3TO6A

Crystal structure of yeast esa1 hat domain complexed with h4k16coa bisubstrate inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase ESA1
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transferase inhibitor
total genus 80
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to6A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to6A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to6A02
1BOAA 5HMNA 2HS5A 1REPC 2FMYA 4M71A 1PUEE 4AVAA 3GYHX 1QSMA 2MLKA 5A2QZ 2IW5A 1K7AA 2BYVE 1LEAA 4TV7A 3WTXC 1U5TC 4JK1X 4EMSA 3C1DA 3I53A 1RIOH 4B5PB 5DWNA 1WRJA 4NEXA 4AIHA 1O3SA 2JTVA 3GEZA 3DDDA 4EGYA 5FO5A 1V3FA 3L7WA 1DDNA 5HS7A 3FNCA 4G94A 5KK1A 4ENNA 3CUQC 4CGZA 1YK3A 1MZBA 2P0WA 3G3SA 5J8FA 2P7VB 4YIFA 2EA2A 2ZO4A 4AIKA 1HKSA 2GIVA 4M85A 4I7HA 2LSOA 5HLIA 1FYLA 1B59A 1KUXA 2DTRA 1PDNC 4KA4A 1G3TA 1MGTA 4MY0A 3DR8A 4HKFA 2XRNA 4L9JA 1XMAA 2KIMA 1G3SA 5F47A 3T8RA 4PGGA 3R6SA 2VBZA 4RGUA 1OYWA 5FD5A 1YS6A 2L02A 4QBJA 4HBLA 4MHDA 2PN6A 5DUIA 3LFKA 1VHSA 4R3KA 4XPLA 3FXUA 3ML6A 3JAMK 4JXRA 4M6YA 4ENKA 1G6NA 1XE4A 3IWFA 2VN2A 3R9GA 5F49A 3KP3A 4I0BA 1BBYA 4J3GA 5E96A 2VT3A 2HQRA 2HWVA 4KVXA 3BZ6A 2E1CA 3SFZA 1IXCA 1KUVA 3E5XA 2PG4A 2H6CA 5HLGA 1QSOA 1U78A 2K4JA 5DCMA 4EJVA 2EFPA 3HTSB 1SMYF 2D1HA 3I64A 5KTCA 4BAYA 5IB0A 1R5HA 2DXQA 4DNCA 2G3AA 4N9HA 3ZMUA 1ZLJA 1SAXA 2D4OA 3RYOA 3JW4A 4KORA 2OB0A 1S60A 3HRSA 2V6CA 4ETSA 5D6EA 2HTJA 3ABTA 3FM3A 2L54A 3Q5FA 4CRYB 1TNTA 3T5XA 4ZYGA 4M9XA 5ICFA 2PI0A 4FD5A 2QM3A 1W7PD 1WQ2A 2ESHA 3B73A 4GCVA 5JR3A 1IB1E 3RI4A 3GF2A 4KOYA 3EXNA 4OMYA 3TTHA 5IT9K 3WTYC 2EK5A 2QIRA 1TLHB 4L0ZB 2EWNA 1S6LA 1F9NA 2HFHA 2IA0A 4WXHA 1FZPB 4G8XA 1XF8A 4E2AA 2NS0A 2CWEA 4UUVA 4HAMA 4HLXA 2QQ9A 2IP2A 2PR1A 3E6MA 4D0PA 2Y0MA 2FIAA 2ZW5A 3R9FA 4UVAA 3EDPA 1MKMA 3GZ5A 5J6XA 1FY7A 1I1GA 5L3CA 3MGDA 4UWIA 2QBYA 5DEQA 1OZPA 2UWMA 1J0RA 2MA3A 2CY2A 3R61A 2CGPA 4LD5A 2ETHA 2RDPA 5DCFA 3LAPA 4WCGA 4KFCA 2XAHA 2NAZA 1K78A 3S6GA 2GAUA 3QPHA 3E3VA 3DEUA 1XD7A 4RAYA 2Q44A 4HX7A 3V8LA 2FOKA 4OLLA 5J8CA 2XKOA 4ZZDA 3P2HA 3KP2A 4KYWA 4YFJA 2A4NA 1YX0A 3VWDA 2ZW6A 3ROUA 3C26A 1ODDA 4OADA 2HYFA 4GYIA 3TDZC 2W57A 2GXBA 4KN4X 2KKOA 4S05A 2JZYA 4IRGA 1RZ4A 1T2KA 1XEBA 4HV6A 2R7FA 2QECA 4FHTA 2DAOA 4UWJA 5FLXK 3DQVC 4OIPF 2KCWA 1JHFA 2M30A 4B09A 4M9SA 1B6BA 4EM1A 2R1IA 1CGPA 4KOXA 1BI3A 5JI6A 1M1DA 2TDXA 5IV0A 2OU2A 4Y17A 2PMUA 4MNUA 5L3FA 4PSWA 2XAJA 2ZXJA 5K5QA 4WK8F 2JRTA 4U9YA 4HX4A 3MAJA 4Y13A 3ZPLA 3ZJ0A 2HQNA 1XGSA 3GFIA 1LVAA 4G7HF 1LB2A 2J8NA 5D5UB 5LGNA 4CICA 1R5GA 4GXOA 1BIBA 4L9NA 5F46A 4M73A 3CDHA 5H6RA 2YR2A 3GLXA 3D5LA 3EYIA 5E17F 4BHPA 3CUOA 1T38A 4LG0A 3EC4A 2KIFA 1RI7A 2IA2A 3DPLC 1Z7UA 4R9MA 3FXQA 2BBYA 4R79A 2JSCA 1EV7A 2VC0A 1AWCA 1ZRFA 1J75A 3JSPA 1DUXC 5HDKA 2IT0A 5DUKA 3HRTA 2ZNZA 2Z10A 3F8KA 3K2ZA 3PFIA 4KIFA 3LQQA 2XASA 2XUBA 1YW7A 2F5IA 2CFXA 3DR6A 1ZG5A 3FRMA 5D4RA 1IXRC 3D8PA 1W5TA 2OQGA 4U0VA 3R9EA 4RGSA 1DPRA 5HOOA 3M9AA 3ZMTA 1P0HA 4IHTA 4UV8A 2HZTA 5H6QA 4A5MA 3RKWA 4P5OA 3LQRA 3C3WA 5DD8A 2PR8A 2XAQA 4KZTA 1S3ZA 2MBFA 2CG4A 3QU6A 1ZYRF 4XRFA 4F7ZA 3JAMZ 3SXYA 2QQBA 3RYPA 1D8JA 4EM2A 2DQRA 4HF1A 2ATRA 1IRGA 2ZKZA 2COMA 4Q47A 2XROA 1TQMA 1G3WA 1D3YA 3ZMZA 1LDDA 2JEVA 5CJ9A 3QP6A 5L3DA 1K4JA 2QMLA 4L18B 3EY5A 4E0AA 1STZA 3KZZA 3J80K 5EC4A 3IC7A 5L3EA 3QOPA 2W84A 1W7PA 2D45A 4OAEA 5IX3A 4KUBA 3E6BA 1I21A 4I09A 1MDMA 4L5JA 1IN7A 3WTVC 5CVUA 5EEHA 2GE3A 4QWQA 1WK4A 3MCZA 1B87A 2RQPA 4G7ZF 3I4PA 3F0AA 1S7AA 2M87A 1S8NA 2RVCA 2EFWA 5HH1A 1OYYA 2GA1A 1FLIA 4ON0A 2Y48A 3HSFA 1H9TA 2I00A 5TRDA 4UNOA 2B5GA 1MJ9A 1NSLA 4N9IA 3SXNA 2ZW7A 1R23A 2XKPA 4KUMA 3WE3A 4XSZF 5DD4A 3R1KA 4XNHB 3K9UA 2EVNA 3LA3A 2VOOA 2V9VA 1ZARA 2HDCA 5IT9Z 3KKWA 1IRFA 4YFXF 1P4XA 1PP8F 3J7AO 1ZGJA 3HHHA 2AE6A 4EM0B 4MQ9F 4EJTA 4LMYA 3S6KA 2STWA 5H86A 4MEYF 3EYYA 4Q5SF 2ESNA 1IN8A 5LEJA 2A07F 2XAGA 1ZG1A 1SFEA 1SD4A 2IJLA 4AWXB 2REEA 1AOYA 4G6QA 3V7RA 4KIBA 1V0CA 3Q9SA 1UFHA 3GY9A 5K5RA 3K69A 3RPUA 3EO4A 1VKCA 1FNNA 2DO7A 4NB5A 2B4DB 3BJAA 3HRMA 1IXSB 2DI3A 2R98A 3V4GA 4EVIA 2M45A 2X0LA 1BI1A 1FWZA 1FOKA 4KDPA 4M74A 1R1VA 3M8FA 3KLOA 4F0YA 4A0ZA 5EEGA 4H89A 2ZBKA 2Q4YA 4JXQA 3FF5A 4FT8A 3ERED 2KRFA 3N7ZA 4UHTA 4IRIA 3ELKA 1NHAA 5BQTA 4IUSA 3HOTA 1FP1D 2CNTA 4I01A 4WXDA 1L0OC 3F8FA 4KMFA 1XSVA 3L2CA 2CNMA 1XN7A 4BH9A 3BY6A 1Z4RA 4JJXA 4QLCU 2DLLA 1F5TA 1Y9WA 5AIPA 5DWMA 1WWXA 1TW3A 2RV8A 1B9NA 1U2WA 4P55A 3ZZIA 3WTSC 1I6XA 1FC3A 1ON1A 1YIOA 4F6AA 1Z4EA 2FXAA 3P2FA 1V4RA 5E8GA 2P4WA 3R95A 1E2XA 1XCVA 3TO9A 5FFXA 2Q8KA 2CNSA 1LDJA 2Y75A 4OMZA 1YLFA 3M7GA 3BPXA 5D5WB 2PMHA 2VC1A 4S04A 2IL4A 3V7SA 1ON2A 2IRFG 5D5VB 2VBYA 3N4MA 1BOBA 1Z9UA 1I12A 3DSBA 2G7UA 5F48A 1ZAOA 3FIXA 2V79A 3GKRA 1QSTA 4HA8A 2PQ8A 3HHGA 1LRZA 4KLVA 2A69F 3CO6C 2VZYA 1HW5A 2VBWA 1B4AA 2EJRA 4WX9A 3GZ6A 4OINF 4XNHC 4PZJA 1XDUA 1M44A 3L00A 5CVJA 2FEZA 5JHUA 2EFNA 5CVIA 4QB9A 3E5QA 3WU0A 4PK2A 4Q48A 3JTHA 4LFUA 2EA4A 3KLNA 1I5ZA 3FWEA 4XBFA 3WE2A 5LLQA 2VI7A 2P7CB 1O3TA 2QWWA 4YIIA 1OR7A 1W5SA 3K1NA 3HOSA 4AD9A 1U5TA 3E5UA 5I0CA 4MJ8A 4YRHA 2O03A 3F22A 2F5DA 4IXAA 3JSOA 4AVPA 4G9YA 3W6KB 4YFNF 1TTYA 3SXOA 2DT5A 4EGZA 2BV6A 1CJWA 1Z1DA 2Q4VA 3W6SA 4EQQA 1S7KA 3CUQA 3RTRA 3V8KA 3QU3A 4CRZB 1D5VA 1USSA 4NHJA 2ZMEB 3DV8A 1CF7A 1I1SA 3H3ZA 4KOTA 4MTEA 1K79A 4A12A 2FA5A 3F3XA 1QO0D 2H5MA 1J7KA 1KU3A 4MEXF 4PK3A 3IRQA 1K6OA 1J4JA 4A0XA 5D5XB 2FIWA 4QC6A 3HSRA 3PQKA 3ZMDA 1LDKB 4BQAA 3BLNA 4KMUX 4KOWA 2ZJ2A 3I59A 4AB7A 1J9IA 3TO6A 2F5FA 2B3VA 3PZJA 5F6FA 3KEQA 1U3EM 2W85A 2YPRA 3GW2A 3D2MA 1P2FA 1Q2DA 3I58A 3PQJA 4OU0A 3FBUA 4P9FA 5KVRA 2FF4A 1T39A 3P9IA 1XB4A 5E1ZB 4HOBA 2NRAC 5ERIA 3R0AA 1P4WA 5ILUA 1OPCA 2Q2EA 4HLYA 5D6FA 5LRSA 2K02A 3IKVA 4IHSA 4L89A 4A0YA 1KYWA 1XSDA 5CVRA 1YO5C 1Z91A 1LNWA 1MK4A 2HOEA 4E8OA 5E8IA 1JXSA 2FSWA 1YFHA 2P6TA 1O3RA 5AIQA 3H4QA 2E7XA 2PLYA 3KEOA 4ONUA 4R3LA 1SQHA 2DBBA 5TJJA 4FD4A 1FPQA 1C0WA 4EJOA 1QSNA 1Z05A 4PCQA 3JUWA 1QQIA 4KICA 2PBIA 2OZUA 5EBVA 4CAWA 4AVCA 4ORFA 1XSXA 1GXQA 1MJBA 3G8WA 1HKTA 2EV0A 1IYLA 3IGRA 1KA8A 2JDCA 2QENA 3IL2A 2XAFA 1Z6TA 1X3UA 3GFJA 1LQ1A 2V1UA 4UVBA 2KJBA 1GVJA 2HEOA 3V7CA 4FX4A 2Z9OA 5CYVA 2A68F 4GO1A 3FMSA 4ESJA 4B5PA 3RKXA 5BMZA 1HW2A 4BMHA 2F5CA 2VXKA 1NE9A 5AONA 4CHUA 3SQNA 4KVOE 2XHKA 4GGGA 1KUYA 3F23A 1W4MA 1G4DA 3F6OA 2FNAA 4UV9A 4KT5C 5LGTA 2F5EA 2FRHA 3MZYA 4PDKA 2GQQA 3C7JA 2BUEA 1ZN2A 4ZZLA 3GFLA 4A5NA 3D3SA 3T0YA 5ICGA 2OAZA 1F4KA 4OIQF 3JTGA 4AVBA 3KP4A 4CS0B 3T1BA 2VZZA 4NQWA 3CXQA 3W91A 4U5YA 4K30A 3BJ8A 2VONA 2W24A 4B8XA 2M1BA 1J2XA 2EV6A 3MQ0A 4JLYA 3TCVA 3RJPA 2VBXA 3MFKA 2QYOA 4LLLA 1PU9A 3BWGA 5JVTA 1XGNA 5ICCA 4AG7A 4XLNF 1OMIA 1ZH5A 2O6GE 4ZBGA 5K1YA 3P9CA 5DV5A 4IPAA 2WTEA 3LD2A 1Q1HA 3WTZA 4M9ZA 4EV0A 3HSEA 2K7LA 4A6EA 1FBQA 2J5OA 2ZXVA 4I0AA 2PEXA 2MLGA 1R58A 1R00A 1P6RA 2DPUA 4NSQA 4MHGA 2DK5A 1O57A 2P8TA 2PFBA 1S7OA 3CLOA 3G3ZA 4HV5A 1DPUA 4R8HA 2Z3YA 2UZKA 3VWEA 1ON0A 4FD6A 2JT1A 4HF2A 1KYZA 1IYKA 4LJZF 1FP2A 1RNLA 2ADUA 3CXPA 1ZRCA 3RPQA 1FYMA 4CO8A 2EUIA 4A6DA 1U8RA 5FVJA 1BJAA 1A04A 3ULQB 2NNNA 1EH8A 2ZNYA 1BN5A 5F64A 3G73A 3EUHA 4RS2A 2O28A 1J5YA 1Y9KA 1RUOA 2PC1A 4MTDA 1S7LA 2YSRA 2NYXA 4IJAA 1YLEA 4U0YA 4XSXF 3KETA 2H09A 4JQFA 3VODA 2B58A 3ECHA 2HGCA 1G3YA 4U88A 2C6YA 1L0CA 3RDIA 2CW0F 2QLZA 3Q9VA 4Y49B 1R1UA 2BL1A 1GHEA 3FZVA 3I71A 1HSJA 5DCMB 2YX7A 4M6XA 3AAFA 1WI9A 3FX3A 2MC3A 2LF7A 2EV5A 1FSEA 4M72A 4X5KA 2H27A 3WG9A 2RC4A 2WPWA 4UBRA 1O7FA 3KP6A 4H6ZA 2MH9A 4U7BA 4KOUA 4DQ2A 2DPDA 4XLPF 2B4BA 3FYNA 5F1RA 4CZZA 3TOAA 1PUAA 3LAJA 3TO7A 4HNXB 1ZREA 1O7LA 1I1DA 2PDOA 3R4KA 4KUAA 2DW4A 4BYYA 3ZN1A 5D4SA 4XPDB 1QNTA 4I49A 2XV4S 1B6AA 4ZH4F 5LHIA 5HS9A 4HDUA 1IN6A 5E20A 3TDUC 3ISPA 5FFZA 3J81K 2M5WA 4FX0A 3WGGA 4R87A 4RGRA 1IN4A 2ARHA 2VEZA 2P5LC 2OZHA 5GCNA 3E6CC 5BOXA 2XVCA 3BP8A 4U9ZA 4UXNA 1UB9A 1XGOA 2LDUA 2E1NA 1IUYA 3TGNA 3DPTA 4OIRF 5ISVA 2QUFA 2Z0ZA 3S6FA 3M8EA 3RIRA 2CSOA 4H6UA 2FE7A 4RB2C 1GXPA 1XDSA 1HXDA 2PRBA 1XIXA 3FHZA 2FBIA 2QBYB 3F21A 1T98A 2H6BA 2STTA 1BC8C 4B5OA 2OBPA 1R22A 3MEXA 3QPTA 3WTWC 3B8GA 3TKYA 4CYDA 2CO5A 2H94A 1VTNC 1UHMA 4WWCA 4ESBA 3F6VA 2JLMA 4ZYHA 5D8LB 1T6SA 3PP9A 1K78B 3M1EA 1IAWA 1P4NA 3DF8A 1IN5A 1S7FA 1XMTA 3EFAA 2FBKA 3O2PE 2UXNA 4EJWA 1S5KA 5HVQC 3B02A 3DXJF 3REOA 1H0MA 1IZ1A 4KOVA 2IPQX 2A61A 3L9FA 2REFA 2MH2A 2R7DA 2DK8A 1R1TA 3T9YA 5FLXZ 3F5BA 3R60A 3H92A 1IF1A 2KJCA 1ZRDA 5ED4A 2OZ6A 2Z5UA 5CNPA 3F8CA 5BPIA 4Y49C 1KZFA 3DP7A 4BNCA 1QSRA 1BI2A 4RAZA 3BJ7A 4PSXA 4JWPA 1BI0A 4BXUA 2K4BA 4IRHA 1DP7P 1Z6RA 2HR3A 2YU3A 3D2PA 4XPKA 1M4DA 1UFMA 2DQLA 2BGCA 2P5VA 4O5VA 2ZW4A 3LODA 5HS8A 1QZYA 2F2EA 4HNYB 5D8KB 3GO5A 1XCBA 4Y15A 1FBUA 5L3BA 2CYYA 4HW0A 2NMTA 2O8XA 2HKXA 3BJOA 3TQNA 2OQRA 3GYAA 5LEKA 1TNSA 3CO7C 1YW8A 3O3KA 3BPVA 2Z33A 2O61A 4L9TA 3QP5A 1QPMA 4XPDC 2XGXA 1H9GA 4Z2YA 4EJUA 4MBUA 4IVNA 1U6GA 5C82A 4LG0B 3QRFF 3V8IA 2HKOA 2FU4A 5KTAA 3BJ6A 2Z99A 2VE8A 2I79A 1KQ0A 5E1XA 4HX8A 1R7JA 5ILSA 2B3UA 2V1DA 4RGXA 4IF4A 2JPCA 2GWRA 1P92A 5L3GA 1ZHFA 1ONVA 2NNYA 2YX4A 2RNJA 1FT9A 2AXLA 1SFXA 4Q4ZF 3K9TA 2L4AA 3K1MA 2Q0YA 2GANA 3FXTA 1U6MA 5JQ4A 2G7HA 4NXYA 3F72A 6PAXA 3RKYA 2R3SA 3R96A 1S3JA 3BOQA 3E0KA 2ELHA 3CXSA 2IA1A 3QB8A 2MD5A 1XGMA 2ZCWA 3O6BB 2QVOA 3E6DA 1ULYA 4JBAA 4ENJA 4ZYDA 2R7HA 1UCRA 2LKPA 1P4AA 2JPBA 2R8VA 2O0YA 2J8RA 2DFIA 4HDVA 1OKRA 3ECOA 4LX9A 3OWCA 2EFOA 1Q2CA 5HLHA 2X7BA 4RB0A 1KQ9A 3WODF 3P7NA 5BPDA 3RYRA 3COAC 1TQPA 2M8EA 4KVME 3JVNA 3J80Z 1JE8A 4KNYA 1IW7F 1YTYA 4MQVA 1Y0UA 3K1PA 2K27A 3K0LA 3TE4A 4HQEA 3P9KA 4HF0A 2EB7A 1IIDA 1YS7A 2D2WA 2LNBA 4LLGF 3U2RA 5DYMA 3L09A 4LB6B 3ZN0A 1PP7U 4N0BA 1W7PB 2OZGA 2HYGD 4BHCA 1YYVA 1SD7A 2FS5A 1MDMB 3HUGA 4K2EA 5HDNA 5C88A 2FE3A 4EVYA 2FBHA 1YR0A 1YGHA 1USTA 2P6SA 4BHBA 3KP7A 4CDGA 2B4DA 5DDGA 2WC2A 3LSTA 3U9GA 3CJNA 2FNPA 1SMTA 3W6XA 1BO4A 2Q0OA 3ZMSA 4L9VA 3N97A 2GA2A 1YQAA 3S2WA 4H0EA 2B5GB 3IKTA 4ENMA 5FB2A 5E1WA 3I9SA 3J81Z 2OA4A 4R57A 3UY5A 1FX7A 2G0BA 1M4GA 2QZ8A 2RN7A 1YG2A 5BS6A 3WTTC 5E18F 2QQAA 5ILVA 2L4MA 2Q7BA 3KFWX 1M4IA 2FMLA 2RGVA 2LF8A 2HUZA 1R57A 3MWMA 4HQMA 1F1ZA 4LUAA 2VBQA 1I27A 4O6JA 2IVMA 1TIQA 1HW1A 3NRVA 4MGRA 2A6EF 5H20A 5A2QK 1KU7A 4OIOF 1YVKA 2FT0A 3D0SA 5LHGA 1WWZA 2ISZA 4RS8A 4LB5A 3SHFA 2ZPAA 3R0JA 2B0LA 2G3TA 1D8KA 2A5YB 2DU9A 4CXFA 2GXGA 1QBJA 3GXOA 1HKQA 2WWYA 3T8TA 2BEOA 1SFUA 1FSHA 4NF1A 3KE2A 1HQCA 2VXZA 4AG9A 4L0YB 2FL4A 2EFQA 3T90A 5CLSA 3I0TA 1HSTA 3NEUA 2P5KA 4CAVA 4KN7X 2BSWA 1EH7A 3BROA 4WF2A 1BC7C 1TBXA 4OOIA 1BM9A 4HZFA 3GX4X 1FBSA 1ZG3A 3LA2A 2FSRA 2FXFA 4HNWB 3VEPA 3HRUA 3V8JA 3VOEA 2VT2A 1N71A 4L5IA 2BEIA 3MZHA 5CVVA 4KOSA 4II9A 1QGPA 2OD5A 1KU9A 5HDGA 4E70A 1JGSA 1IICA 3IRRA 2E7WA 3FMQA 1MD0A 3FM5A 2WV0A 3VB2A 3ZP5A 2ISYA 1BIAA 2UXXA 4O3MA 5ICEA 2Q04A 4FD7A 5JPHA 2Z11A 2PJPA 1B1BA 3GVAA 2A6HF 2O3FA 4YFKF 2AS5F 2VQYA 3OV8A 2VOPA 1Y7RA 5LHHA 4QUSA 3SZPA 3ZMVA 3F8BA 5LBQA 4YG2F 4JD6A 1Q2YA 3KZYA 4MI4A 1OYIA 2JDDA 4LK1F 4LLNA 2ZMEA 3WR7A 3NE7A 2HTSA 2D1VA 3F8MA 4GS4A 2RKHA 2GZWA 2L3DA 4I02A 2ACJA 3SHPA 3OOPA 3LWFA 3S6HA 3HIFA 3I3GA 1MJAA 4KLWA 2P6FA 3EQLF 4ASNA 1T0FA 1R36A 3WU1B 3SZTA 3WGHA 2HV2A 2W25A 4ZYEA 1YVOA 4I2OA 4NCZA 4P9UA 2K86A 3GWZA 1KGSA 1L3LA 1B9MA 5K5OA 2P6EA 4CAXA 4M3SA 4AIJA 2A3SA 4RB1A 3TT2A 3HTUA 1RO5A 2V1XA 5H84A 1U5TB 3ZQ7A 3DNSA 4QVTA 3QAHA 2BE5F 4G6DA 4WXCA 1ZGAA 3IWGA 2C27A 1SD5A 2VODA 4MY3A 5JFRA 4U0WA 3I54A 3F8NA 1TW2A 2ZFWA 1NMTA 1J59A 4G7OF 1CM0A 1GHCA 3CUQB 2VE9A 1YREA 1WSUA 2PSWA 1RXTA 2XIGA 4UA3A 1ZLKA 3E97A 1CF7B 2KIUA 2G9WA 4HYEA 3FXRA 1QZZA 3U1DA 3VFZA 4ESFA 3GUDA 3W6JB 1E17A 2J5PA 1O3QA 1JHHA 5LRRA 1TQIA 4I98B 2FQ3A 2P6GA 1LEBA 1KQ8A 3IHUA 1Z9CA 3TFYA 3I59B 1LJ9A 2CQKA 5IT3A 1WKMA 1S7NA 5FGMA 5LGUA 4L8AA 4LK0F 4YGOA 3WTUC 1RUNA 3FMRA 3C18A 5FD6A 3WGIA 1UHWA 3EETA 3ABUA 3I5UA 1XMKA 3H3UA 4GYGA 3PGPA 4U7DA 3NQOA 1HBXG 1S29A 4P96A 4RB3C 1KU2A 3DKWA 2L01A 4KIGA 3KCCA 5KTDA 3CTAA 3TOBA 2D4PA 2HQYA 2FCKA 3FB3A 3DFGA 4IF5A 3HYIA 4UVCA 1YW9A 2J8MA 3KP5A 4R1HA 3LA7A 3IWZA 1FYKA 4LGWA 3BDDA 4RI1A 4PV6A 4PGHA 2AJ6A 2OH1A 1EH6A 1SD6A 2WPXA 2K5TA 2X4HA 3GFMA 4A2UA
chains in the Genus database with same CATH superfamily
3S9NA 1BOAA 1E3OC 5HMNA 2HS5A 2W0TA 2RQQA 1REPC 2FMYA 1JJ6C 3W3CA 4M71A 1PUEE 2QYVA 3IIBA 4AVAA 1WH7A 3GYHX 2X3TA 1Y6IA 1DU0A 4A3KJ 1QSMA 4BJTA 3JRUA 2MLKA 5A2QZ 3WT4A 3PSFA 2IW5A 1K7AA 4D9JA 1OR7C 2BYVE 4BUPA 2POKA 3CESA 1WZ2A 3BCBA 3DLJA 1LEAA 1RKWA 2HDDA 3CJRB 2HVRA 4TV7A 2YNDA 3WTXC 1U5TC 4F9UA 4JK1X 2QF7A 1MBHA 4EMSA 1AA7A 3LSMA 3C1DA 3I53A 1RIOH 4B5PB 3B3WA 4BQNA 4JX4A 5DWNA 1WRJA 2IGOA 1IUFA 4NEXA 4AIHA 4B14A 2E71A 1O3SA 1YX3A 3FBIB 2JTVA 3W2VA 5JVGF 4JOMA 3S9LA 3GEZA 3DDDA 4OC2A 3RSNA 4EGYA 4CH7A 5LFAA 5FO5A 1W0TA 1V3FA 3L7WA 2PJ2A 2CU7A 1DDNA 2MD0A 1TWCJ 4XK4A 5HS7A 3FNCA 4G94A 5KK1A 3OIPA 1UWYA 4ENNA 3CUQC 2V8VA 2IS1A 4B13A 2KDOA 1Y1BA 4CGZA 5EX0A 5M5YJ 1JGGA 1YK3A 1RKTA 3S32A 1TC3C 3HM5A 2CIJA 2IS6A 5J1RA 1KBFA 3TW7A 4A2ZA 3PNTA 1MZBA 3HOUJ 2P0WA 1A5JA 4OC3A 3G3SA 4MCQA 5J8FA 2P7VB 3L2WA 4YIFA 2EA2A 1LFUP 1D0ZA 2HB6A 3H1CA 3A0HC 2ZO4A 4AIKA 4PPZA 1HKSA 2GIVA 2L9RA 2VIXA 1CT4I 4M85A 4I7HA 4IOCF 1XG1A 2LSOA 5HLIA 1FYLA 1FEXA 1B59A 1KUXA 2DTRA 2HPMA 2CH0A 1Z8TA 3PRTA 3KY9A 5B1AH 1PDNC 2E2HJ 5HNFA 4KA4A 1G3TA 1MGTA 4MY0A 4RAFA 2FNFX 3DR8A 1OMUA 4HKFA 2XRNA 4HNUA 4A3LJ 3HH2C 4NQWB 2PJBA 4UEEA 4L9JA 1XMAA 3OR2C 2KIMA 2CTCA 1OCZH 1G3SA 3QAYA 2D5VA 5F47A 3T8RA 4PGGA 1BJZA 4XKWA 3R6SA 3S2DJ 2VBZA 3MZ8A 4RGUA 1D1AA 5BNGA 1OYWA 3CCMI 3S3NA 1TWFJ 5FD5A 2ERWA 1WGXA 4RAGA 1YS6A 4D5FA 1NG7A 2L02A 4QBJA 4HBLA 4MHDA 4B11A 2PN6A 2OCCH 3BTIA 4Y7NJ 3LFKA 5DUIA 2PJ8A 2JA5J 1VHSA 4R3KA 2X6YA 4XPLA 3FXUA 3ML6A 3JAMK 3ABMH 5E3LA 1A2ZA 4JXRA 2F6CA 2VKHA 1TWHJ 2KFDA 4M6YA 1DS2I 5J4YA 1R9TJ 4ENKA 3B7IA 2M0MA 1G6NA 4FISA 1SGRI 2A05A 2CWGA 2SGFI 2A5WA 1CX8A 4RMNA 2LBFA 1XE4A 3IWFA 3AG4H 2VN2A 3R9GA 5F49A 2L9VA 3KP3A 4I0BA 1BBYA 1PCEA 4J3GA 5G1ZA 5E96A 1MMDA 2VT3A 2HQRA 2HWVA 4KVXA 3BZ6A 3PUFA 2E1CA 3LL7A 3SFZA 2N71A 1IXCA 4HSRA 2LTPA 2V1CC 2V7FA 1R79A 1KUVA 2E2JJ 3E5XA 2PG4A 1IU8A 4UXHA 2PJ0A 2H6CA 5HLGA 3ERMA 2L7MP 1QSOA 1U78A 4KSFA 2JN6A 2K4JA 5DCMA 4EJVA 1WJEA 2EFPA 4IO9F 4FETA 3HTSB 1SMYF 2ROWA 2D1HA 2VKVA 2DA4A 3BG3A 3I64A 4XN3A 5KTCA 4BAYA 5IB0A 1ETOA 1N77A 1R5HA 7CPAA 2DXQA 1XPXA 4DNCA 4LIVA 2G3AA 1K7UA 3PFYA 1SEUA 2PIYA 1ZLIA 4DOZA 4N9HA 2K9NA 1ZLJA 3ZMUA 1SAXA 2D4OA 2A20A 3JW4A 3RYOA 4KORA 2OB0A 1ARLA 4A3GJ 3UEYA 1S60A 3HRSA 4ONWA 4J00A 1VQ5I 1IDZA 3S15J 2C6CA 2ORVA 4UEZA 2V6CA 4ETSA 3H3VK 5D6EA 4E7HA 1IDYA 2HTJA 2LR8A 4P4EA 3ABTA 3FM3A 1YIJI 4C2ZA 2L54A 4JZ0A 2QQ8A 2DMQA 3Q5FA 4CRYB 1K4SA 3OS0A 4PFPA 1Z21A 1TNTA 4PJLA 3L1PA 5AG6A 1Q9BA 3T5XA 4ZYGA 1OBRA 4F52A 1CSOI 4M9XA 5ICFA 5B5EC 4MFJA 2R93J 2PI0A 4FD5A 4PJNA 1TKFA 4ZY0A 2QM3A 1RR7A 2W1OA 1W7PD 4R76A 1WQ2A 4X1EA 1UZCA 3ONQA 2W00A 2ESHA 4DGWB 3S16J 3B73A 3K4KA 4GCVA 1IRZA 5LRGA 2DMNA 5JR3A 1CGII 1OCOH 4RDUA 1IB1E 3RI4A 4II3A 3GF2A 4A3IJ 4KOYA 1TBOA 2JZMA 4A37A 3EXNA 5J1QA 3Q0WA 4OMYA 3TTHA 1PVEA 5IT9K 3WTYC 2EK5A 2QIRA 4RLFA 1DGRM 2DMUA 3VDUA 1TLHB 4L0ZB 1R0RI 4X3RA 4BL0B 1MBFA 2EWNA 4RN7A 1HA8A 4EFDA 1S6LA 4OVOA 2C6GA 3H5NA 1F9NA 2HFHA 2IA0A 3QOEA 4WXHA 2VQGA 1FZPB 2ELIA 2YUSA 4G8XA 4RLQA 3MKZA 1XF8A 2R0QC 4E2AA 2NS0A 2CWEA 4UUVA 4HAMA 4HLXA 3LSRA 2QQ9A 2B8TA 2IP2A 2PR1A 4NGQA 3E6MA 3FBNB 2Y0MA 4D0PA 2FIAA 2ZW5A 3VDXA 4E6KG 3FECA 3R9FA 3BR6A 2BZTA 3OR1C 2F4IA 4UVAA 3EDPA 3G2BA 2DA2A 2YNCC 5IP6A 1MKMA 2Q7SA 1RETA 3GZ5A 5J6XA 5CCMA 1FY7A 1I1GA 2PMZN 2YU9J 9ANTA 2RAEA 5L3CA 3MGDA 5LYFA 3BR0A 2CFOA 4NC6A 2QBYA 4UWIA 3V7ZA 1X1PA 5DEQA 1B72B 1NK3P 1OZPA 2UWMA 1RR8C 4B44A 1J0RA 2MA3A 2CY2A 3R61A 2CGPA 1GVDA 3HOXJ 4PQAA 2V77A 2EZIA 3B3TA 4LD5A 1FOWA 2ETHA 2RDPA 5DCFA 1LE8A 1ZO0A 3B6AA 3LAPA 4WCGA 4KFCA 2XAHA 1CPXA 2DTZA 2NAZA 3PO3J 1U5KA 2QSHX 5IP9J 2EIMH 2JA7J 2I8DA 1K78A 1D5YA 4CYPA 1R4NB 1TURA 2ODDA 3PB9X 1Z77A 3S6GA 5J3LA 2ZOGA 2GAUA 3QPHA 5K8NA 3E3VA 3DEUA 1XD7A 4RAYA 4CA0A 2Q44A 1Z7LA 1WTJA 2IAIA 4HX7A 3V8LA 4XN0A 1Z2IA 2B9SA 2FOKA 1ZKGA 2NU2I 4OLLA 3RPUD 1BR4A 2KP6A 4LQ6A 4BY1J 3SGBI 5J8CA 2XKOA 1QU3A 1ZGWA 3KQZA 1JUMA 4ZZDA 1SGQI 3P2HA 1OCTC 3KP2A 5K7FA 4KYWA 1YJ9I 1WPKA 4YFJA 2A4NA 1YX0A 2AFXA 5IYBJ 3VWDA 2CQXA 2ZW6A 3ROUA 2MG4A 3C26A 1ODDA 2H8WA 4OADA 2HYFA 2M4GA 4GYIA 3TDZC 4P44A 2W57A 4F3QA 2GXBA 4KN4X 2KKOA 3O8GA 4S05A 2ZEHA 2JZYA 4CCJA 4IRGA 1RZ4A 1T2KA 1XEBA 4LIUA 5CKTA 4HV6A 3ZQFA 1IW4A 2LY1A 2R7FA 2QECA 4ZDPA 4FHTA 1VNDA 5EZHA 2DAOA 1WJDA 1XJOA 2YQPA 3VPRA 4DUKA 4BU2A 1S20A 1FTTA 4UWJA 1XX5A 3RAMA 3L2NA 2X1DA 3H36A 1UMQA 2EQRA 5FLXK 4LOCA 3S3OA 2ICWG 3DQVC 1J09A 1V5GA 2AHQA 4OIPF 2KCWA 3W6VA 2MW8A 1JHFA 2G9DA 3FHNA 1HCRA 2M30A 3BG7A 2L7FP 2K9SA 1A6IA 4M9SA 4B09A 4CCNA 2L8EA 1H0ZA 1B6BA 1ELLP 3S2HJ 2V8DA 3QPSA 2WA0A 4EM1A 2R1IA 5LRJA 4XORA 1V54H 3DWLE 1CGPA 2M2EA 4KOXA 4ZY2A 1BI3A 2LC2A 2RNGA 4E4HA 5JI6A 1M1DA 2TDXA 2F5VA 5IV0A 2NVQJ 2OU2A 4Y17A 4R8FA 4UIBA 4BBRJ 2LUYA 2PMUA 3M1CA 4UY8I 4MNUA 2Q43A 5L3FA 3HOWJ 2M9HA 4PSWA 1PUFA 1D0YA 3ZGKA 3MD2A 4DJAA 2XAJA 2ZXJA 5K5QA 4A94A 4XLAA 4WK8F 2JRTA 2ZXWH 4U9YA 3OIQA 1TT5B 2ID6A 4HX4A 4OC4A 2KMOA 5IYDJ 3MAJA 4Y13A 1X1BA 3ZPLA 3ZJ0A 2HQNA 1XGSA 3GFIA 1LVAA 4G7HF 1LB2A 2J8NA 2F7VA 5K8PA 3GFMA 5D5UB 5LGNA 3RO0A 4CICA 1R5GA 3EUHC 3B4VC 4GXOA 4A3CJ 1BIBA 2M7AA 5GPAA 4L9NA 5C82A 1I39A 4OKOA 5F46A 4PJ0C 2K9QA 4M73A 2MC4A 3CDHA 5H6RA 2CQQA 3SFIA 4PXBA 5M3FJ 4ZYAA 2YR2A 3GLXA 4XR6A 3RQ4A 2JA8J 3LWUA 3D5LA 3EYIA 5E17F 2NU3I 4BHPA 2R5YB 2LLKA 3CUOA 4BEHA 4LG0A 1T38A 1WHUA 4JP0A 3EC4A 2KIFA 1RI7A 2IA2A 3HOVJ 3DPLC 3J7ZI 1Z7UA 4R9MA 3OXLA 1TKHA 1YU6C 3FXQA 2BBYA 4R79A 2JSCA 1EV7A 2VC0A 4IZZA 2PE3A 4A3EJ 4UFVA 1AWCA 5GTIC 1ZRFA 1J75A 3JSPA 2XPVA 1SAUA 1AKHB 1SGNI 1DUXC 4F55A 5HDKA 2IT0A 1TUSA 2L9NA 3KYDB 4G6TB 5DUKA 2R92J 1Q7LA 3SJXA 3HRTA 2ZNZA 4C2MJ 2CWFA 4FE4A 2I3CA 3IWEA 2Z10A 3K2KA 2ZEGA 3F8KA 3K2ZA 2R4GA 3J7YJ 3PFIA 4KIFA 3LQQA 3OMYA 4YWYA 3A02A 2XASA 2CXAA 3TBIA 3CCSI 1YRNA 2XUBA 3H8FA 1YW7A 2F5IA 2CFXA 3DR6A 1SGDI 1ZG5A 4FWUA 4NGNA 3FRMA 2EZKA 5D4RA 1IXRC 3D8PA 3H9QA 4UUTA 4IQJA 1W5TA 2PX9A 4IHWA 3D7FA 1BR1A 2OQGA 4U0VA 3D67A 1VQNI 3R9EA 4RGSA 5KAIC 1DPRA 5HOOA 1WGCA 3PBBA 3M9AA 2BOLA 2VRWB 3ZMTA 1P0HA 4IHTA 4UV8A 2HZTA 3K6GA 5H6QA 4A5MA 3DEEA 4BE1A 1F2PA 3RKWA 4P5OA 3LQRA 4MHYA 1RRJA 3C3WA 5DD8A 2PR8A 1HEVA 3PIPF 2XAQA 1Y1VJ 2ODFA 4KZTA 1S3ZA 2MBFA 2L7KA 2CG4A 4V2FA 3MKYB 1B8IA 4MCRA 4NGPA 4JYWA 3QU6A 2JRMA 4Y4RA 1K7TA 3GIUA 1ZYRF 1GYTA 4XRFA 3OYEA 1O4XA 2AFWA 2KPMA 3N05A 1DP3A 1RPWA 4NNJA 4F7ZA 2BVLA 3JAMZ 2JWTA 5LYDA 3SXYA 1Z3YA 1X4PA 2BCOA 1X19A 2DPSA 2BY3A 5HODA 2QQBA 3RYPA 1D8JA 3KPHA 4EM2A 5LYLA 2DQRA 2LVSA 4HF1A 1TIHA 3RQIA 4A31A 2ATRA 3VYTB 1MMGA 1IRGA 3RZDJ 2L2OA 3NE8A 4M3GA 2ZKZA 2COMA 4Q47A 1JUPA 1T33A 2XROA 1TQMA 2L9SA 1G3WA 1D3YA 2XAUA 3VYRB 5EEAA 3ZMZA 3KI9A 4NUBA 3BG5A 1LDDA 1F43A 1LAPA 2PJRB 2JEVA 3DKYA 5CJ9A 1WI3A 5E3MA 3IC1A 3QP6A 1QVUA 5L3DA 5EG0B 1Y0YA 3PB8X 4I99C 1IRXA 4A32A 1K4JA 4YRVA 4L18B 1TF9A 2QMLA 3EY5A 4E0AA 1Z0XA 4IL6C 1STZA 3KZZA 3J80K 5EC4A 3IC7A 5L3EA 3QOPA 2W84A 4E7JA 1W7PA 2XGEA 2D45A 2DFFA 1NH3A 2ME6A 1GDTA 4MXUA 5F08A 3G4SI 1YQEA 4OAEA 5IX3A 4KUBA 3E6BA 4AU7A 4I09A 1MDMA 1I21A 4L5JA 3CCYA 2WAFA 1IN7A 4IHVA 4QTRA 1BA5A 3WTVC 1YJWI 2V9KA 3BR5A 5CVUA 5EEHA 4YELA 1QZEA 2L7ZA 3MKWB 2GE3A 2VKDA 4QWQA 4XKVA 5JGFA 3CZXA 1VQPI 4LG3A 2Z1DA 5CCLA 4B4CA 2LFBA 2XSDC 1WK4A 2X51A 1JT6A 3MCZA 1B87A 2RQPA 4G7ZF 3S9MA 2QQEA 3AL0C 3I4PA 3SI0A 3F0AA 1S7AA 2XRLA 4C7HA 2HZDA 4MHZA 2NSMA 2M87A 1S8NA 2P81A 2RVCA 2EFWA 1LFPA 1OYYA 5CPRB 1W0UA 1GT0C 5HH1A 1G8XA 2GA1A 1FLIA 4FBEA 4ON0A 4FTHA 1WJCA 2Y48A 2LD5A 1IJWC 3HSFA 3A9LA 1H9TA 5ELYA 2I00A 5TRDA 3O8HA 4UNOA 2XEJA 1V5EA 3IH3A 1MJ9A 3M4OJ 2B5GA 1NSLA 4N9IA 3SXNA 2ZW7A 3DBRB 1R23A 2XKPA 4KUMA 3WE3A 2Y0SA 1YTPA 1XMBA 4XSZF 5DD4A 2JVGA 3R1KA 1RC9A 3FC3A 4ZGYB 4XNHB 2DJIA 3CCVI 5M3MJ 1KZHA 3K9UA 2EVNA 4QIWN 3LA3A 4B12A 2VOOA 2V9VA 1ZARA 2HDCA 1R5ID 3LSHA 1ZG9A 4MLOA 5E3RA 5IT9Z 3KKWA 2EINH 1IRFA 2QSGX 4YFXF 1P4XA 1PP8F 3J7AO 1ZGJA 5GPCA 3HOZJ 3FMCA 4PXCA 1PYVA 1OLTA 3HHHA 3K4JA 2AE6A 2DF5A 4MHPA 4EM0B 4MQ9F 4EJTA 4LMYA 5JHWC 3K4NA 3S6KA 3OYBA 4C68A 2Z2SB 2STWA 5H86A 1CQTA 4MEYF 3EYYA 4Q5SF 5AG7A 2ESNA 3DLAA 1IN8A 2ZENA 4C3HJ 4P4DA 4CAEA 1UHAA 1F2OA 5LEJA 2A07F 2XAGA 2H8RA 1ETWA 1ZG1A 1SFEA 1SD4A 2IJLA 4AWXB 1G2HA 2REEA 2KDZA 2DA5A 1NK2P 3P5JA 3HUGB 1AOYA 2DFHA 4G6QA 3V7RA 4KIBA 1V0CA 1AUGA 3Q9SA 1OYVI 1WJ5A 1UFHA 3GY9A 5K5RA 3K69A 4P10A 4IQ4A 1OISA 3RPUA 2E36A 4A24A 3EO4A 1VKCA 5HNHA 4A3JJ 1FNNA 4CYCA 2M0CA 2DO7A 3JCUC 4NB5A 2B4DB 3BJAA 1TT0A 3Q0UA 3HRMA 1KBEA 1BL0A 1IXSB 2DI3A 2R98A 1IV6A 3V4GA 4EVIA 1SFOJ 3OOUA 2M45A 2X0LA 1BI1A 3D5RC 1D1BA 4LQGA 1FWZA 1FOKA 1I3AA 4KDPA 4M74A 1R1VA 2DODA 2KHMA 3WHBA 3BQZA 2Y9ZA 1SC7A 3NFZA 3M8FA 2BVMA 1SVMA 3VH9A 3KLOA 4F0YA 4A0ZA 3BT9A 5EEGA 4Y33A 2EIJH 1IY5A 2RFHA 4H89A 3A0BC 5F1JA 3RNZA 1VDDA 3IEHA 2GKVA 2ZBKA 1JQGA 2KRHA 2Q4YA 2Y30A 4JXQA 3KZWA 2EIKH 2BW3A 2Y31A 3FF5A 3HEFA 4FT8A 3ERED 3BC8A 2KRFA 3N7ZA 2IQ6A 4UHTA 3A03A 4IRIA 1ACIA 2TRTA 3ELKA 1NHAA 2MYSA 5BQTA 3JRCA 4IUSA 2M4KA 1VHOA 3HOTA 2FVGA 2IGKA 3NAUA 2PIZA 1FP1D 2CNTA 2LP0A 4I01A 4GM5A 4WXDA 2XGCA 1L0OC 4BBHA 3GUXA 3F8FA 4KMFA 1XSVA 3L2CA 2CNMA 4V2GA 4CCKA 1XN7A 2N8GA 3HKZN 4BH9A 3BY6A 1Z4RA 4JJXA 4QLCU 2DLLA 1F5TA 1Y9WA 1CGJI 3NARA 1DQUA 5AIPA 1MBKA 2JJ7A 3SEZA 5DWMA 4NFRA 1WWXA 1TW3A 2RV8A 1B9NA 1U2WA 4JYKA 4ABZA 1M8CA 1X10A 3IU1A 4P55A 1MSFC 3ZZIA 1FOXA 3WTSC 1I6XA 1TWGJ 1FC3A 1ON1A 2PVWA 3KR4A 1YIOA 4F6AA 2QJ8A 1Z4EA 2M3AA 1XMXA 2FXAA 3P2FA 2LY2A 4BXXJ 1FTZA 3VATA 1V4RA 2PJ7A 5E8GA 1YSJA 2P4WA 3R95A 1E2XA 1XCVA 4P4FA 3TO9A 5FFXA 2Q8KA 2CNSA 1DS3I 5E3OA 1LDJA 3OXFA 4XL9A 2V53A 2Y75A 4OMZA 1YLFA 3M7GA 3B2YA 4I6ZA 3BPXA 2ZEFA 3WC5A 5D5WB 2PMHA 4X0GA 2VC1A 2I10A 4S04A 2R5ZA 2R7XA 2IL4A 2VQHA 4E1RA 3V7SA 3QPLA 5FUXA 1ON2A 1TL8A 2IRFG 3DPUA 5D5VB 3DEWA 4GDFA 5FUVA 4XLEA 2VBYA 3PB4X 4DYQA 3N4MA 2LB7A 1BOBA 2E1OA 2AQEA 4AC0A 1TBRR 1Z9UA 1I12A 3PNVA 3BLYA 4XLFA 2GOMA 2W7NA 4XNFA 1TWAJ 3DSBA 3DGVA 2G7UA 3WABA 5CQGA 1SANA 1VI0A 4XQFA 1AMPA 2VQCA 5F48A 2HQAA 2OJED 4A93J 3NA6A 1ZAOA 3FIXA 4XICA 2V79A 3GKRA 1EE3P 1QSTA 5J1YA 2G0EA 4ZI6A 4HA8A 3TX8A 2PQ8A 3HHGA 1LRZA 2KLOA 4KLVA 2A69F 2WAQA 3Q3SA 3CO6C 2QQCA 1WCMJ 2R7WA 3GTPJ 2VZYA 1HW5A 1TGSI 2VBWA 1B4AA 2EJRA 4WX9A 4ZTFA 3GZ6A 4OINF 1ZG7A 2X1EA 2K9MA 5JM6A 3BXMA 4GRIA 2XF7A 2AO9A 5EGOB 3OY9A 4PZJA 4XNHC 4XM3A 1XDUA 1M44A 1WVRA 3N5FA 3L00A 5CVJA 2FEZA 4BE2A 3CJQB 5JHUA 3QNVA 4AM3A 2EFNA 5CVIA 1H88C 4QB9A 3SI1A 1MW7A 3RCOA 2CV2A 3E5QA 3H5AA 3WU0A 4KSIA 4C3JJ 2Z3OA 3FKIJ 4PK2A 4Q48A 2WGCA 3JTHA 3JRFA 3CT9A 4LFUA 2EA4A 3KLNA 4Z65A 5JHFA 3CXLA 5D29A 1I5ZA 3FWEA 4XBFA 1V1IA 3PNYA 2UVOA 1YE9A 3S1NJ 4ZTJA 3WE2A 2CJSC 1ELMP 2CUEA 3G1LA 5LLQA 1IO2A 2VI7A 2P7CB 1O3TA 2QWWA 3D68A 4YIIA 1OR7A 1W5SA 1HLVA 1VIXA 1OCCH 4E7ZA 3K1NA 2EPFA 1X74A 2F48A 3HOSA 4AD9A 2W48A 3SDBA 3OIOA 2ZEEA 1U5TA 4ZYQA 3E5UA 1X1AA 4C2TA 5I0CA 2A6TA 4HSTA 5G21A 4MJ8A 4YRHA 2O03A 4B43A 2BO9A 3F22A 2F5DA 3T8WA 5GTHC 2IS2A 4IXAA 3JSOA 4AVPA 1F57A 4XKCA 4G9YA 3W6KB 2CS3A 4YFNF 3GOXA 1YMEA 3CP2A 1TTYA 2XB5A 5F0HA 1ZQ3P 4OIWA 3SXOA 2PJCA 2DT5A 4EGZA 2LKSA 1IV8A 1BMOA 1YW6A 5HVHA 4NGRA 2BV6A 2MSYA 1CJWA 1Z1DA 3D5SC 2Q4VA 3W6SA 4EQQA 3FKJA 2LMDA 1S7KA 1YI2I 1FARA 3CUQA 3RTRA 3CCQI 3V8KA 4CCMA 3QU3A 4CRZB 1EKEA 2B0UC 3D4UA 2Q4ZA 2V1NA 4UIAA 3QYBA 1N25A 1D5VA 1USSA 4M6HA 4NHJA 2ZMEB 4HNVA 3DV8A 1CF7A 1JI8A 1I1SA 1SVOA 3H3ZA 4KOTA 2HDWA 4MTEA 1K79A 2R7VA 2B63J 2ARPF 4A12A 2VASA 2FA5A 3F3XA 1R4MB 3SEQA 1QO0D 3PIOF 3UFFA 2LRDA 2H5MA 4MRIA 5HI7A 1J7KA 3H9GA 3ASNH 4HNTA 2Z3MA 1KU3A 4MEXF 2EBJA 4PK3A 3IRQA 2E5NA 1K6OA 1J4JA 4OMEA 4ZJZA 2CTBA 1W3SA 4A0XA 2R7OA 2KL4A 5D5XB 4DBRA 4ITVA 2NS8A 2P6AC 2GU2A 2FIWA 4QC6A 3HSRA 3BQYA 3SJEA 2EH3A 3PQKA 4M3FA 3ZMDA 3A01B 1LDKB 4BQAA 3BLNA 3SGQI 4KMUX 1VZ0A 4KOWA 3BHXA 2ZJ2A 3I59A 2CUJA 4AB7A 1J9IA 2DA6A 3TO6A 2F5FA 2HI3A 2B3VA 3LSIA 4UCNA 3PZJA 2EK8A 5F6FA 4MFDA 4KS9A 3KEQA 1U3EM 2W85A 2YPRA 3GW2A 1TBQR 3D2MA 1P2FA 1Q2DA 1X3WB 3I58A 2F3CI 3PQJA 4MFKA 4Z6YA 2DDAA 2FOWA 4OU0A 3SZGA 3FBUA 4P9FA 3BI1A 2LG4A 1OVOA 4A3BJ 1CT2I 2AFOA 5IOZA 2SGEI 2KQRA 5KVRA 2FF4A 1T39A 4IHXA 1NSAA 4O23A 3P9IA 3JREA 1XB4A 4DBQA 5E1ZB 2VJJA 1TOTA 2V1CA 4HOBA 2JBJA 4F92B 1HDQA 2WSAA 5GAEJ 2WCYA 3B3CA 2NRAC 3BTJA 5ERIA 4OC5A 3R0AA 4FE7A 3I4MJ 3ABLH 1P4WA 2ZJPF 5ILUA 2ZEDA 1OPCA 2Q2EA 3BJIA 4HLYA 1XRYA 5D6FA 5LRSA 4CZCA 2K02A 2B7EA 3IKVA 4XOPA 1K6YA 3A2KA 4IHSA 2K40A 3CMAI 4GXHA 4BDZA 1UVFA 4L89A 2DEAA 4A0YA 1KYWA 1XSDA 5CVRA 1YO5C 1Z91A 4OAYA 1LNWA 1HDUA 1MK4A 3FEDA 4A33A 5GAGJ 4YU9A 2HOEA 3E2IA 4E8OA 5E8IA 1UUCA 1JXSA 2FSWA 1YFHA 2P6TA 2PJ1A 3FJUA 1O3RA 5AIQA 2ZEOA 3H4QA 2E7XA 2PLYA 3KEOA 3HDDA 1CT0I 2SGQI 2DBBA 5TJJA 1SQHA 3KASA 4FD4A 1FPQA 1C0WA 1Z8XA 4EJOA 1QSNA 1T56A 1Z05A 4PCQA 3JUWA 1N78A 3QYFA 2X6WA 1QQIA 2AQFA 4KICA 1W1WE 3GTOJ 2PBIA 2OZUA 4E7SA 1P9QC 2DMTA 2PVVA 5EBVA 3SDGA 3FH4A 2QKMB 5IPAA 4CYQA 4CAWA 3CCLI 2IXSA 4AVCA 1LKXA 4UUSB 4ORFA 1XSXA 2OR4A 5IP7J 4FAIA 1JTXA 2FJ1A 1UG2A 2HVQA 1A31A 3LSPA 1NXUA 1GXQA 1MJBA 3G8WA 2NU0I 4M6IA 1HKTA 4NJRA 2CRGA 2EV0A 4BJ6C 5TISC 1JKOC 1IYLA 3PL8A 3IGRA 2OD1A 1KA8A 2RREA 2JDCA 2QENA 3IL2A 2XAFA 1Z6TA 4M6GA 2LY9A 2OOTA 1X3UA 1FNOA 4N4OB 3H9JA 1V5FA 2V9PA 3GFJA 1LQ1A 2OTLI 2V1UA 4UVBA 1XX6A 2KJBA 1GVJA 2HEOA 3OVOA 3TC8A 3S3MA 3V7CA 4FX4A 2K3FA 4F8ZA 2X52A 4EATA 4AYBN 4B48A 5CYVA 3HL2A 2Z9OA 2A68F 4GO1A 3LACA 2DMPA 2GOXB 3FMSA 4UXIA 4ESJA 1OJLA 4P1WA 4B5PA 3RKXA 5K7HA 4A3MJ 3TL4X 5BMZA 1HW2A 2GVIA 4BMHA 4RA2A 5JH9A 2HNHA 3DTIA 1MBJA 3D1NI 4IK2A 2F5CA 4ZX8A 2VXKA 2ZSHB 2ELKA 3OYAA 3GTJJ 1NE9A 4HGUA 5I4MA 5AONA 4CHUA 1KMAA 4X6AJ 3SQNA 4KVOE 2IGMA 2XHKA 4GGGA 1R71A 2QQ0A 1KUYA 1WJFA 1W4MA 3LFUA 3F23A 1G4DA 3F6OA 1ETQA 2FNAA 4IKFA 4D1QA 4UV9A 1ULMA 4ONUA 3DKXA 4KT5C 3KYCB 2IMOA 2CW8A 3S8PA 2YNCA 2GIZA 2F5EA 3HPGA 5DTDA 5LGTA 4KITB 4NGSA 2FRHA 3MZYA 1HDPA 4PDKA 2GQQA 3LSKA 3C7JA 1HF0A 3OYKA 2ZMEC 5EX3A 4PXDA 3BZCA 2BUEA 1BLLE 2WB1A 1ZN2A 4ZZLA 4XMYA 3CF5F 1MSEC 3GFLA 4P4IA 2OPTA 4A5NA 3D3SA 3T0YA 2MABA 4MMOA 5ICGA 2EZHA 3QWLA 1IOFA 2OAZA 2V4JC 4MFZA 3HGYA 1F36A 2QSFX 1F4KA 2CUFA 4C2YA 4OIQF 3JTGA 2UZ3A 4AVBA 3KP4A 4CS0B 3WC6A 2Z3KA 3T1BA 1VHEA 4NQWA 1XBUA 2VZZA 2UUZA 3CXQA 4U5YA 3W91A 4RM3A 2N17A 4K30A 3BJ8A 2VONA 2W24A 4B8XA 1A36A 3ZQLA 3CC2I 1LCPA 4UFXA 2M1BA 1T0FC 3CCRI 1VGYA 4EEFG 1J2XA 2JA2A 2EV6A 4KJZA 3CC4I 3MQ0A 4JLYA 3TCVA 2VJ5A 3RJPA 4L5EA 2VBXA 3MFKA 3JRHA 2HXIA 2QYOA 4LLLA 2EK9A 2FQ4A 3BWGA 5JVTA 1XGNA 1Y1CA 5ICCA 1VQ4I 4XLNF 1PU9A 1OMIA 4AG7A 1ZH5A 3OYCA 4UCMA 2E34A 3WHCA 5IY5H 2HC9A 2O6GE 3PFEA 5K1YA 5C4JJ 4ZBGA 1T95A 5HVGA 1S72I 2H1KA 5FKLA 3I4NJ 3P9CA 2DYSH 1LAMA 5DV5A 3ZXSA 4IPAA 2WTEA 3LD2A 1Q1HA 1FYBA 3WTZA 4M9ZA 4EV0A 3HSEA 1SGEI 2ZELA 2K7LA 4A6EA 3CDIA 4FUUA 3FXLA 3FXJA 3QODA 5LYIA 5JLXA 1FBQA 1EJ9A 2J5OA 6CPAA 1Z67A 1ITYA 2ZXVA 4I0AA 4ZDOA 2PEXA 4W97A 3FISA 4SGBI 2MLGA 2VJIA 1R58A 1R00A 1P6RA 3X2QH 3D7DA 2DPUA 3PUBA 2WAQN 4MHGA 4NSQA 2NOGA 4P45A 2WADA 2ECBA 2DK5A 1O57A 2P8TA 4G1PA 2PFBA 1S7OA 3CLOA 3G3ZA 4HV5A 2EBIA 1DPUA 4R8HA 3JRAA 2Z3YA 2UZKA 3VWEA 3HLPA 1ON0A 2R7ZJ 1K7VA 4FD6A 2JUGA 1OFCX 1U0JA 2JT1A 1QHHD 5THWA 2EZLA 3OS2A 4HF2A 4AMLA 3MN8A 1KYZA 2E1MB 5FLVA 1UVGA 1K4TA 1IYKA 3JTKA 4LJZF 1FP2A 1RNLA 2ADUA 4HEA2 1RTQA 3CXPA 1ZRCA 3C2HA 3RPQA 1FYMA 3UKGA 4CO8A 3EPZA 1LFWA 2EUIA 1A35A 4PXEA 4A6DA 1U8RA 5FVJA 1BJAA 3ZQHA 1A04A 3S14J 3TW6A 2E73A 3ULQB 3KQXA 2AXTC 2NNNA 1IOIA 2N52A 1EH8A 4HPSA 2JMWA 2KZVA 1FJLA 5EJCA 5EMIA 2ZNYA 1BN5A 4QPOA 5F64A 3G73A 3EUHA 3KZIC 1SVLA 4RS2A 2O28A 3TP0A 3BTCA 1J5YA 2CV0A 1Y9KA 1RUOA 4E7IA 2PC1A 4MTDA 3RBUA 2IJZA 2AFMA 1S7LA 3WU2C 4XRSG 1XOVA 1WFXA 3K4CA 3IAS2 2YSRA 1YOVB 5HXDA 2NYXA 3OS1A 5AG4A 4IJAA 2DJNA 4BBSJ 3FSYA 1YLEA 2V26A 4U0YA 2VQLA 2LBFB 1POGA 1CP6A 4XSXF 3KETA 2DA3A 2H09A 5H2FC 4JQFA 3VODA 1VQ6I 2B58A 3H8GA 4A30A 1U8BA 3SI2A 2X6OA 2HGCA 3ECHA 1G3YA 4U88A 3L2VA 2C6YA 4B3XA 4C2XA 3H5RA 4H4KC 1L0CA 3RDIA 5HQ8A 1VF9A 3GB0A 2CW0F 1UJ8A 2QLZA 3Q9VA 3M3YJ 5FRNA 4Y49B 2YUUA 1R1UA 3ABKH 3AKZA 4FASD 4OP4A 2BL1A 1GHEA 3FZVA 3I71A 1HSJA 3OWTA 2CQ7A 4BQOA 4II2A 1MMNA 5DCMB 2YX7A 4M6XA 3AAFA 3K4LA 1I50J 3FX6A 1E0EA 3B3SA 1WI9A 3FX3A 1MH3A 2DT6A 2MC3A 2E35A 2LF7A 5FUYA 2EV5A 2OTJI 1BPMA 2CWHA 1FSEA 3MN2A 2X6XA 4C9YA 1RFHA 1YLOA 4M72A 4MFLA 4X5KA 1HOMA 5B66C 2H27A 2KIQA 3WG9A 3ZR8X 4A95A 2RC4A 2JK3A 2NVYJ 2WPWA 1AN1I 5EZGA 4R3LA 1R6RA 4MFPA 4DJLA 4MFQA 5EDNA 2GKTI 4UBRA 4AUXA 1JUSA 1O7FA 3KP6A 1ARMA 2MH9A 4U7BA 2XEGA 2DDBA 4DQ2A 4H6ZA 4KOUA 2DPDA 3CPXA 4F9VA 4CGNA 4AIDA 2YNEA 1B72A 4XLPF 2ZSIB 2V6EA 2B4BA 3FYNA 5F1RA 2L7XA 1X1CA 4CZZA 3TOAA 4GI3C 1Y8RB 4QSHA 2JQ7A 2XF6A 1PUAA 3FK7A 3LAJA 3K2AA 3TO7A 1ZREA 4IHYA 2M5XA 2JBKA 4HNXB 2VLAA 1O7LA 1I1DA 3VE5A 2PDOA 4PFOA 4WJBA 3R4KA 3FVLA 4KUAA 2XEIA 2DW4A 3AG1H 1V1HA 2PMZA 2KMRA 4BYYA 3ZN1A 5D4SA 4XPDB 1QNTA 3BR3A 4I49A 1BW6A 1B6AA 2XV4S 4ZH4F 5LHIA 5HS9A 4P4BA 4HDUA 1PJRA 1MIJA 2XDVA 1IN6A 3LSGA 1VQOI 5E20A 3TDUC 1CBXA 3ISPA 5FFZA 3J81K 4KISA 2M5WA 4FX0A 3WGGA 3IO1A 3H0GJ 4R87A 2ZXIA 1QVTA 2X48A 1IN4A 2DYRH 3GCMA 4RGRA 4C3IJ 5FRMA 2GKRI 2ARHA 2FX0A 3VWBA 4B47A 2VEZA 3D7GA 4CYNA 1I6HJ 3KYLA 2P5LC 2OZHA 5GCNA 1E3HA 4KT6A 3E6CC 2XSJC 4PK4A 1SFKA 2X1CA 5BOXA 2XVCA 3BP8A 3HGGA 4UXNA 1VQ7I 4U9ZA 3I3LA 1UB9A 4E7LA 1XGOA 1IC8A 2LDUA 3Q0VA 2E1NA 1VQKI 1MMSA 1IUYA 3TGNA 3DPTA 2OUMA 4K3NA 4OIRF 4D7NA 3G6EI 3ZOBA 5ISVA 2QUFA 2Z0ZA 3S6FA 3M8EA 1TP4A 2PRQA 3RIRA 3OSGA 2CSOA 5J4VA 4H6UA 2FE7A 4RB2C 1GXPA 2DCEA 4BQQA 4YIRX 3MEKA 1XDSA 3CPAA 1HXDA 1HC8A 3WG7H 4UB6C 2PRBA 3NH4A 2KCXA 4NJQA 1XIXA 4W9YA 4UCPA 3JRBA 2FBIA 3FHZA 3F21A 2QBYB 4OC0A 1T98A 3UEJA 2H6BA 2STTA 2WAEA 3E1SA 4G12A 1BC8C 4B5OA 3UR3C 4DW6A 2OBPA 1K61A 1R22A 3MEXA 3QPTA 3WTWC 3DTKA 3CC7I 3B8GA 3LMSA 3TKYA 1LE8B 2F4OB 4CYDA 2CO5A 1LPQA 2HOTA 4F0XA 2H94A 5JPHA 1VTNC 1JWQA 1UHMA 4WWCA 3L2QA 1VFCA 4ESBA 3F6VA 3ISXA 2JLMA 4XRMA 5HVFA 4ZYHA 4M3EA 5D8LB 1T6SA 2O9LA 3PP9A 3SYTA 1JJ8C 1K78B 3C2GA 3M1EA 1IAWA 3VYUB 1P4NA 3DF8A 1IN5A 1S7FA 1XMTA 3EFAA 3CMEI 1S5LC 5JLWA 2VL8A 2FBKA 4JX6A 1BPNA 3O2PE 3UOEA 3CZ6A 5EYRA 2UXNA 4EJWA 1S5KA 5HVQC 2GLOA 3B02A 3DXJF 3LNQA 3H5ZA 4IAVA 2VPLA 4B6DA 4MHNA 3VSKA 3RZOJ 1MBGA 2R7UA 3REOA 1H0MA 1IZ1A 1TKJA 4KOVA 2IPQX 2A61A 3L9FA 2REFA 3ZQGA 2MH2A 1OCPA 2R7DA 4C7IA 2DK8A 3GTMJ 1R1TA 2JSPA 5FLXZ 3T9YA 3PDNA 2WBMA 3F5BA 3BG6A 2R5YA 1WJBA 2R7SA 3R60A 1HEEA 3H92A 3DU5A 2NU1I 3BZKA 1IF1A 2KJCA 3CDXA 2VPRA 1ZRDA 5ED4A 3S93A 1FMVA 1I3QJ 3S1MJ 1KWMA 4BINA 3PFOA 2OZ6A 2Z5UA 1JKRC 5CNPA 3F8CA 2GBYA 4CGPA 1Q1VA 2HPIA 3AFHA 5BPIA 2DXIA 4Y49C 1KZFA 1AKHA 3DP7A 3SJMA 3KEYA 4AVZA 4BNCA 1QSRA 1BI2A 1R49A 4RAZA 1ZELA 2EILH 5F27A 3BJ7A 1X2NA 4PSXA 5HLTA 4FCYA 2CQNA 3DLLF 4JWPA 1BI0A 4BXUA 3QYEA 2K4BA 1W4RA 4IRHA 2BXYA 1DP7P 1Z6RA 2HR3A 2YU3A 1MNDA 4BY7J 2QVPA 2ZEMA 3D2PA 1WJAA 3K70D 4XPKA 2WB1N 1M4DA 1OMTA 1UFMA 2NU4I 4DZPA 1W5CC 1ETYA 2DA7A 2DQLA 2BGCA 2P5VA 3BCAA 3KX2A 4MO7A 4O5VA 2ZW4A 4I76A 3LODA 2WUUA 3BTLA 2DPTA 5HS8A 1QZYA 2F2EA 2UV1A 4HNYB 5D8KB 4GFBA 3GO5A 3S17J 1XCBA 4Y15A 5C3EJ 4R6TA 2Q1ZB 1FBUA 1NUBA 3G1MA 5L3BA 1PUFB 2CYYA 2ZB9A 3H35A 4F91B 4OWRB 3OYDA 3R5BA 4HW0A 2NMTA 1Y0RA 2O8XA 3DTEA 2HKXA 3BJOA 1MNEA 4HPQA 3TQNA 2CUZA 2OQRA 4D7MA 3K4BA 3GYAA 5LEKA 1UG0A 3OL3A 1TNSA 2DKVA 3QWPA 2JA1A 3JRIA 2O4HA 2IBDA 3CO7C 4WWVA 1YW8A 3O3KA 3BPVA 3QQAA 2Z33A 2O61A 2E5RA 2OV7A 3QTLD 1Y0NA 3CLQA 5IOYA 4L9TA 1PYTB 3BI0A 3QP5A 5F09A 1QPMA 4XPDC 1MH4A 2XGXA 3G71I 1H9GA 3FXMA 4Z2YA 2EO8A 2ELJA 4EJUA 1ORKA 2M34A 4NGMA 4MBUA 4S0HB 2XC7A 4A69C 4IVNA 1U6GA 3FK6A 2WVJA 7WGAA 4BEHB 1QA6A 4LG0B 2W82A 3QRFF 2DIPA 2HKOA 2FU4A 2DT7B 5KNLA 3OL0A 3D00A 3BJ6A 3V8IA 4CGLA 5KTAA 4RBOA 2Z99A 4M3DA 2ZJRF 2VE8A 2ZC2A 2LKXA 4H2KA 5A28A 2I79A 1KQ0A 2K3PA 2J87A 2JYYA 5E1XA 4JCVE 2HQ5A 1R7JA 4HX8A 2VJ4A 5ILSA 2B3UA 2V1DA 3GTLJ 3IFEA 4RGXA 4IF4A 2JPCA 2GWRA 1N13A 1BUSA 5C44J 1P92A 4NC7A 1ZHFA 1ONVA 5L3GA 3IWWA 5FLMJ 2NNYA 4ZY1A 2YX4A 2RNJA 5K8OA 2OF7A 3OYMA 1LFBA 1FT9A 2QA4I 3DBHB 5FKKA 4BKXA 1G59A 2NVTJ 2AXLA 1SFXA 4Q4ZF 4IX7A 2PJRA 4CAFA 3K9TA 1Y8QB 2L4AA 3K1MA 2GANA 2Q0YA 1CHOI 3FXTA 3NWSA 1U6MA 5EG0A 1YRNB 3SJGA 1D1CA 2G7HA 1W36D 1PTRA 2V8GA 5GAHJ 1JKPC 3MRUA 5A27A 4NXYA 3F72A 4B1RA 3GTGJ 6PAXA 2Y69H 3F9KA 1Y8FA 3K4MA 2OC6A 2E60A 2R3SA 1S3JA 3RKYA 5GADJ 1VQ8I 1TF8A 3R96A 5FKMA 1K83J 3BOQA 5FKNA 3OYFA 2ELHA 3E0KA 4UFWA 3CXSA 3KIOA 2CV1A 5D8NA 3OYGA 2IA1A 3QB8A 1H8LA 2MD5A 1XGMA 2ZCWA 3O6BB 2QVOA 3E6DA 1ULYA 2CW7A 1R43A 4JBAA 4ENJA 4ZYDA 2XGDA 2Y2ZA 2R7HA 2I5UA 3I9V2 1UCRA 1XTAA 2LKPA 2ZEPA 1X1DA 1LANA 2QQDA 1P4AA 5CQEA 4QPQA 3BR1A 4OIDA 2JPBA 4UEFA 2R8VA 1UELB 4BE0A 3VDPA 2O8KA 1B8IB 3B35A 2O0YA 2X9DA 3NH8A 4FKDA 2J8RA 2DFIA 4HDVA 2H1LA 1OKRA 3ECOA 3K10A 2J9RA 1Y7EA 4LX9A 5C4XJ 4UXJA 2GFQA 1Y56A 3OWCA 2EFOA 4UF4A 1Q2CA 5HLHA 2X7BA 4RB0A 1KQ9A 4CCOA 3D7HA 3WODF 3P7NA 5BPDA 1D0XA 1P7IA 3RYRA 3COAC 1TQPA 2M8EA 2VKEA 4KVME 1LOKA 3K7AJ 2JA6J 2ZFUA 4XKBA 5AGEA 4A39A 5FKOA 1ULNA 1GV2A 1R3NA 3LSJA 3JVNA 4E1PA 1Z5RA 1FIAA 3J80Z 3IH4A 5E3NA 2NOJB 3HOYJ 1JE8A 1QMUA 1ENHA 2NVXJ 3CD6I 3VARA 2VL1A 5DM6F 4BJ5C 4KNYA 1IW7F 1YTYA 3R5AA 2PJAA 4TWEA 4MQVA 4NGTA 3V38A 4BD9A 3S1QJ 2EWBA 1Y0UA 3K1PA 2K27A 3K0LA 4MIMA 2RIJA 3TE4A 4HQEA 3P9KA 4HF0A 2EB7A 2ZOFA 1IIDA 1YS7A 2MGQA 3TEDA 2D2WA 2BY1A 2LNBA 4LLGF 3A1YA 3U2RA 5DYMA 3L09A 1Y1WJ 4LB6B 3ZN0A 1PP7U 1PJUA 1HDLA 4N0BA 1W7PB 1TXRA 4N4NB 2OZGA 3HBLA 3BG9A 3GMEA 2HYGD 3JR9A 4BHCA 1YYVA 1SD7A 5J47A 5KAFC 1HPTA 2FS5A 3HXLA 3E0JB 3HUGA 1MDMB 1HDDC 1U9NA 1Z3XA 3AG3H 4K2EA 5HDNA 5C88A 3KHZA 5M5WJ 4R7MA 2FE3A 3CJTB 1IGNA 1ERDA 2HXOA 2QGUA 2KMPA 1PPFI 4EVYA 2FBHA 1GUUA 3M8JA 5IB9A 1YR0A 1T8IA 1YGHA 1USTA 2P6SA 4BHBA 2Y0SN 3KP7A 4CDGA 5DDGA 2WC2A 2B4DA 4L9MA 1DTDA 3CCUI 4W1UA 3LSTA 3PM1A 3U9GA 3PBEA 5J40A 3CJNA 2SGDI 2XEFA 4X8IA 2FNPA 1SMTA 3C2BA 1BR2A 2QPOA 3W6XA 1BO4A 1ZLHA 2J9AA 4UB8C 2Q0OA 3ZMSA 4L9VA 1M8BA 2NXNB 3K70C 3N97A 2GA2A 1YQAA 3SJFA 3S2WA 2JUCA 2Z16A 4H0EA 1Z7KB 5TGTA 4NC8A 4XONA 2QEXI 4OAZA 2B5GB 3IKTA 3V42A 4ENMA 4HRIA 4XLCA 5FB2A 2KZGA 1MNMC 1ETVA 5AG5A 4MPIA 9WGAA 5E1WA 3I9SA 1YJNI 4ZX9A 4HG2A 3J81Z 2O53A 4CGOA 2K9LA 2OA4A 4R57A 4CGMA 3UY5A 1FMWA 1FX7A 3L2UA 2G0BA 1M4GA 4WP4A 4DIQA 1ZK8A 2QZ8A 2RN7A 3IH2A 3PSIA 1YG2A 3GTKJ 5BS6A 4IOAF 3MKLA 3WTTC 5E18F 3H8EA 4XOTA 2QQAA 5ILVA 2L4MA 2Q7BA 3FIWA 1BW5A 1SGYI 3MMYB 1P7JA 3KFWX 2DN0A 2HOSA 1M4IA 3KHXA 2FMLA 4NDLA 1MBEA 5KCMA 4Y3OA 2RGVA 3ISZA 4V19K 3IV5A 2LF8A 5DAEA 1XFOA 4OC1A 4DYOA 2HUZA 1R57A 3MWMA 2RB7A 3IU2A 3CDLA 3JRGA 2ECCA 4HQMA 1F1ZA 2LEOA 4M6VA 3TMOA 2VBQA 4LUAA 1I27A 2O7OA 2DA1A 2IVMA 4O6JA 3EUAA 3CMMA 1DE4C 1HW1A 1TIQA 2WY7Q 3IJ3A 3NRVA 4MGRA 2A6EF 3HKZA 5H20A 3W2WA 5A2QK 1KU7A 4OIOF 1YVKA 2FT0A 5G22A 5DS0A 3D0SA 5LHGA 4CYCB 1Y39A 2F8HA 1JT0A 3DU6A 1WWZA 1X4OA 2ISZA 2BOAA 4RS8A 2KMQA 4LB5A 3SHFA 2ZPAA 3R0JA 4E7KA 2B0LA 3CQZJ 1SGPI 1QRYA 3MVPA 3OXGA 2G3TA 1D8KA 2A5YB 2DU9A 4CXFA 1CPSA 2AFUA 2GXGA 1QBJA 2NS7A 3CP8A 2R7QA 3GXOA 4EWTA 1ZG8A 3KR5A 1HKQA 4J19A 1W36C 1CG2A 3OYNA 2GLFA 2NVUB 2WWYA 3T8TA 3UNGC 2BEOA 3HJEA 3VYSB 3E59A 2C6PA 4C2UA 4RM2A 1NG6A 5F04A 3OSFA 1ZR2A 1SFUA 1FSHA 4NF1A 2COBA 2BW3B 3ASOH 3KE2A 2HU9A 3AL0B 1HQCA 2VXZA 3OL4A 4AG9A 4L0YB 5B1BH 2PJ6A 2FL4A 3FXKA 1YHQI 2EFQA 2DOAA 3ZQQA 3FSXA 3T90A 5CLSA 3S1RJ 3I0TA 1HSTA 3NEUA 4NBQA 2P5KA 1MMAA 5FJ8J 2GM4A 2Z3NA 2DFEA 4CAVA 3HC7A 5J1UA 4DYCA 4KN7X 1PTQA 4EMEA 2BSWA 2QKLB 2M7BA 1EH7A 5EGOA 3ESWB 2PJ9A 3BROA 4WF2A 1BC7C 4KSAA 2LYCA 4XLHA 1MT1A 2PJ3A 1YX5A 1TBXA 4OOIA 5FROA 1BM9A 1FAQA 3I55I 4HZFA 3A4CA 3HB9A 3GX4X 2VUMJ 2PCUA 1FBSA 1ZG3A 3LA2A 1APLC 2FSRA 2FXFA 2BY0A 2DOEA 2BUSA 4HNWB 1H89C 1S9HA 4B3AA 3OYIA 3VEPA 3HRUA 3V8JA 3VOEA 4P6YA 2VT2A 1KONA 1N71A 3GLJA 4L5IA 5LD2C 1AHDP 3OYHA 2E5ZA 2GXAA 2BEIA 3MZHA 5CVVA 3H0DA 4KOSA 4II9A 1QGPA 2OD5A 1KU9A 5HDGA 4CSWA 4E70A 1JGSA 1IICA 2IEKA 4PJJA 3IRRA 1OQYA 2E7WA 1CP7A 1GV5A 2N1AB 1U9OA 3FMQA 1X58A 2LREA 1MD0A 2JVHA 3FM5A 2WV0A 3FF3A 1S7EA 3VB2A 3ZP5A 2ISYA 1BIAA 2ID3A 2R5ZB 2UXXA 4O3MA 2KISA 3EUKL 5ICEA 1X12A 3HZJA 2Q04A 2Z11A 4FD7A 5E3PA 4P4JA 3RZAA 2PJPA 2OCEA 3OYJA 1B1BA 3GVAA 1ZTRA 3HUVA 1Z8LA 2A6HF 2O3FA 1WGTA 4ZC3A 2XRCA 4Q36A 4YFKF 4FQGA 2AS5F 3CF2A 2BHZA 2XB0X 2VQYA 4DZJA 3OV8A 2VOPA 1Y7RA 2V8HA 5LHHA 4QUSA 2HYJA 3RU0A 2WY8Q 3SZPA 3ZMVA 4F93B 3F8BA 5LBQA 5E3QA 4JX5A 1Z2LA 3GLLA 2CJJA 4YG2F 2ZXHA 4JD6A 1UAAA 2ORWA 1LR8A 2KT0A 1Q2YA 2F4MB 1LR9A 2X85A 3CMYA 2HOAA 3KZYA 4MI4A 1ZR4A 1OYIA 2JDDA 4LK1F 4AXVA 1EF4A 3SEKC 4LLNA 3OYLA 1NTCA 3VSLA 3FDYA 2IGNA 2R7TA 2YS9A 2ZMEA 1RESA 3ZRGA 3WR7A 1T08B 3NE7A 5CBMA 2HTSA 2D1VA 3F8MA 5DM7F 5F0CA 4GS4A 3NWTA 2RKHA 2GZWA 2L5QA 2L3DA 2XPUA 4I02A 2ACJA 2QCOA 2AFSA 2Z3LA 1QQ9A 3SHPA 3OOPA 4YEJA 3LWFA 1VQLI 3S6HA 1TBNA 5BWAB 5EF6A 3ZQCA 3HIFA 3I3GA 3IAM2 1MJAA 4KLWA 1WH5A 2CMPA 2P6FA 1X2MA 3EQLF 4A3FJ 4ASNA 1T0FA 4M3BA 2Z3PA 1R36A 3WU1B 1LUJB 2ANPA 3SZTA 3M07A 3WGHA 3NH5A 2HV2A 3L2RA 2ABZA 2KRCA 2W25A 2OVOA 2ZJQF 4ZYEA 4IEJA 3G1OA 3A01A 1YVOA 5LRKA 2VB6A 4I2OA 4NCZA 1OCRH 2K86A 4P9UA 1N75A 2R7RA 3TP3A 3GWZA 2WYRA 1KGSA 1L3LA 1B9MA 5CPAA 5K5OA 2P6EA 3HG9A 2PJ5A 4CAXA 1IG7A 4M3SA 4AIJA 2A3SA 4RB1A 3TT2A 3FEEA 3HTUA 1RO5A 1FIPA 4B10A 3RKQA 2KMUA 2V1XA 2E2IJ 1JTYA 1U5TB 3ZQ7A 2K9HA 1IGBA 3DNSA 5H84A 4QVTA 3QAHA 2BE5F 3R5DA 4G6DA 4WXCA 3BR2A 3FXOA 1ZGAA 4J01A 3IWGA 3KGQA 2C27A 1SD5A 2VODA 3R5CA 4MY3A 5JFRA 2JXDA 4U0WA 5K7ZA 3I54A 2C1CA 4BGDA 1LVKA 3F8NA 2W4SA 1TW2A 2JEWA 2ZFWA 2BXZA 2ME0A 1NMTA 4B6ZA 1XS9A 1J59A 1M4LA 4G7OF 3IUOA 4Q38A 1CM0A 1IY6A 2DOFA 2K5CA 1VQMI 3ZCOA 1YW4A 1GHCA 3CUQB 1P9ZA 1FOYA 1TZLA 2AFZA 5GP9A 4MFEA 4ANJA 4BS9A 2VE9A 1YREA 2L0KA 4TNUA 3DBLB 1XC5A 1QPIA 1FT7A 1E3PA 1QHGA 4XIDA 1X4SA 1WSUA 2PSWA 1RXTA 2XIGA 2FD5A 1X3ZB 1V55H 3E97A 1ZLKA 4UA3A 1CF7B 2KIUA 2LH9A 2MFZA 3LOCA 3PEIA 2G9WA 3ZQIA 1WKXA 4HYEA 3FXRA 1QZZA 4XRSA 2VXDA 3U1DA 1YITI 3B3VA 3VFZA 4CUGA 4ESFA 3GUDA 3W6JB 1XA6A 4MCPA 1DU6A 1AYEA 1E17A 3IP4B 2J5PA 4C30A 3UGIA 2TCTA 2WV1A 3B6CA 1HJAI 1IY7A 2M8GX 4MCSA 4CYOA 4RUHA 2BY2A 1O3QA 2CF4A 1JHHA 5LRRA 1ETKA 3JRDA 2IS4A 3PB7X 8CPAA 2ENZA 1TQIA 4I98B 1XBTA 2FQ3A 3U1KA 4LITA 2P6GA 4Q7AA 1LEBA 2HVSA 1KQ8A 4IHMA 3IHUA 1Z9CA 1EA3A 3CCEI 3TFYA 3I59B 4PJMA 4BXFA 4UUSA 3TJQA 1LJ9A 1ULKA 2CQKA 2NYQA 1GLNA 4BDYA 4A3DJ 4ZDLA 2BHYA 1UHSA 5IT3A 2K85A 3J7AY 2SGPI 2PJ4A 1WKMA 2LK2A 2XPWA 1S7NA 5FGMA 5LGUA 4L8AA 4LK0F 5FUWA 4YGOA 3PO2J 3WTUC 1RUNA 1VQ9I 3GTQJ 2DB6A 2FUG2 1PCAA 1Z8WA 3DCFA 2Y9YA 3UGDA 3FMRA 2GLJA 3C18A 5E79C 5FD6A 4BACA 3WGIA 3I1UA 5K8MA 1CE3A 1UHWA 2XF5A 2Q51A 1P9GA 2ENNA 3EETA 3ABUA 1M1EB 3W2AA 5IYCJ 1H8AC 1AU7A 2Q2EB 3WC7A 3I56I 2WZNA 3I5UA 1XMKA 3H3UA 4GYGA 5F0FA 3PGPA 4U7DA 1A6QA 3NQOA 3U21A 1HBXG 1S29A 4P96A 4RB3C 2VI6A 2E1MC 4CCLA 1KU2A 2JW6A 3DKWA 2L01A 4KIGA 4D5CA 2E19A 3KCCA 2LOOA 5KTDA 5KHDA 3CTAA 3HPHA 5M5XJ 3AG2H 3TOBA 1JKQC 2D4PA 4AYBA 3CCJI 3GBGA 4X2TA 4PUSA 2HQYA 2FCKA 3PJRA 3GZNB 3FB3A 3DFGA 3UGLA 3HYIA 5DS9A 4IF5A 4UVCA 1ETXA 1YW9A 2GREA 2J8MA 3KP5A 5JQ4A 4R1HA 3LA7A 3IWZA 1FYKA 5B3SH 4LGWA 3BDDA 5G20A 3LMMA 1BAVA 3PB6X 4RI1A 2O5RA 4PV6A 4Y52J 3D66A 3E7LA 4DYRA 4PGHA 2AJ6A 4A38A 2OH1A 3F0CA 1LR7A 1EH6A 1SD6A 2WPXA 4U87A 2K5TA 2X4HA 2YGWA 3KL9A 4CPAA 1DGWY 4A2UA
chains in the Genus database with same CATH topology
1BOAA 5HMNA 2HS5A 1REPC 2FMYA 4M71A 1PUEE 4AVAA 3GYHX 1QSMA 2MLKA 5A2QZ 2IW5A 1K7AA 2BYVE 1LEAA 4TV7A 2YNDA 3WTXC 1U5TC 4JK1X 4EMSA 3C1DA 3I53A 1RIOH 4B5PB 5DWNA 1WRJA 4NEXA 4AIHA 4B14A 1O3SA 2JTVA 3GEZA 3DDDA 4EGYA 5FO5A 1V3FA 3L7WA 1DDNA 5HS7A 3FNCA 4G94A 5KK1A 4ENNA 3CUQC 4B13A 4CGZA 1YK3A 4A2ZA 1MZBA 2P0WA 3G3SA 5J8FA 2P7VB 4YIFA 2EA2A 2ZO4A 4AIKA 1HKSA 2GIVA 4M85A 4I7HA 2LSOA 5HLIA 1FYLA 1B59A 1KUXA 2DTRA 1PDNC 4KA4A 1G3TA 1MGTA 4MY0A 3DR8A 4HKFA 2XRNA 4L9JA 1XMAA 2KIMA 1G3SA 5F47A 3T8RA 4PGGA 3R6SA 2VBZA 4RGUA 1OYWA 5FD5A 1YS6A 2L02A 4QBJA 4HBLA 4MHDA 4B11A 2PN6A 5DUIA 3LFKA 1VHSA 4R3KA 4XPLA 3FXUA 3ML6A 3JAMK 4JXRA 4M6YA 4ENKA 1G6NA 1XE4A 3IWFA 2VN2A 3R9GA 5F49A 3KP3A 4I0BA 1BBYA 4J3GA 5G1ZA 5E96A 2VT3A 2HQRA 2HWVA 4KVXA 3BZ6A 2E1CA 3SFZA 1IXCA 1KUVA 3E5XA 2PG4A 2H6CA 5HLGA 1QSOA 1U78A 4KSFA 2K4JA 5DCMA 4EJVA 2EFPA 3HTSB 1SMYF 2D1HA 3I64A 5KTCA 4BAYA 5IB0A 1R5HA 2DXQA 4DNCA 2G3AA 4N9HA 3ZMUA 1ZLJA 1SAXA 2D4OA 3RYOA 3JW4A 4KORA 2OB0A 1S60A 3HRSA 2V6CA 4ETSA 5D6EA 2HTJA 4C2ZA 3ABTA 3FM3A 2L54A 3Q5FA 4CRYB 1TNTA 5AG6A 3T5XA 4ZYGA 4M9XA 5ICFA 4MFJA 2PI0A 4FD5A 2QM3A 1W7PD 1WQ2A 2ESHA 3B73A 4GCVA 5JR3A 1IB1E 3RI4A 3GF2A 4KOYA 3EXNA 4OMYA 3TTHA 5IT9K 3WTYC 2EK5A 2QIRA 1TLHB 4L0ZB 2EWNA 1S6LA 1F9NA 2HFHA 2IA0A 4WXHA 1FZPB 4G8XA 1XF8A 4E2AA 2NS0A 2CWEA 4UUVA 4HAMA 4HLXA 2QQ9A 2IP2A 2PR1A 3E6MA 4D0PA 2Y0MA 2FIAA 2ZW5A 3R9FA 4UVAA 3EDPA