA 3CUQC 4PXBA 4B6DA 4CA0A 5IOYA 2DBBA 1P9GA 2VKDA 2V77A 1PTQA 3R5DA 2CS3A 4I99C 1Y7EA 4M3GA 2D45A 5C4XJ 4UY8I 1OYWA 4EJWA 1E17A 2KZVA 5E3NA 2DTRA 4M3BA 3CCJI 3O6BB 4MGRA 1USTA 3HOXJ 4OIOF 2M2EA 3R60A 4JBAA 2V9PA 2M7BA 4NGPA 4UEFA 2JRMA 1DE4C 3TX8A 4H89A 3M07A 4EJOA 2R8VA 4KNYA 1WJFA 1XCVA 2E1MC 5HLHA 5DWMA 1W1WE 2DJIA 5HI7A 1XA6A 1TQMA 3N7ZA 5LYDA 5ICFA 1KYWA 2DN0A 4BE1A 3BZKA 2BUEA 4BBHA 2OCEA 2VBQA 1S3ZA 1H0MA 2PJ4A 5FLXK 5ILVA 4UVBA 2F3CI 3K69A 3CPXA 3D00A 3H9QA 3V38A 4FD5A 1BN5A 1I6HJ 2JSCA 3LL7A 1ZTRA 3W2AA 3IWGA 1S29A 1WGXA 4II2A 1WSUA 4K2EA 3LQRA 4F6AA 1FWZA 1G3TA 3CJQB 4N4NB 4WXCA 4KSIA 1LUJB 1H0ZA 2BGCA 2BYVE 4CZCA 2PJAA 2A68F 2O3FA 3U21A 1QSNA 4ABZA 2H1LA 1MBFA 6CPAA 1IV8A 4P4DA 1CPXA 2RKHA 2XAJA 1B87A
chains in the Genus database with same CATH topology
2WV0A 1S3JA 3FM5A 1SMYF 5DUIA 4CAVA 1MJ9A 3P2HA 4UVAA 2IT0A 1Y9WA 4OLLA 1OPCA 1FPQA 2CFXA 2VZZA 5LGNA 2W57A 1YFHA 3FM3A 3GFIA 4HX7A 1QSMA 3J80K 1PU9A 3DEUA 2PJPA 1MJAA 2HTSA 2LKPA 2G3TA 4E0AA 2KJCA 3AAFA 3JAMK 4LB5A 1YW7A 1V4RA 4KUAA 2I00A 1B9NA 1OYYA 2DQLA 4MQVA 4QWQA 3H4QA 5F47A 5FB2A 3R9GA 1GVJA 1IB1E 2Z3PA 2MLGA 3I53A 3U1DA 2IJLA 3MFKA 3HSEA 1QSRA 3D3SA 4WF2A 2V1UA 4ESBA 3KFWX 2DT5A 5F46A 2QIRA 4CAEA 4C2ZA 5J8CA 2XKOA 1ON0A 2J5PA 1R22A 3VWDA 2OBPA 4GGGA 3I0TA 1XEBA 1KQ0A 3TO6A 2VBYA 4ORFA 5IX3A 4KSFA 3R4KA 4KUBA 1O7FA 2QLZA 4UXNA 1K7AA 3F21A 3B73A 2H6BA 2CW0F 3TFYA 4L89A 1P2FA 3IWEA 5D5UB 1RZ4A 2M1BA 1U8RA 4H6ZA 3F6OA 1F9NA 4GCVA 1K78A 2K5TA 3JAMZ 4BAYA 1Z9UA 5ISVA 2JDCA 1SQHA 2YNDA 5L3DA 2EV5A 4MNUA 4JWPA 2AJ6A 2I79A 3M9AA 4I0BA 2M5WA 2YX7A 2FT0A 4XPKA 4I2OA 2HTJA 3WTVC 1I5ZA 1FYMA 4LMYA 1MDMB 2G0BA 2OAZA 1MDMA 3DF8A 2EFPA 1FP2A 3N4MA 1QSTA 4GYGA 2E7WA 2OD5A 1D8KA 5D8LB 3JTHA 3MEXA 1DPRA 4U9ZA 2JPBA 4RB3C 4CYQA 3SQNA 5DWNA 2D1VA 2XASA 4G7ZF 1M4DA 3EO4A 3V8LA 3U9GA 2STTA 1S7OA 5LEJA 1YVOA 1W7PD 2DO7A 1OZPA 1QZYA 3J81Z 4KIGA 3IC7A 3GVAA 1V0CA 1S7LA 3FMRA 3BY6A 2CG4A 4G94A 2STWA 2FEZA 4KS9A 1W4MA 1WWZA 3ZJ0A 2KIUA 5C88A 4PSWA 5JPHA 3CTAA 5EEGA 2Z0ZA 1IN4A 1R1TA 2OB0A 2RVCA 1XSXA 4RB0A 5D6EA 3KEOA 1H9TA 5LHIA 3M7GA 1B6BA 3JVNA 3FX3A 1UB9A 1EH8A 4B5PB 3HRSA 1YX0A 3P2FA 3EXNA 2FE3A 4M85A 1W5TA 3BP8A 4UCNA 3B02A 1K79A 3PQKA 2PG4A 2VOPA