3TO6A

Crystal structure of yeast esa1 hat domain complexed with h4k16coa bisubstrate inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transferase inhibitor
molecule keywords Histone acetyltransferase ESA1
total genus 80
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to6A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to6A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to6A02
1FT9A 3AAFA 4R87A 2W85A 4KUMA 5BS6A 2JRTA 3P7NA 1D3YA 2LF7A 1SAXA 3E6DA 3SZPA 3BJ8A 5FVJA 3QAHA 3I71A 4F0YA 3RKYA 4CRZB 3ABTA 4OAEA 1O3RA 4EM2A 4HV6A 5JR3A 3GFLA 3EC4A 3GKRA 1FZPB 3N4MA 3V8LA 4RB2C 2C6YA 1ZLJA 3GO5A 2KIUA 1TQIA 5LLQA 2D1VA 1W7PA 2E1CA 1B1BA 1QSRA 2M1BA 3P9KA 2BL1A 3KZZA 1USSA 1B59A 4LJZF 4BYYA 3WTXC 4EGYA 1XGSA 1TBXA 3KLOA 4MTDA 4FD6A 4I0AA 3S6HA 3GXOA 4G6DA 3Q9SA 4JXRA 1REPC 4YFKF 3HHGA 2K7LA 2OBPA 4YFXF 4RI1A 1CF7B 1S3ZA 1YFHA 2O6GE 4D0PA 3D2PA 3QU6A 3W91A 2IP2A 2FSWA 4YFNF 5JI6A 2STTA 2ADUA 4CXFA 5HLIA 4JQFA 3FXQA 3J81K 3HTSB 3LD2A 3RJPA 2DPDA 3G3ZA 4BHBA 4KNYA 3K0LA 4OIPF 1RIOH 1LNWA 4HF1A 3F23A 1S7FA 1S29A 3RYOA 4R3KA 1V4RA 5HOOA 4NF1A 5D4SA 4KN7X 3H3ZA 2QM3A 2ESHA 2AJ6A 2ZCWA 2L4AA 3S6FA 4L9VA 5LBQA 2V9VA 1TTYA 2Z11A 3BJOA 3QRFF 2K02A 3EUHA 1Z4EA 3F8BA 4LX9A 5IB0A 2K5TA 1V0CA 5DYMA 4UA3A 3RDIA 3V7CA 2J8MA 1IZ1A 4RGRA 4CDGA 4HLYA 2KCWA 4ZYGA 3QPTA 2CGPA 3K2ZA 1B87A 2EFQA 4QC6A 3WTVC 1S5KA 1BI0A 3TOBA 1XMAA 4PZJA 5L3GA 4P55A 4I0BA 4NQWA 1YYVA 2HYGD 4M9XA 1JGSA 1SD4A 1Y9KA 1BM9A 1P4NA 5C88A 4XPDC 1B9NA 2F2EA 3T0YA 2Q8KA 4OADA 5IV0A 4H0EA 4BHCA 1WWZA 5H6RA 5A2QZ 4LK1F 2ZBKA 5F46A 1TLHB 2IT0A 3TGNA 3TDZC 3IHUA 3DSBA 4KIFA 4NB5A 4A6DA 5A2QK 1I6XA 4KOSA 2FE3A 2NNYA 1U5TA 3QU3A 3O2PE 2B4DA 4KOUA 1LJ9A 3CJNA 1MDMA 3M1EA 5H84A 1XF8A 2ISYA 1YO5C 3KEOA 4U88A 1IB1E 5HS7A 2B4DB 1KU7A 4YFJA 4K2EA 4KVME 5AIPA 1N71A 2Q0OA 1X3UA 3HRUA 2HGCA 4AWXB 1OZPA 3FHZA 5AONA 1WQ2A 4I2OA 1PU9A 3LA7A 5LEKA 4KYWA 4Y17A 2R7FA 4KLVA 4XSXF 4LK0F 3RIRA 2ZJ2A 3TQNA 2Q0YA 1Q2YA 1T6SA 4EJWA 5D8KB 1K7AA 4HQEA 3TTHA 2I00A 2LNBA 3E97A 4MTEA 3PQJA 3SZTA 1HW5A 1TIQA 3WE2A 4YIFA 1QSNA 2AS5F 2VN2A 5LGTA 5I0CA 1UHWA 3FMRA 1O3QA 5KK1A 4R9MA 2YX4A 4ZYDA 4YIIA 2D4OA 4HZFA 4JBAA 2QUFA 3ZZIA 2ZKZA 3LFKA 3JAMZ 1CJWA 3HHHA 4CRYB 3CTAA 1ZGJA 2OH1A 3D3SA 2H6BA 4GGGA 4I02A 2FXFA 2HYFA 4QUSA 4YGOA 2NNNA 4UBRA 1OMIA 4FX0A 3HTUA 4RGSA 2Q4VA 3PP9A 2PJPA 2WC2A 3C3WA 2WPWA 4UWJA 1BI1A 1ZHFA 2F5FA 2OA4A 2G9WA 1FSEA 2VC0A 4S04A 4KIGA 3FZVA 5FO5A 2O8XA 4EQQA 4XPDB 4MGRA 4R1HA 1M4IA 2FMLA 2PDOA 4M9ZA 1QPMA 2VI7A 5E20A 5J6XA 4CICA 2PI0A 5D6FA 3BJ6A 1QZZA 2XAHA 2EVNA 4UV9A 1Z05A 3FMQA 1LEAA 2PSWA 3HSRA 2Z10A 1T38A 4PV6A 1F1ZA 2DTRA 1I1SA 2P6GA 3V8JA 3SXOA 3REOA 4A0YA 2STWA 5H86A 4UNOA 4WXHA 1KU9A 5K5OA 4RB0A 5F47A 4HA8A 3C26A 1YX0A 1U5TC 4HDVA 1U2WA 5KVRA 1XGOA 4Q48A 2P6SA 1DPRA 5HS8A 1KUXA 3DQVC 1YLEA 2B4BA 2X4HA 3PQKA 2L4MA 3FF5A 1DDNA 4EJOA 1YS7A 2FBKA 1U78A 2HQNA 2BGCA 3GW2A 3BROA 3ML6A 1LB2A 1R57A 2DQRA 3PGPA 2AXLA 2A6EF 1YVOA 4G7HF 4RS2A 4U0WA 2P6FA 3FRMA 1JHHA 4G6QA 1Z6TA 1R36A 2ATRA 2OD5A 2XKPA 1LQ1A 5L3EA 1BOBA 4Q47A 3F8KA 2CW0F 4AVAA 1P4XA 1C0WA 2DW4A 2M87A 3VFZA 2QQBA 2REEA 1SQHA 1GVJA 1JHFA 1T98A 4MBUA 1OYWA 2Z99A 4WWCA 1MJ9A 4AVPA 2VQYA 3E6CC 4HX4A 1YGHA 3V8IA 2FSRA 1YK3A 1TNTA 2GANA 2R3SA 3BP8A 1I1GA 4JJXA 3EDPA 3R9FA 1L0CA 4QBJA 2CNSA 3MEXA 4L5IA 4OINF 3E3VA 5EBVA 2HWVA 3HUGA 1Z1DA 1EH6A 2HTSA 1XEBA 4WXDA 2IL4A 3TOAA 3O6BB 2FMYA 4JWPA 4QWQA 2REFA 2CNTA 1W5TA 2EJRA 1MZBA 4N0BA 4HX7A 4CO8A 4ZYEA 2DU9A 3QPHA 1LDKB 3R9EA 3DP7A 4JXQA 4L0YB 3ISPA 1IIDA 1MDMB 5KTDA 4MI4A 2GAUA 3I54A 4PSXA 2HQYA 4P9FA 5IX3A 4HF2A 3I9SA 5EC4A 1XCBA 2EFNA 2P7VB 2EV6A 4KLWA 4IPAA 1TQPA 5EEGA 3ZMZA 4AIJA 4HOBA 4R3LA 4GYIA 3N97A 1QSTA 2IA0A 2A61A 2GA2A 4A12A 3DPTA 2B0LA 2MH9A 3MZYA 1ZG1A 2UZKA 2YU3A 4KFCA 4EV0A 4ZH4F 1NE9A 3U1DA 3JUWA 1XB4A 3ZQ7A 2K4JA 3L09A 5HS9A 4KICA 4KOXA 2PMHA 2HV2A 1S7OA 4ENJA 2PN6A 4L9JA 4NEXA 5LHIA 3S6KA 2J8NA 4NCZA 2AE6A 3SHFA 5ISVA 4B5OA 3U9GA 2JLMA 4MY0A 3HSFA 2Z3YA 1QO0D 4ON0A 1IN6A 1XSXA 2W84A 2FXAA 2HR3A 4PK2A 1UFHA 3CUQA 2ZXJA 1T0FA 2PFBA 3BJAA 3ZN0A 2BE5F 1IICA 4YG2F 3BLNA 1O3TA 3GFJA 4EVIA 1RXTA 3J80K 4KVXA 1RZ4A 4CAXA 3TE4A 3I59A 2D1HA 3K9UA 1UB9A 2Q44A 1ZGAA 2VBWA 2PR8A 3GZ6A 2B3UA 3EY5A 2OZHA 1SMTA 4A0XA 4F6AA 1J4JA 4KZTA 2JSCA 4KMFA 4KORA 1IN7A 2D2WA 4AIKA 3LQQA 5TJJA 1IXSB 4UVBA 2Q2EA 2R7HA 1FYLA 1STZA 4HNYB 2BV6A 2QBYA 3WODF 1GXQA 3GZ5A 4RS8A 2XVCA 2DPUA 1IAWA 3E5UA 2L3DA 3J81Z 2XKOA 1F4KA 1XN7A 3LODA 2QQAA 3JTHA 2L54A 4BMHA 4L8AA 3R4KA 4MEYF 2DBBA 3TO6A 3R0AA 2J5PA 3KCCA 2PLYA 1I27A 3WTSC 3FWEA 1FOKA 4FD5A 4NXYA 3G8WA 3B73A 1R1VA 2DFIA 1K6OA 5E8GA 2NRAC 5LRRA 3LQRA 3FMSA 5CJ9A 1QBJA 4Y49C 1KU2A 4HV5A 2E7XA 2H09A 3Q9VA 4FD7A 4OU0A 3T5XA 2VBZA 1IXRC 1K78A 1HSTA 1R22A 2IA2A 1SFXA 2OU2A 3KP4A 1ZG3A 4DQ2A 1RI7A 4Y15A 2ZPAA 4XBFA 1PUEE 4CAVA 2BBYA 2ZMEB 2A69F 4M73A 3CLOA 3WTYC 4HLXA 5CVJA 5BPDA 1ZYRF 5D6EA 2JPBA 1UHMA 4CS0B 3ZPLA 4G7OF 1JXSA 3KE2A 2OZGA 1TW3A 2FU4A 1OKRA 4HX8A 1SFEA 4OIQF 5ICEA 2CWEA 5L3DA 3U2RA 2DQLA 3GFIA 3MGDA 1FP2A 4UUVA 2Q7BA 2K27A 4HNWB 3GVAA 4I7HA 3M8FA 1Q1HA 4CHUA 5JQ4A 2HEOA 4PCQA 5HDNA 2JEVA 2ZW5A 6PAXA 3I59B 5L3CA 4HF0A 2VT3A 2K86A 2QMLA 2CFXA 1XDUA 2TDXA 4F7ZA 3ELKA 1L3LA 1IN8A 3G3SA 4HYEA 5BQTA 4HDUA 3OV8A 4LG0B 1WWXA 1T39A 3KP2A 1Y0UA 2KRFA 4N9HA 1FWZA 4O5VA 3T90A 1Z6RA 1I5ZA 3DR8A 3CUQC 2CNMA 5K1YA 2QWWA 1IF1A 3L00A 2HFHA 2WWYA 1ZARA 2KJBA 3JSOA 3D5LA 4M71A 4II9A 4H6ZA 5F49A 2WPXA 5HLHA 1IRFA 3GF2A 4LLGF 4S05A 4I98B 1QZYA 1ULYA 4KDPA 3V7SA 2M30A 4CZZA 3COAC 1VKCA 3R95A 1HKQA 3UY5A 1QSOA 4BXUA 2JT1A 1H9GA 3IKVA 2B5GB 4KUBA 1HW2A 1IYLA 2FNAA 1JE8A 1BI3A 3G73A 2XV4S 5K5QA 5CVIA 2G7HA 3LA2A 3RPUA 1HQCA 4H89A 4PGHA 2HTJA 5DEQA 4XLPF 2QENA 1ONVA 5D5WB 1G6NA 3R1KA 2ETHA 1BO4A 5J8CA 2DK5A 3K1NA 2XRNA 2LF8A 3GYHX 2VXZA 1FC3A 1M4GA 4WXCA 3RKWA 4M9SA 3QP5A 4U7BA 4TV7A 4EGZA 3P2HA 3PZJA 1MJAA 1ZH5A 2RDPA 1R1UA 3ZN1A 2VONA 5CNPA 5E96A 4OIOF 2O0YA 2P8TA 2VOPA 4ENNA 1H9TA 1WK4A 2P4WA 2C27A 1O7LA 3E6BA 1G3WA 4N9IA 2R8VA 1Z7UA 4I09A 2EFOA 1G3SA 1YR0A 3SFZA 2EV0A 3IC7A 1FLIA 1W7PD 2GIVA 3V4GA 1J5YA 4A6EA 3NRVA 5KTAA 3K69A 4H6UA 4LLNA 2M45A 3IWGA 5LRSA 4FHTA 3R60A 3LA3A 4L5JA 4FX4A 4KOYA 2MLGA 1YVKA 3VB2A 3S2WA 1RUNA 1QQIA 5ILSA 2GE3A 3R9GA 2ACJA 2EWNA 3TKYA 1MD0A 2XAQA 1HW1A 3BDDA 4LG0A 4R79A 4RB3C 4UHTA 2W57A 1BC7C 3ZMUA 5TRDA 2RNJA 5L3BA 3DNSA 3TFYA 1HXDA 2QZ8A 3EFAA 1OR7A 1YREA 3WU1B 2QYOA 1SD7A 2V1DA 1ZRFA 2EA4A 1EV7A 2F5DA 1LDDA 3HRSA 4LB6B 1WSUA 1J0RA 1TW2A 3KFWX 3VODA 3WU0A 4XSZF 4PK3A 1BIBA 4B09A 2FCKA 3FM5A 3L2CA 3C7JA 4IF4A 5FB2A 3DDDA 4L0ZB 1YW8A 1VHSA 1K78B 2KKOA 2BEIA 4BAYA 3H3UA 4HBLA 3K9TA 2CYYA 1CGPA 2B58A 2VZYA 2FNPA 3K1PA 4P5OA 1G3YA 1M1DA 1BJAA 5BMZA 1SD6A 3M8EA 3HSEA 2MBFA 2RQPA 1XIXA 1LEBA 1B4AA 4MQVA 3W6JB 3F0AA 3E5QA 5L3FA 1IW7F 4CAWA 1P6RA 1QSMA 2EB7A 3SQNA 2ZW7A 4P96A 2OZUA 4EM1A 1G4DA 1PDNC 3ZMTA 5LHGA 3ROUA 2CY2A 2ESNA 2NYXA 5JHUA 4U0YA 4U7DA 2BEOA 4LLLA 4R57A 4B5PA 2QECA 4XNHB 3F8FA 1GHCA 5GCNA 5ERIA 1U6GA 3I5UA 4CGZA 5DWNA 3KP3A 4ENMA 1O3SA 3L9FA 3PFIA 3O3KA 3TO7A 1FBUA 5E8IA 5CVVA 4LD5A 5DCMA 2D45A 2YX7A 4KOVA 1BN5A 5HMNA 3WG9A 4R8HA 5HVQC 3C18A 3VWDA 3F22A 2I79A 4Y49B 1KYZA 3M9AA 2Z5UA 4MEXF 2NMTA 3WTTC 3RPQA 4B5PB 2ZNZA 1IN5A 4HAMA 2FF4A 1USTA 3F6VA 1PUAA 3FYNA 4PGGA 3F6OA 3DF8A 4L18B 1WRJA 2XGXA 5FLXK 3T8RA 1S7NA 5J8FA 2X0LA 5DD8A 1Q2CA 2DO7A 3DEUA 1W7PB 1ZN2A 2P7CB 1P2FA 1K4JA 1ODDA 4J3GA 4X5KA 3ULQB 1M4DA 4P9UA 2E1NA 1E2XA 3SXNA 1SMYF 2XIGA 3LWFA 1KU3A 4OOIA 3T1BA 3N7ZA 4NSQA 5FD5A 4KOTA 5BOXA 4Q5SF 1L0OC 5D5VB 1FYKA 3FXRA 2FIAA 2YPRA 2R7DA 5ICGA 1YW9A 1S7LA 1KQ8A 3JW4A 2RGVA 1QNTA 5H20A 3T8TA 3HOTA 3P9IA 3GLXA 1Q2DA 2R98A 4EM0B 1YS6A 1U8RA 4CYDA 4IXAA 5C82A 4MQ9F 3BJ7A 4OMZA 1R58A 1I12A 5K5RA 3Q5FA 5FD6A 2EFPA 2HS5A 1P4AA 2EFWA 3OWCA 4G9YA 3GUDA 2G7UA 1ZAOA 4HNXB 1T2KA 3T9YA 4ZZLA 2H5MA 2MD5A 3FXTA 1P92A 4IHSA 2ARHA 1B9MA 3MAJA 3QOPA 4IRHA 3IWFA 1Z9CA 1FSHA 4JLYA 3E5XA 1FYMA 5E1WA 2Y48A 2ZW6A 4IUSA 3JAMK 3BY6A 5LGNA 1R23A 3LAPA 1KQ9A 4ESJA 1BBYA 1IYKA 4A2UA 3HOSA 4BNCA 2DAOA 5F64A 2UWMA 5D5XB 1ON0A 5ICFA 2D4PA 3FIXA 4QB9A 2WV0A 2XASA 3LSTA 2YSRA 3ECHA 1S7KA 3KETA 3QP6A 2Y75A 2UXXA 1XGMA 4O6JA 2FEZA 3OOPA 4E70A 1BI2A 1WKMA 2M5WA 2IA1A 3R61A 3DXJF 2LSOA 4U0VA 2DI3A 4A5MA 4M72A 5H6QA 2BYVE 1TQMA 3I58A 1I1DA 2J5OA 5ICCA 1B6BA 5DUKA 2LKPA 2BUEA 4KVOE 1BOAA 2P5KA 4QLCU 2P0WA 4Y13A 3EQLF 5IT9K 3FXUA 5KTCA 3KKWA 1H0MA 1FBSA 2VE8A 2ZMEA 1FPQA 1DPUA 1VTNC 5DD4A 2EUIA 3NEUA 2QLZA 3KLNA 1Y7RA 2HKXA 3I0TA 2PG4A 2PRBA 2QIRA 2GZWA 4IVNA 1CF7A 2Q04A 1FNNA 4EJVA 4G8XA 3GYAA 5AIQA 3WGGA 3EETA 2VT2A 5IT3A 1XE4A 4KUAA 2A6HF 4M85A 3EYIA 2OQRA 3ABUA 1LDJA 3MFKA 4Q4ZF 2G3TA 1R00A 3B8GA 2HZTA 3SXYA 1W4MA 3IRRA 1HKSA 4A0ZA 5JPHA 3IGRA 4UWIA 3W6SA 4PSWA 3WGIA 1ZRCA 1NSLA 2VEZA 5HDGA 4LMYA 2G0BA 3M7GA 1MGTA 4BH9A 2COMA 1LRZA 3HYIA 1HSJA 2O03A 4ENKA 4RGXA 2MH2A 2Z33A 1OPCA 1GXPA 1Y9WA 2V6CA 2IVMA 1HKTA 4EJUA 2R1IA 4IJAA 4ONUA 4YRHA 4JD6A 5JVTA 4MHDA 3ERED 1BC8C 2GQQA 2XROA 5IT9Z 3F3XA 2X7BA 3C1DA 4MJ8A 4WX9A 2Q4YA 3IKTA 5DWMA 5DUIA 2O61A 2GA1A 1MKMA 3E6MA 2FIWA 4UVAA 4EJTA 4ASNA 5CYVA 4ESBA 3RYPA 2B3VA 1KQ0A 3R0JA 1M44A 4GS4A 4OLLA 4ZBGA 3JVNA 4OMYA 4WK8F 1P4WA 3L7WA 1J2XA 1ON1A 1XDSA 2H6CA 2JTVA 2ZNYA 4K30A 1AOYA 3V8KA 3H4QA 4A5NA 4AD9A 2V1XA 4JK1X 3RKXA 2L01A 4IF5A 2RV8A 1HBXG 3CUOA 1EH8A 3CXSA 2GWRA 4XRFA 2A07F 2B5GA 1NHAA 1FY7A 1S3JA 1ON2A 4E0AA 3I53A 2ZW4A 3MCZA 1D5VA 2M8EA 3W6KB 2XUBA 4KN4X 3CDHA 3KP7A 4U9ZA 3H92A 3VEPA 3I4PA 4KA4A 4RB1A 1YLFA 2XAFA 4WF2A 3BPXA 2MA3A 3ECOA 2VBYA 3B02A 4BHPA 2DT5A 2ELHA 2F5IA 2CG4A 1FP1D 1RUOA 3HIFA 2VOOA 5LHHA 2FE7A 5LEJA 3FM3A 3ZMDA 2NAZA 5D5UB 4BQAA 4E8OA 4LFUA 1ZLKA 4UVCA 1R5HA 4L9TA 2ZXVA 4B8XA 2Y0MA 1EH7A 2XAJA 1PP7U 3IWZA 2MC3A 3V7RA 5CVRA 3F8CA 5FFZA 5HLGA 4LGWA 4PDKA 2F5EA 5E18F 2PC1A 1YQAA 2XAGA 3KEQA 4M6YA 5DCFA 3VOEA 1S7AA 4GXOA 2FBIA 2VE9A 3W6XA 5CVUA 2O3FA 5CLSA 1J7KA 4G7ZF 4AIHA 1V3FA 4LB5A 2P5VA 4AB7A 4Z2YA 2L02A 3DV8A 3MWMA 2GXBA 3I64A 1IUYA 5E1XA 4ETSA 1FX7A 2NS0A 3RYRA 2V79A 2IJLA 2MLKA 1J59A 2FS5A 4NHJA 4AG9A 2V1UA 2DK8A 1O7FA 1U6MA 1R1TA 3BWGA 3IL2A 4QVTA 2HDCA 3S6GA 2FQ3A 2QVOA 2F5CA 2EV5A 1BIAA 5DV5A 3GX4X 3MZHA 4AG7A 2JDDA 1YW7A 4UXNA 2OB0A 1J75A 1P0HA 2H27A 1U5TB 4AVBA 1I21A 4ZZDA 3P9CA 3CO6C 2JZYA 2FA5A 4GO1A 1S6LA 2VBQA 1DUXC 4I49A 4UV8A 1G3TA 4LUAA 1RO5A 4U5YA 1OYYA 5DCMB 3TO9A 2J8RA 1XCVA 5ED4A 2A3SA 2VODA 2HQRA 4IRGA 2H94A 3JSPA 4ZYHA 4MY3A 4MNUA 1ZG5A 2W25A 1B6AA 1D8KA 2P5LC 3DKWA 4O3MA 3CO7C 3R96A 1R5GA 1MJBA 5E1ZB 4M6XA 2HUZA 1IRGA 5DDGA 1XGNA 1E17A 3BOQA 5FLXZ 3FB3A 2KJCA 2A5YB 3FX3A 3CUQB 3NQOA 2OQGA 2FBHA 4U9YA 2BSWA 4FT8A 1KUYA 3DR6A 2ZFWA 2IW5A 4M3SA 3J80Z 5JFRA 2ISZA 5HDKA 4MHGA 1YIOA 5D4RA 3TDUC 2PR1A 1U3EM 5EEHA 3CXPA 3F8MA 3E0KA 3HRTA 4KIBA 4WCGA 1K79A 3EXNA 5ILUA 1KZFA 1PP8F 1O57A 2FOKA 4HQMA 3DFGA 4XPLA 1Z9UA 1QGPA 1KA8A 2UXNA 2Z9OA 4EVYA 5ILVA 2P6EA 2O28A 1Z4RA 1KUVA 4ORFA 1S60A 2VXKA 2WTEA 2HKOA 2YR2A 3KP6A 4E2AA 2K4BA 3LAJA 1XD7A 2VC1A 5F48A 2DXQA 2E7WA 3R6SA 1S8NA 3CXQA 1YTYA 3VWEA 2KIMA 3WTZA 3WTUC 1KGSA 1GHEA 4XLNF 3D8PA 1R7JA 3K1MA 4L89A 2QBYB 1IN4A 1Z91A 2P6TA 2A4NA 3ZP5A 3ZMVA 1UCRA 3SHPA 3JTGA 1MK4A 2PMUA 5F6FA 3GFMA 3F5BA 3KZYA 5BPIA 3MQ0A 4RGUA 1OYIA 1SFUA 1SD5A 1NMTA 4KMUX 2JDCA 4XNHC 3TCVA 2IRFG 3BPVA 2PQ8A 2EA2A 3F8NA 2RN7A 3F72A 3FBUA 2CSOA 2IPQX 2FRHA 1F5TA 1ZREA 1XSVA 2XHKA 3DPLC 2CO5A 2QQ9A 1J9IA 3ZJ0A 4RAZA 4HKFA 5LGUA 1IXCA 4XPKA 2A68F 3GWZA 2VZZA 2HOEA 4HW0A 1D8JA 2OZ6A 4GCVA 3WGHA 2VBXA 1F9NA 3KP5A 1FBQA 1A04A 4KOWA 3EO4A 2CQKA 2DLLA 1W5SA 1XMTA 4G94A 3WE3A 4EMSA 3BZ6A 3D0SA 3RTRA 3FNCA 5HH1A 1WI9A 4RAYA 5E17F 2G3AA 3WTWC 3GY9A 2JPCA 2W24A 2ZO4A 3RI4A 1ZRDA 2FT0A 5FFXA 2PEXA 1XSDA 1XMKA 1CM0A 3TT2A 1TNSA 3I3GA 4GYGA 2OAZA 4FD4A 4KT5C 3GEZA 3EYYA 1AWCA 3HRMA 5D8LB 3J7AO 5FGMA 3F21A 4L9NA 4OIRF 3IRQA 4AVCA 4M74A 4I01A 1LVAA 2RVCA 1UFMA 3NE7A 3P2FA 2PBIA 2GXGA 2LDUA 2RKHA 1RNLA 2KIFA 2RC4A 4IHTA 3ZMSA 4DNCA 1DP7P 1YG2A 3WR7A 4IRIA 1KYWA 2Z0ZA 3QB8A 2FL4A 5F1RA 2EK5A 3D2MA 4ESFA
chains in the Genus database with same CATH superfamily
1WGXA 1FT9A 2LY9A 2VKDA 3HXLA 4D5CA 1TOTA 3AAFA 4R87A 3VDXA 2W85A 4KUMA 5CBMA 5BS6A 2JRTA 3P7NA 3ONQA 5FLVA 1D3YA 1HOMA 2LF7A 3AFHA 3QYBA 3OL3A 1SAXA 3E6DA 3SZPA 3BJ8A 2K3FA 5FVJA 2HOAA 1ZO0A 3B2YA 3QQAA 3QAHA 3I71A 3MKZA 1UG0A 3RKYA 4F0YA 2I5UA 3IUOA 3ABTA 4OAEA 2QSHX 1O3RA 4CRZB 4EM2A 4HV6A 4IOAF 5JR3A 4BINA 3GFLA 2VKHA 3EC4A 1MBHA 3JRFA 2J9RA 3GKRA 4PJMA 4LITA 1U9NA 1FZPB 2DB6A 3N4MA 3V8LA 4RB2C 3FXKA 5JLXA 1A5JA 4A39A 2M34A 2C6YA 1ZLJA 4DJAA 4XLHA 3H3VK 4NGSA 2XEIA 4BBSJ 3G6EI 3GO5A 2KIUA 5B3SH 1TQIA 4A93J 1CT4I 4IEJA 2JYYA 3D67A 4PUSA 2H8RA 4IX7A 5LLQA 4OKOA 2D1VA 1W7PA 2ERWA 4KISA 3S9MA 2E1CA 3VDPA 1B1BA 2Y9ZA 4DZJA 1QSRA 2O9LA 2F4OB 2M1BA 1H8LA 4R76A 3BTLA 3P9KA 2R7XA 2BL1A 1WJ5A 2YS9A 4MPIA 3KZZA 1USSA 3X2QH 2QQDA 2PJ6A 2LB7A 2M4KA 4BEHA 3OYMA 2ORWA 1Q7LA 3FMCA 1F36A 1B59A 4LJZF 3ZQQA 4BYYA 3WTXC 3FXOA 5G21A 1FIAA 1XX6A 3Q0UA 4EGYA 1BUSA 1XGSA 1TBXA 1WJDA 2JSPA 3KLOA 4MTDA 1HCRA 2CXAA 4I0AA 4FD6A 3S6HA 3DBLB 1MNMC 2MGQA 3GXOA 3A01B 2CQNA 2LR8A 4G6DA 4HPSA 1V1HA 3Q9SA 4JXRA 1REPC 4YFKF 3GUXA 4HSTA 3K7AJ 5E3MA 3HHGA 4GXHA 1OCTC 2OTJI 2HI3A 1X1CA 3CP8A 5LRJA 1Y39A 2ZXHA 2LEOA 2K7LA 2OBPA 4YFXF 1G8XA 3DBHB 3DEEA 3IP4B 1CF7B 1CGII 1S3ZA 4A3DJ 4RI1A 1UAAA 1YFHA 3LNQA 2O6GE 4D0PA 3OSGA 4BACA 4HPQA 3BHXA 3D2PA 3QU6A 1ITYA 1OMUA 1TF9A 1Y1BA 4OVOA 3ZRGA 3W91A 1SGNI 2IP2A 3S16J 2PJ9A 4H2KA 2FSWA 3BTIA 4DIQA 4YFNF 3R5BA 1ACIA 1WH7A 5JI6A 2STTA 2ADUA 4C3HJ 4CXFA 1Y0NA 5HLIA 4UCNA 4JQFA 2Y30A 3FXQA 3PM1A 3J81K 3HTSB 3GOXA 2GLFA 3LD2A 1P9GA 5IPAA 2ZC2A 2ROWA 3GB0A 1YLOA 1U9OA 3RJPA 1P9QC 2DPDA 3G3ZA 4BHBA 4KNYA 3D4UA 2K9LA 3K0LA 3KQZA 1XFOA 3RAMA 2HXIA 4OIPF 4A3JJ 1RIOH 2AFUA 1LNWA 3S17J 4HF1A 3F23A 1S7FA 1S29A 4R6TA 1R4MB 3RYOA 4DZPA 4R3KA 2BXZA 3CPAA 1V4RA 5HOOA 3S9LA 4LG3A 4CZCA 4NF1A 5D4SA 4M6VA 4UB6C 3JRGA 3C2BA 4KN7X 3H3ZA 2QM3A 2ESHA 2AJ6A 2ZCWA 2L4AA 3UR3C 1H89C 4L9VA 2HPMA 1ULNA 2XAUA 2CTBA 3RNZA 5LBQA 1OBRA 2V9VA 3SDBA 1TTYA 3I55I 2SGEI 2Z11A 3BJOA 3QRFF 1KONA 2K02A 2YNEA 3EUHA 9WGAA 3NE8A 5J4YA 1Z4EA 3F8BA 4LX9A 3I3LA 5IB0A 2K5TA 1V0CA 1AUGA 4Q7AA 4PFPA 4A31A 3BR1A 5DYMA 4UA3A 2WYRA 3RDIA 2NVXJ 3M3YJ 3V7CA 3SJGA 2EO8A 4DUKA 2J8MA 1IZ1A 4HGUA 2I3CA 4RGRA 2R5ZA 2ZXWH 4CDGA 1RRJA 2R0QC 4HLYA 2KCWA 2LC2A 4ZYGA 1BW5A 3QPTA 2CGPA 3HOUJ 3K2ZA 1B87A 2EFQA 4QC6A 3WTVC 5J1QA 1S5KA 1BI0A 1UHAA 3TOBA 1TKJA 5EG0A 1XMAA 4PZJA 2WZNA 2VQLA 5L3GA 4P55A 2JUCA 3WC5A 2W7NA 4I0BA 3TW7A 4NQWA 1YYVA 2HYGD 1X4OA 4M9XA 1S7EA 4CCJA 1JGSA 5J47A 4XNFA 1OCZH 1A36A 3R5CA 1SD4A 5IY5H 1TT5B 3HBLA 1BM9A 1Y9KA 4MFQA 2EIKH 1K7VA 1FT7A 1P4NA 4EEFG 5C88A 3H9QA 4XPDC 1B9NA 4KSIA 2F2EA 3T0YA 4F55A 2X1CA 2M7AA 4JOMA 2DMQA 2Q8KA 4OADA 5IV0A 4M6IA 3OYFA 2ZOFA 4H0EA 4BHCA 1WWZA 1R3NA 4NJQA 4TWEA 2E2JJ 1BJZA 2DA7A 5H6RA 5A2QZ 4LK1F 1PUFB 2ZBKA 2KP6A 2R7SA 1AMPA 1TLHB 1CP6A 1K6YA 2IT0A 3GTPJ 5F46A 5LYFA 1LFWA 3D7HA 2Z3MA 4A3KJ 3CCSI 2MABA 3CMYA 3TGNA 3OXFA 2H1LA 3TDZC 4D7MA 1MT1A 5IP7J 3IHUA 2ZXIA 4C2TA 3DSBA 2E71A 2R93J 4KIFA 2ME6A 3OL4A 4NB5A 1RFHA 4A6DA 4BL0B 1I6XA 5A2QK 2ENNA 2LY2A 4DOZA 2EIJH 2JA7J 4KOSA 4OC1A 3B3VA 2FE3A 4BE1A 2NNYA 2NOJB 1U5TA 1A6IA 4B3XA 3QU3A 1RR7A 3FX6A 4M6HA 3O2PE 2QKMB 1V54H 1KWMA 2B4DA 4BY7J 4KOUA 1LJ9A 3PNVA 3CJNA 4BE2A 3RZAA 4DJLA 3FKJA 2UV1A 2LMDA 1MDMA 2G0EA 3M1EA 5E79C 5H84A 1HF0A 1XF8A 2CWHA 2ISYA 1YO5C 5ELYA 3KEOA 2L5QA 4U88A 1IB1E 2Y69H 1BPNA 1VQ9I 1UUCA 2FUG2 4F52A 3PEIA 3GTOJ 5HS7A 2B4DB 4RDUA 1LE8B 1BLLE 1KU7A 4IKFA 4K2EA 4ZDPA 4KVME 5AIPA 1N71A 4Q36A 2E34A 2Q0OA 1JTXA 1X3UA 2HGCA 3HRUA 4LOCA 4C30A 3HOWJ 3OYEA 3W3CA 3S93A 4AWXB 1Z2IA 1OZPA 4BJ6C 3FHZA 3VYSB 1YJ9I 1OISA 2BZTA 1WQ2A 5AONA 2OF7A 4I2OA 1PU9A 3LA7A 5LEKA 4KYWA 5I4MA 4Y17A 3B4VC 2L9NA 2R7FA 1TWGJ 4ZX8A 5LYLA 4KLVA 3EPZA 3S1QJ 4A2ZA 4XSXF 4LK0F 2O7OA 3RIRA 2ZJ2A 2QCOA 3TQNA 2Q0YA 1I39A 1QPIA 1Q2YA 1T6SA 2C6GA 1QVTA 2EBJA 2PJ1A 2PVWA 2VJ4A 4EJWA 1BR2A 5D8KB 1K7AA 3CCQI 4XLEA 4HQEA 2XB5A 1CPSA 2AFZA 3TTHA 2I00A 1A6QA 3V42A 2LNBA 1ZG7A 3JCUC 4OC4A 1N78A 5JHWC 3UEJA 3E97A 4NGMA 4MTEA 3PQJA 4BBRJ 3SZTA 4IK2A 2NVQJ 3S15J 1HW5A 1TIQA 3IU2A 4TNUA 3CC4I 1XMXA 2COBA 3WE2A 2ELJA 5FKLA 2X6WA 4YIFA 1ENHA 2AS5F 2VN2A 5LGTA 1QSNA 5I0CA 2B9SA 5FRNA 3IU1A 1UHWA 2J87A 1CT0I 2IMOA 3FMRA 4O23A 4A94A 1O3QA 5KK1A 5DS9A 4R9MA 2YX4A 4ZYDA 4YIIA 1JUSA 4A3GJ 2D4OA 2CWGA 4HZFA 4PXEA 4JBAA 2QUFA 4AM3A 3DBRB 3ZZIA 2ZKZA 3LFKA 3S2DJ 3K2AA 4U87A 2DDBA 4AVZA 2XGCA 1K7UA 1TF8A 3JAMZ 1CJWA 3HHHA 4CRYB 3CTAA 4B11A 1ZGJA 2OH1A 3D3SA 1N13A 4IL6C 2H6BA 1VQ4I 4GGGA 4I02A 1RPWA 2FXFA 2HYFA 4QUSA 3ZQLA 3HGYA 4X1EA 4YGOA 2NNNA 1VHEA 1V55H 2R5ZB 2Y31A 1FOXA 3CF2A 4UBRA 1OMIA 3LMMA 5HNHA 1ZR2A 1BPMA 2ELIA 4FX0A 3CJRB 5LD2C 1JTYA 5F1JA 2XF7A 3HTUA 4RGSA 4Y52J 2Q4VA 3DTKA 3PP9A 1XMBA 2E2IJ 2PJPA 2MYSA 2WY7Q 3SZGA 4BJ5C 4ZYQA 2WC2A 1X2NA 3PO3J 3C3WA 2WPWA 4UWJA 2LP0A 1BI1A 2HDWA 1ZHFA 2F5FA 2OA4A 2HQ5A 2G9WA 1FSEA 2PJ3A 2O53A 4A95A 2VC0A 4S04A 4KIGA 5EGOA 3FZVA 3MKWB 5FO5A 4B14A 2QPOA 1CG2A 2O8XA 2DIPA 3T8WA 4EQQA 4XPDB 2XRCA 2LOOA 3KR5A 2CUEA 4MGRA 4R1HA 5F27A 1M4IA 2FMLA 4CYOA 2NU0I 1A35A 1GV5A 4AMLA 4M3EA 3D7GA 2KMOA 1LR8A 1RESA 2PDOA 4M9ZA 1QPMA 4MFDA 1HDPA 4MFJA 4KJZA 4UF4A 2VI7A 5E20A 5J6XA 4CICA 2PI0A 5D6FA 3BJ6A 1QZZA 3KY9A 2XAHA 2EVNA 4OMEA 4UV9A 1Z05A 3D1NI 3BZCA 3FMQA 3LSGA 5M5YJ 5FROA 4BY1J 2B8TA 1LEAA 1UZCA 4XICA 4XIDA 3CC7I 4WP4A 1AA7A 2L9RA 1E3OC 2PSWA 2Q2EB 3H5RA 3HSRA 4CAEA 4DYOA 3FBNB 1APLC 2PX9A 1F2PA 2AFMA 2Z10A 1T38A 4PV6A 4CGOA 4A33A 1F1ZA 2DTRA 2IBDA 1MMSA 1FIPA 1I1SA 4YFJA 4ZY1A 2HVQA 2WVJA 2AFWA 2P6GA 3V8JA 3SXOA 2ZSHB 3REOA 4A0YA 2STWA 5H86A 3PFYA 4UNOA 1TGSI 1YW4A 5G1ZA 1MBEA 1HPTA 3BR2A 3GTJJ 4WXHA 1KU9A 5K5OA 4XKCA 2IEKA 4RB0A 1MNEA 1VZ0A 5F47A 2EILH 3BR0A 4CYPA 4HA8A 4GM5A 3C26A 4YRVA 1U5TC 2KZGA 4HDVA 1YX0A 3FEDA 1PCAA 1U2WA 1N25A 2AXTC 4OWRB 5KVRA 2R5YA 1A31A 4P4EA 1XGOA 2E60A 4ESFA 4RN7A 4Q48A 4BQOA 1PYTB 1XTAA 2P6SA 4ONWA 4MCPA 5HLTA 1NG6A 3JRDA 3MRUA 3PUFA 2LVSA 1DPRA 5HS8A 4QIWN 3DQVC 1KUXA 1YLEA 1EE3P 2B4BA 2X4HA 3CCRI 4MMOA 3PQKA 2DPSA 2L4MA 3FF5A 1DDNA 4H4KC 1ETWA 2VPRA 2O8KA 4EJOA 3JRAA 1YS7A 2FBKA 6CPAA 1U78A 1ETQA 2BGCA 3GW2A 2HQNA 3L2WA 5EG0B 3UKGA 3BROA 3ML6A 2DN0A 1IC8A 1LB2A 1R57A 2DQRA 3KL9A 2AXLA 3PGPA 3BR6A 2A6EF 1YVOA 4G7HF 2ZEOA 3MEKA 4RS2A 4U0WA 3DLAA 1MMDA 2IGNA 1UWYA 2P6FA 3FRMA 1ZG8A 1JHHA 4G6QA 1GLNA 3PFOA 4EWTA 5M3MJ 1Z6TA 1R36A 2KDOA 4FE7A 3SGBI 2R7ZJ 1TP4A 2ATRA 2PJ4A 2OD5A 2XGDA 2XKPA 4G12A 4AXVA 2DYSH 4FISA 1LQ1A 2IGMA 5L3EA 1BOBA 4Q47A 3HUVA 3F8KA 1Y6IA 2CW0F 3GTGJ 5FJ8J 3H1CA 2M3AA 1IW4A 4AVAA 1P4XA 5HVHA 1C0WA 2DW4A 2M87A 3S2HJ 3SI2A 3OIQA 4E7KA 1ZKGA 2LY1A 1D0YA 3VFZA 2QQBA 4CPAA 4CAFA 1P7IA 3F0CA 2REEA 3PBBA 1SQHA 4R7MA 1GVJA 1JHFA 3PB4X 2HOTA 1T98A 4MBUA 1OYWA 2Z99A 4WWCA 1OMTA 3HH2C 2PJBA 1MJ9A 1R43A 4AVPA 2VQYA 2CV0A 4CCOA 3E6CC 1CE3A 4HX4A 2QSGX 3SI0A 1PYVA 1YGHA 1IV6A 4GFBA 3V8IA 1OCCH 3TW6A 2FSRA 5K8OA 1YK3A 1TNTA 4XRSG 1A2ZA 2GANA 4A3MJ 3OYGA 2R3SA 4XM3A 2DMUA 4UFVA 3BP8A 1D5YA 3M1CA 3ISXA 1I1GA 3TC8A 4OIDA 4JJXA 3PO2J 2W82A 3EDPA 2ORVA 3R9FA 3OIOA 4YWYA 1L0CA 3OS1A 4QBJA 4BDYA 3KGQA 1VQNI 2CNSA 2ICWG 3JR9A 3FXMA 1ZK8A 5EX3A 1LANA 3DU5A 2Q51A 3MEXA 2JBKA 3OS0A 4L5IA 4OINF 1Z7LA 3E3VA 5GTHC 5EBVA 2HWVA 3HUGA 1OR7C 3V7ZA 3I1UA 1Z1DA 1G2HA 2J9AA 3RZOJ 1EH6A 2CMPA 1YIJI 2HTSA 3OYLA 5M5XJ 1E3HA 1Z77A 1WVRA 1XEBA 4WXDA 2IL4A 3QAYA 3MKYB 2WCYA 4B1RA 2DF5A 2WY8Q 3TOAA 3SJFA 2CQ7A 3O6BB 2Z3PA 2FMYA 4HRIA 4JWPA 4QWQA 3PIOF 2HDDA 2CNTA 2HB6A 1W5TA 2REFA 2EJRA 1MZBA 2QYVA 2B7EA 2JMWA 4N0BA 3AKZA 4HX7A 4CO8A 3OYAA 1LKXA 4ZYEA 3N5FA 1HJAI 2DU9A 3PSFA 3QPHA 2ZB9A 1LDKB 4Y4RA 4MRIA 3R9EA 4A3FJ 1LPQA 5A28A 3DP7A 1G59A 1YE9A 4JXQA 1E0EA 4A30A 4OC0A 4NBQA 4L0YB 3ISPA 3A2KA 1IIDA 5JHFA 1MDMB 5KTDA 4MI4A 2GAUA 2VL8A 3I54A 1Z8LA 4HSRA 3OYBA 3BG5A 2DPTA 3LFUA 3SEZA 3D7DA 1X74A 2PJCA 1NG7A 2EH3A 4PSXA 2HQYA 2POKA 4P9FA 3PB8X 5IX3A 4HF2A 2LTPA 3VWBA 4IHVA 3I9SA 5EC4A 3UNGC 1K4SA 3OL0A 1XCBA 2EFNA 2P7VB 3DKXA 2EV6A 5FKOA 4A3IJ 4KLWA 4NGQA 4IPAA 1TQPA 5EEGA 3ZMZA 4AIJA 4HOBA 4R3LA 2GIZA 3CCMI 4GYIA 4W97A 3N97A 4R8FA 4P1WA 2IAIA 2IA0A 1QSTA 2A61A 2GA2A 5J1RA 4A12A 1Y8QB 1SGEI 3DPTA 2B0LA 2MH9A 2NU1I 2PIZA 3OYJA 3W2VA 3MZYA 1ZG1A 2UZKA 2YU3A 2BW3B 1T08B 4KFCA 3GLJA 4EV0A 4ZH4F 1NE9A 3WC6A 2V1CA 4FQGA 4A37A 3IAM2 3H0DA 3U1DA 3JUWA 3QOEA 1XB4A 3ZQ7A 2K4JA 3L09A 1UJ8A 2LUYA 3HGGA 5HS9A 1JQGA 2VJ5A 2JWTA 4KICA 3KX2A 3S1RJ 1K4TA 2W48A 2F4IA 2PMHA 2HV2A 1V5EA 1ETKA 3OYIA 1MMAA 4KOXA 1FJLA 1S7OA 3L1PA 4ENJA 4P4DA 2PN6A 3O8HA 4L9JA 4NEXA 5LHIA 5C4JJ 4PK4A 3S6KA 2J8NA 4NCZA 2AE6A 3SHFA 5ISVA 2TCTA 1NXUA 2R7OA 1K61A 4B5OA 3U9GA 2JLMA 4MY0A 3HSFA 1X4PA 2Z3YA 1MSFC 1QO0D 4ON0A 5CCLA 1IN6A 3OYHA 2AFXA 4IHMA 3HM5A 1XSXA 2CW7A 3BLYA 3FF3A 2W84A 2FXAA 4QPOA 2HR3A 4PK2A 2D5VA 2LLKA 4DGWB 5IYBJ 3CUQA 5IYCJ 2JQ7A 1UFHA 2IGOA 2PIYA 4EMEA 3IIBA 2X1EA 1T0FA 2KLOA 2ZXJA 2PFBA 3BJAA 4MHPA 3ZN0A 2BE5F 1IICA 2F7VA 4YG2F 3SYTA 2ANPA 3BLNA 2M7BA 4NGNA 4MHYA 1DTDA 1O3TA 3GFJA 2R7TA 2GOXB 2BOAA 4EVIA 1Q9BA 5EJCA 4E7JA 3S6FA 2DFEA 3BT9A 2RREA 3ABKH 3J80K 1RXTA 4KVXA 1RZ4A 4CAXA 1VQOI 5EF6A 2ZEDA 3TE4A 3I59A 2D1HA 2OPTA 3QYFA 2X48A 1UB9A 3K9UA 1IJWC 1X3WB 2OJED 2Q44A 1ZGAA 2VBWA 2PR8A 1SGQI 4P4FA 3GZ6A 1SAUA 3TMOA 4ANJA 2B3UA 3EY5A 2QGUA 1XPXA 1SMTA 1DP3A 2OZHA 4A0XA 1X19A 2BY2A 2HNHA 3VYRB 4F6AA 3CZ6A 1J4JA 1ERDA 2N8GA 2PJ5A 5EMIA 1HEVA 4KZTA 2JSCA 4KMFA 4KORA 1V5FA 2BHZA 1OJLA 1SGDI 1IN7A 2D2WA 4AIKA 4XOPA 3LQQA 3D00A 2KMUA 2GLOA 4X2TA 5TJJA 2ZJRF 4RAGA 1IXSB 4UVBA 2Q2EA 2R7HA 2BHYA 3PDNA 1CX8A 1FYLA 4ZY2A 5E3NA 2C1CA 1STZA 5H2FC 1YHQI 2EWBA 2QVPA 4MCQA 5JM6A 2RIJA 4HNYB 2XC7A 2BV6A 2QBYA 3WODF 1GXQA 2JVHA 3GZ5A 3JRHA 2R7WA 4RS8A 2ZJPF 2XVCA 2DPUA 2YNDA 1IAWA 2R7RA 2RNGA 4A3CJ 3E5UA 1VQ5I 4UY8I 2L3DA 3J81Z 2IS6A 3BG7A 2XKOA 2CQXA 1XN7A 1F4KA 3LODA 2QQAA 3JTHA 4HG2A 2L54A 4BMHA 4L8AA 3R4KA 4MEYF 2DBBA 3TO6A 3A01A 1PPFI 3R0AA 1VQLI 2ABZA 2J5PA 3KCCA 2PLYA 1I27A 2M4GA 3L2UA 3WTSC 3K6GA 3FWEA 1TXRA 1FOKA 4FD5A 4NXYA 2XF5A 3G8WA 3B73A 1R1VA 2DFIA 1K6OA 3PUBA 5E8GA 4J00A 2NRAC 2IGKA 4P10A 1CSOI 5LRRA 3LQRA 3FMSA 3NH8A 5CJ9A 1QBJA 1XA6A 4Y49C 1KU2A 4HV5A 2E7XA 3S3OA 2H09A 2L8EA 1UVGA 3Q9VA 2F3CI 4EATA 4FE4A 4FD7A 4OU0A 4E7ZA 2PJ7A 3T5XA 4M6GA 2VBZA 5FKNA 5GPAA 3QTLD 1IXRC 1K78A 4P6YA 2Q43A 3ISZA 1HSTA 1R22A 2IA2A 1SFXA 2OU2A 3KP4A 1ZG3A 4IOCF 3NWSA 2V4JC 4DQ2A 1RI7A 3B3TA 4FBEA 1VQPI 4Y15A 2ZPAA 1PJRA 1LR7A 2CUZA 2YUSA 4XBFA 1PUEE 2GKVA 3BR3A 3LACA 5LRKA 3FJUA 4RM3A 4CAVA 2BBYA 2ZMEB 2ZMEC 4JX4A 2VKEA 2A69F 4RLFA 1MBKA 2IXSA 4M73A 1TWCJ 1VF9A 3CLOA 3WTYC 4F0XA 4HLXA 3ZXSA 3MN2A 4CYCB 5CVJA 1VQKI 4UFWA 4Q38A 1VQ7I 2ID3A 5BPDA 1ZYRF 5D6EA 1Z2LA 2JPBA 3CD6I 2BY0A 1UHMA 3CCUI 4CS0B 3ZPLA 4G7OF 1JXSA 3KE2A 2OZGA 1LVKA 1BMOA 3OR2C 3S14J 1TW3A 2KQRA 4YELA 1HDLA 1IOIA 3B3WA 5AG4A 2XB0X 4V2FA 3HOYJ 2FU4A 2W00A 3CCEI 1XRYA 3BC8A 3SEKC 1OKRA 4HX8A 2V53A 1SFEA 1MIJA 5EYRA 4OIQF 2F5VA 5ICEA 4CYQA 2CWEA 5L3DA 3U2RA 3WHCA 3VSLA 4NNJA 2DQLA 2ZOGA 4F3QA 1P9ZA 3GFIA 3EUHC 3MGDA 1FP2A 4UUVA 2Q7BA 2DOAA 4OC3A 2K27A 4UCMA 3LSJA 2KDZA 2L7XA 2KRHA 4HNWB 3GVAA 4I7HA 2RB7A 2MFZA 3M8FA 1Q1HA 4CHUA 5JQ4A 5CCMA 4KT6A 2HEOA 4PCQA 5HDNA 3KPHA 2DEAA 2JEVA 1MMGA 2ZEEA 6PAXA 2ZW5A 3I59B 5L3CA 4HF0A 2VASA 5B66C 4XN3A 2VT3A 1IGBA 1M1EB 2K86A 2QMLA 2A6TA 5HNFA 3PNYA 2CFXA 1XDUA 2OCEA 4MXUA 5CQEA 5K8NA 1DS2I 3P5JA 2LFBA 5F0CA 2JA8J 3DGVA 2TDXA 3CLQA 4UB8C 4CYNA 4F7ZA 3HDDA 3ELKA 3H9GA 1SVMA 3OVOA 4ZTFA 1IN8A 1L3LA 3G3SA 2EZKA 4HYEA 4JZ0A 5BQTA 4HDUA 3OV8A 4LG0B 2QQEA 5FUYA 1WWXA 2EZLA 4E4HA 4C3JJ 3OYCA 3KP2A 1T39A 3B3CA 3B3SA 1I3AA 1Y0UA 5LRGA 2KRFA 4N9HA 1IDZA 1FWZA 4O5VA 3ZGKA 3T90A 2MD0A 2ZELA 1T8IA 1Z6RA 2VB6A 4LIVA 1I5ZA 3DR8A 3CUQC 1CT2I 3HUGB 2QWWA 3L00A 2HPIA 2BXYA 5K1YA 1IF1A 2HFHA 2WWYA 1ZARA 2KJBA 3JSOA 2L2OA 1FNOA 3OOUA 3D5LA 5DM6F 5IYDJ 4UFXA 4M71A 5FKKA 4II9A 3KI9A 3HZJA 2PJAA 2OOTA 3PB9X 1H88C 4H6ZA 5F49A 1H8AC 2BW3A 2WPXA 5HLHA 1IRFA 1LAMA 3GIUA 3GF2A 5IOZA 5FUVA 2V8GA 4LLGF 1Z3XA 4S05A 3CDXA 4I98B 1QZYA 2ID6A 3NH5A 1ULYA 3V7SA 4II2A 2KL4A 2M30A 4CZZA 5B1BH 3COAC 4KDPA 1HKQA 4HEA2 1VKCA 1X10A 3R95A 5IOYA 1LR9A 1QSOA 4BXUA 3UY5A 2JT1A 1H9GA 2DYRH 3SDGA 2KRCA 4HNVA 3IKVA 2B5GB 4KUBA 3E7LA 1HW2A 1IYLA 2A5WA 4PJLA 2GREA 1IY6A 1ARLA 2FNAA 3OWTA 1JE8A 3EUAA 1I3QJ 2WV1A 1BI3A 2K5CA 1J09A 3ZQFA 3G73A 1W1WE 2JUGA 5D29A 2XV4S 5K5QA 1CGJI 3AG2H 4BXFA 5CVIA 2NU4I 1LUJB 2G7HA 3LA2A 3RPUA 4M3BA 1HQCA 4H89A 3B6AA 3BXMA 4PGHA 2HTJA 1RETA 4XKVA 5DEQA 4XLPF 1SGYI 2DODA 4B4CA 2QENA 1HA8A 4A32A 1GT0C 3CCLI 1ONVA 2BVLA 5D5WB 1G6NA 3R1KA 5DTDA 2ETHA 1BO4A 1ULKA 5J8CA 2DK5A 2MW8A 3K1NA 4RMNA 3HC7A 4GRIA 2XRNA 2LF8A 2NS7A 4IHWA 2O4HA 3GYHX 1ZGWA 1YX5A 1VQ6I 2VXZA 1FC3A 1OFCX 1M4GA 3AG1H 4WXCA 3RKWA 4M9SA 1WKXA 3H36A 3QP5A 4TV7A 4U7BA 4EGZA 3P2HA 3PZJA 1UHSA 1MJAA 2DDAA 1ZH5A 2RDPA 1R1UA 1SVOA 5TISC 3ZN1A 5E3LA 3NARA 2VONA 4PQAA 5CNPA 5E96A 3A0BC 4OIOF 2E1OA 2O0YA 3E1SA 5FUWA 4XL9A 4IO9F 2K9NA 2P8TA 1MMNA 3FIWA 1X58A 2LKSA 3CDLA 2QA4I 4ENNA 1H9TA 2VOPA 1WK4A 2P4WA 4DBRA 2V77A 2C27A 1O7LA 3E6BA 1G3WA 4N9IA 3CT9A 3O8GA 1D0XA 2X3TA 2EK8A 2R8VA 2UUZA 4MHNA 4XR6A 2HC9A 1Z7UA 4I09A 2EFOA 4MLOA 1G3SA 2DA4A 3OYDA 1YR0A 1ARMA 1YJWI 3SFZA 2ZEFA 2EV0A 3IC7A 3TL4X 3SJMA 1FLIA 1W7PD 4X0GA 1N77A 4UXHA 2GIVA 3V4GA 3MZ8A 2VPLA 4KITB 3L2RA 1J5YA 4A6EA 4PFOA 1YI2I 2R92J 3CJTB 3TP3A 3LMSA 3NRVA 4CCKA 5KTAA 3K69A 3PJRA 1LFUP 4NC8A 1WGCA 4LLNA 4H6UA 3C2HA 2M45A 3IWGA 1TUSA 4D1QA 3GTKJ 5LRSA 3TP0A 3LOCA 1X1BA 4FHTA 3DU6A 3LA3A 3R60A 4L5JA 3S32A 4FX4A 4KOYA 1VNDA 2JN6A 2MLGA 2ZEPA 2JJ7A 1XX5A 2EZHA 3MMYB 5FUXA 4PXDA 4FCYA 2KPMA 1YVKA 3VB2A 2LBFA 3S2WA 1QQIA 2Y0SN 5ILSA 5KAFC 1RUNA 2QQ0A 1Z21A 1JGGA 1YMEA 2GE3A 3R9GA 3RQIA 1TBRR 2ACJA 2EWNA 3TKYA 1LCPA 2K9SA 3CDIA 4NC7A 1MD0A 2XAQA 1HW1A 4OAZA 3JTKA 3BDDA 4LG0A 2L7MP 4R79A 4RB3C 1X3ZB 1DGRM 1WJEA 2W57A 3NAUA 4UHTA 1BC7C 2C6PA 4NFRA 3ZMUA 4UXJA 5TRDA 2RNJA 2LBFB 5K7ZA 5L3BA 1V1IA 4NC6A 1WFXA 3L2QA 1I50J 3DNSA 3TFYA 3L2NA 1HXDA 1NK3P 2QQ8A 2QZ8A 2UVOA 3EFAA 1OR7A 1TT0A 4PJ0C 4E7IA 4P4BA 1YREA 3WU1B 2QYOA 1SD7A 2V1DA 1PVEA 1U5KA 1F57A 1ZRFA 3VATA 2EA4A 1EV7A 4A69C 2F5DA 1LDDA 3HRSA 4M3GA 2DT6A 4LB6B 5C4XJ 2X6YA 1WSUA 4B43A 1J0RA 1TW2A 3KFWX 5F0FA 3VODA 3WU0A 4XSZF 4PK3A 1X1AA 1BIBA 4B09A 2FCKA 1W4RA 5KAIC 2HXOA 3FM5A 4CSWA 3L2CA 3C7JA 4IF4A 5FB2A 1ULMA 3DDDA 1JUMA 4L0ZB 1YW8A 3F9KA 1VHSA 2JA1A 1OCOH 1K78B 3KHZA 2KKOA 2BEIA 4BAYA 3CPXA 3H3UA 1TWAJ 3K9TA 2CYYA 4HBLA 1CGPA 4CGNA 2GBYA 2Y2ZA 5KCMA 2B58A 2ODFA 3DTEA 2VZYA 2FNPA 3K1PA 4P5OA 1G3YA 1LE8A 1M1DA 1KBFA 1BJAA 5BMZA 1SD6A 1MBGA 3M8EA 2M0CA 3HSEA 2MBFA 4DYRA 1S9HA 2RQPA 4XRSA 4QSHA 1XIXA 1LEBA 5JVGF 1B4AA 4I76A 2N1AB 2NU2I 3WT4A 4MQVA 5BWAB 1Z7KB 3W6JB 3AL0C 3F0AA 4A3LJ 3E5QA 4BUPA 5L3FA 2CIJA 1IW7F 1QA6A 4CAWA 5AG7A 1P6RA 1QSMA 3IC1A 2EB7A 3SQNA 2Z3LA 2ZW7A 4P96A 2M9HA 2OZUA 4EM1A 1G4DA 1PDNC 4HNTA 3ZMTA 2L9SA 1S20A 2K9QA 1XS9A 1MBFA 5LHGA 3ROUA 2CY2A 3K70C 2ESNA 4XKWA 2NYXA 5JHUA 4U0YA 1TWHJ 5EGOB 2WA0A 1VDDA 4ITVA 4JYKA 4U7DA 4NJRA 3IH2A 1WHUA 1VI0A 4LLLA 4XQFA 4R57A 2K9HA 3PB7X 3VYUB 3FK6A 2QECA 4B5PA 4XNHB 3F8FA 1B8IA 3G1OA 1XC5A 1GHCA 5GCNA 4B48A 3MKLA 1S5LC 1U6GA 2DJNA 2OUMA 3I5UA 5ERIA 2QSFX 4A3EJ 1ZR4A 4CGZA 3KP3A 5DWNA 1T56A 4RAFA 1QHHD 1RKTA 4ENMA 4G6TB 1O3SA 2EIMH 4LIUA 3OYNA 3L9FA 2GM4A 3PFIA 3O3KA 3TO7A 4C9YA 1FBUA 5E8IA 3DWLE 1R71A 4LD5A 5CVVA 2CJSC 2C6CA 4UCPA 5DCMA 4IHYA 3SEQA 1RTQA 2B63J 2D45A 2EPFA 4IZZA 1HC8A 2CQQA 2YX7A 3BG6A 1BN5A 4KOVA 5HMNA 5EZGA 1DE4C 2VJJA 4BU2A 3D5RC 1VGYA 4XOTA 1WI3A 3K4KA 1KMAA 3GTLJ 3QWPA 1B72A 3WG9A 2R7VA 4R8HA 4QTRA 1FOYA 1SANA 3E0JB 5HVQC 1TL8A 3AL0B 3C18A 3KHXA 1TBNA 2VI6A 5CQGA 3VWDA 4E7LA 3F22A 4C3IJ 5GAGJ 3WG7H 5JH9A 3GZNB 2I79A 2X85A 4Y49B 4X8IA 1KYZA 3M9AA 2Z5UA 3QNVA 4MEXF 2NMTA 1AKHA 4UIAA 2NYQA 1YTPA 2BOLA 3R5AA 1GYTA 3WTTC 1IOFA 2VJIA 3BTJA 5CPAA 3RPQA 2CNMA 2ZNZA 4B5PB 4C68A 1IN5A 1IG7A 4HAMA 2E5RA 2FF4A 1USTA 1Y1WJ 3F6VA 1PUAA 1PJUA 3FYNA 4PGGA 4F92B 3N05A 4JYWA 3H5NA 2L7ZA 2XPWA 3F6OA 1OCPA 4F9UA 1OYVI 3DF8A 2XDVA 4BD9A 2F48A 3IV5A 2KMRA 2PE3A 1OLTA 3PNTA 4L18B 1HEEA 1TZLA 2RAEA 2JXDA 2SGDI 1WRJA 2XGXA 1TKFA 3JRUA 3VH9A 2WB1A 2XRLA 5B1AH 1NH3A 3H9JA 2YU9J 1X12A 5FLXK 3T8RA 1S7NA 5J8FA 2X0LA 5DD8A 3HOXJ 4E1PA 3PIPF 4E7HA 1Q2CA 4ZGYB 2DO7A 3DEUA 1W7PB 2EZIA 1ZN2A 3HPHA 1P2FA 4XKBA 2P7CB 2UZ3A 1K4JA 4CCNA 2AFOA 4ZDOA 4PJNA 1ODDA 4J3GA 4X5KA 3ULQB 3SGQI 1M4DA 2V9KA 2E1NA 3RQ4A 4P9UA 1IU8A 5K8PA 1ETOA 1E2XA 4BE0A 2YNCC 3I9V2 1Y0RA 1QRYA 4D7NA 2V1NA 3SXNA 2OC6A 1SMYF 3GTMJ 2XIGA 4XK4A 2WADA 2EINH 3LWFA 2DKVA 1KU3A 2OVOA 4OOIA 3T1BA 3N7ZA 3CJQB 4NSQA 1WPKA 3CP2A 3FK7A 5FD5A 4KOTA 2VKVA 4F91B 5BOXA 3GLLA 4Q5SF 1L0OC 2X9DA 3FSXA 5D5VB 4RM2A 3OY9A 2YUUA 4RUHA 1FYKA 2JZMA 3BCBA 3FDYA 3G2BA 3FXRA 4MFZA 3PB6X 4Y7NJ 1TKHA 4P4JA 2FIAA 4DW6A 2YPRA 1H0ZA 3BTCA 2R7DA 5ICGA 1YW9A 3TEDA 1S7LA 1KQ8A 2X51A 4XLAA 3JW4A 1XBTA 2RGVA 2KMQA 3S9NA 1Q1VA 3H8FA 4GI3C 2M0MA 1IGNA 1QNTA 5H20A 3I56I 3T8TA 3HOTA 2KHMA 3KEYA 4QPQA 3ZQCA 1K7TA 3P9IA 3GLXA 1Q2DA 2R98A 4EM0B 4X6AJ 1XJOA 1YS6A 1U8RA 4CYDA 4IXAA 3W2WA 5C82A 1JKQC 2SGQI 3NA6A 4MFPA 1Z8WA 1POGA 2JBJA 2KISA 4MQ9F 3BJ7A 3C2GA 2P6AC 3IFEA 4OMZA 5IB9A 3BI0A 3GBGA 1R58A 3IAS2 1I12A 4W9YA 4MFEA 5K5RA 2MSYA 3CF5F 4KS9A 3Q5FA 5F0HA 1Y7EA 5FD6A 1Y8FA 2EFPA 2HS5A 1P4AA 4M3DA 2EFWA 3OWCA 4G9YA 2K9MA 3GUDA 2G7UA 3WHBA 3RKQA 1ZAOA 1Z5RA 2QJ8A 4HNXB 1T2KA 1JT0A 3T9YA 4ZZLA 2H5MA 3LSIA 2MD5A 1IDYA 2IQ6A 3FXTA 5DS0A 1P92A 3CCYA 2KZVA 2ME0A 2NVUB 4ZC3A 4IHSA 1ZG9A 3K10A 2ENZA 2ARHA 1B9MA 3MAJA 1NUBA 5K7HA 3QOPA 4IRHA 3IWFA 1Z9CA 1FSHA 4A3BJ 4JLYA 5CKTA 3E5XA 2QEXI 1FYMA 1VQMI 5E1WA 4FASD 2Y48A 2ZW6A 4E1RA 2YNCA 4IUSA 5G20A 3JAMK 3J7AY 1FAQA 3QYEA 3BY6A 2NVYJ 2YGWA 5LGNA 5AG6A 1R23A 3LAPA 2GXAA 1MNDA 1KQ9A 3U21A 2CUFA 3ZR8X 4ESJA 4GDFA 4C2MJ 1BBYA 4ZYAA 3OYKA 1IYKA 4A2UA 3RU0A 3HOSA 4MCSA 2SGPI 4BNCA 2V1CC 5GAHJ 2DAOA 5F64A 2FVGA 2CUJA 2UWMA 3PRTA 5D5XB 1ON0A 1X2MA 3K4LA 5ICFA 4CA0A 3A02A 1CQTA 5IP6A 1PCEA 2D4PA 3FIXA 4QB9A 2WV0A 2XASA 3LSTA 2ZJQF 1XBUA 4BBHA 3SJXA 3ABMH 1WCMJ 3G4SI 2CF4A 2YSRA 1ETXA 4K3NA 1RC9A 2CH0A 3VPRA 4S0HB 3ECHA 2JEWA 5M5WJ 1S7KA 2PVVA 2ZEHA 1HDDC 4UUTA 3KETA 3KYLA 1VIXA 3QP6A 5J1YA 1YU6C 1PUFA 2Y75A 2UXXA 1QZEA 1VFCA 1XGMA 3W6VA 2GFQA 7CPAA 1SVLA 1BA5A 3WU2C 2Z3OA 3ASOH 3HLPA 4O6JA 2FEZA 3OOPA 4E70A 5K8MA 3DLLF 1BI2A 2RQQA 3VDUA 3H8GA 1WKMA 4II3A 2M5WA 2IA1A 3R61A 3DXJF 3FH4A 4M3FA 1M8CA 2LSOA 4U0VA 2DI3A 5GAEJ 1Z8XA 4A5MA 4M72A 5H6QA 2BYVE 1TQMA 3H5AA 3I58A 2KMPA 3UGLA 3EUKL 1I1DA 2J5OA 5ICCA 4A24A 1B6BA 1HDQA 5DUKA 5DM7F 3K4BA 3IO1A 1ZLIA 3OR1C 4B10A 2LKPA 2BUEA 2HVRA 1YRNA 4KVOE 1BOAA 2G9DA 2P5KA 4QLCU 4B47A 2P0WA 3KQXA 2WSAA 3EQLF 2DFHA 4Y13A 5IT9K 5D8NA 3DEWA 1UG2A 5HODA 5E3PA 2HZDA 5JLWA 3FXUA 5KTCA 3KKWA 1H0MA 1FBSA 2VE8A 4SGBI 4B13A 2ZMEA 2ECCA 2BY1A 1FPQA 1DPUA 1YRNB 5EZHA 1VTNC 5DD4A 2SGFI 4XLFA 1IV8A 2EUIA 1YQEA 2ZENA 1NTCA 1P7JA 3NEUA 4FETA 5EEAA 1DGWY 2MC4A 2QLZA 2XGEA 4D9JA 1WTJA 1Y1CA 3KLNA 2N52A 1Y7RA 2HKXA 4B6ZA 3I0TA 2PG4A 1BAVA 2PRBA 5LYDA 2QIRA 2DMTA 2GZWA 2CV2A 3DPUA 2OV7A 2NOGA 4IVNA 2A20A 1CF7A 1QHGA 3BQZA 1R6RA 2Q04A 3TJQA 2V7FA 4Z6YA 4F8ZA 1UELB 3Q3SA 1FNNA 4EJVA 1LOKA 2H8WA 4G8XA 2VIXA 3GYAA 5AIQA 3WGGA 3EETA 5BNGA 1HDUA 1FOWA 2PJ0A 2VT2A 3RO0A 5JGFA 3B35A 5IT3A 1XE4A 1Z0XA 3MD2A 3BI1A 4KUAA 2A6HF 1WGTA 5IP9J 4M85A 3EYIA 2VQHA 2OQRA 2Y0SA 3ABUA 1JI8A 1JJ8C 1LDJA 4JP0A 1TWFJ 5LFAA 4IHXA 2NVTJ 3ERMA 3MFKA 1EKEA 4Q4ZF 4ZX9A 3A9LA 2CW8A 2G3TA 1R00A 3B8GA 2HZTA 2I8DA 3SXYA 1W4MA 3IRRA 1R79A 3H5ZA 2M5XA 1HKSA 4A0ZA 5JPHA 4WWVA 3IGRA 4UWIA 5AG5A 1GDTA 1IO2A 5CPRB 1SEUA 3W6SA 4PSWA 3WGIA 1ZRCA 1DS3I 1NSLA 1N75A 2VEZA 5HDGA 3UFFA 1W0TA 3FECA 1SFOJ 2PMZA 4LMYA 1YX3A 4OAYA 5GPCA 3OS2A 1VHOA 2G0BA 2DMPA 2K3PA 3HB9A 3M7GA 1MGTA 5FRMA 1ELLP 2DT7B 4BH9A 2V26A 1PTRA 2COMA 4AYBN 2AO9A 1LRZA 4XN0A 3HYIA 3BQYA 1HSJA 2VUMJ 2Q7SA 2NU3I 2E19A 2V9PA 2O03A 4ENKA 4RGXA 2BCOA 3CZXA 2MH2A 2L7KA 2Z33A 1XOVA 1D1CA 4A38A 2Z3KA 1OPCA 1GXPA 1Y9WA 5HQ8A 2V6CA 2LH9A 2ELKA 2IVMA 1HKTA 2XSJC 4EJUA 1D1BA 4P45A 3B7IA 2R1IA 2E1MB 4IJAA 2HVSA 4ONUA 4YRHA 4JX6A 1WJCA 5JVTA 3H35A 4JD6A 3ERED 1BC8C 4MHDA 2L7FP 2GQQA 2XROA 5IT9Z 4BEHB 3F3XA 4J19A 5A27A 2X7BA 3C1DA 4MJ8A 4NGRA 4WX9A 3R5DA 1JWQA 2Q4YA 3ZQGA 3IKTA 2IJZA 5DWMA 5DUIA 2O61A 1R5ID 2GA1A 1YOVB 2GOMA 3Q0VA 1MKMA 4FUUA 2PJ2A 3U1KA 3TX8A 3CESA 3SJEA 3E6MA 2FIWA 1WH5A 4UVAA 4EJTA 3I4NJ 2K85A 2BO9A 4ASNA 2VRWB 5CYVA 1E3PA 4RLQA 4ESBA 5F08A 1D0ZA 3RYPA 2B3VA 2BVMA 1KQ0A 1HLVA 3R0JA 5J4VA 4CGMA 1M44A 4GS4A 4OLLA 2E5ZA 4ZBGA 3JVNA 1QQ9A 1T33A 4V2GA 3D68A 4OMYA 4WK8F 1P4WA 4UUSA 2XEGA 3PFEA 1U0JA 2DA2A 1J2XA 1ON1A 3L7WA 1XDSA 1MBJA 1Y56A 5GADJ 1F2OA 2H6CA 4NGTA 3HJEA 2JTVA 1AN1I 2ZNYA 3S1MJ 3HL2A 2JA5J 4K30A 1AOYA 3V8KA 1GV2A 2NSMA 2FNFX 1LFPA 3H4QA 2EBIA 2CFOA 4N4OB 1BR1A 2PJ8A 5C44J 3RBUA 1FYBA 3HKZA 4A5NA 5KNLA 1TC3C 4AD9A 5HI7A 1YSJA 3GMEA 2V1XA 1R9TJ 4JK1X 3RKXA 2L01A 4IF5A 2RV8A 3ZQHA 2PMZN 2DA1A 1HBXG 2KFDA 3CUOA 4MCRA 1LAPA 3CMMA 1NK2P 1OCRH 3JRIA 1EH8A 1TBOA 3CXSA 4NDLA 2GWRA 4XMYA 4XRFA 2A07F 4XLCA 3G71I 3KZWA 2B5GA 1NHAA 1FY7A 1YW6A 1S3JA 1ON2A 4E0AA 3I53A 2ZW4A 3MCZA 1D5VA 2M8EA 1Z67A 2XF6A 3W6KB 4ZJZA 2XUBA 3J7ZI 1MSEC 3VSKA 4KN4X 1OVOA 2Z3NA 3NFZA 2CJJA 3CDHA 3JRBA 2X6OA 3KP7A 4UUSB 4E6KG 4U9ZA 4FTHA 4BQNA 1W0UA 1Z8TA 1T95A 3H92A 3VARA 4G1PA 4IAVA 2V6EA 3VEPA 3I4PA 4KA4A 4RB1A 2DOFA 1F43A 3QWLA 1YLFA 2XAFA 4WF2A 3BPXA 4LQGA 3LSPA 3OSFA 2MA3A 2IS1A 4MO7A 3ECOA 2V8VA 2VBYA 4XRMA 3S1NJ 3B02A 4BHPA 4BKXA 1ORKA 2DT5A 2ELHA 2F5IA 4OC2A 2CG4A 1FP1D 1RUOA 3HIFA 2VOOA 2B0UC 3DCFA 5LHHA 2FE7A 2JA2A 4BQQA 5LEJA 3WABA 3FM3A 3ZMDA 1IUFA 2K40A 2M2EA 3FXJA 2NAZA 5D5UB 4BQAA 4OIWA 1SFKA 4E8OA 4LFUA 1ZLKA 4UVCA 4CYCA 1EF4A 4W1UA 1R5HA 4L9TA 2ZXVA 3S8PA 4B8XA 2IS4A 2Y0MA 1EH7A 2XAJA 4I99C 4C2UA 3RCOA 1PP7U 4IQ4A 3S3NA 3IWZA 2CV1A 2MC3A 4PXCA 2H1KA 3K70D 3V7RA 1WJBA 1SC7A 2VQCA 4BXXJ 5CVRA 3F8CA 1M4LA 2DFFA 5FFZA 5HLGA 3DKYA 3UOEA 1X1DA 1GVDA 4LGWA 2Z2SB 3QODA 4PDKA 3KYCB 2XSDC 2DA5A 4CCMA 2F5EA 5E18F 5J40A 2BUSA 1FTZA 2PC1A 1YQAA 2XAGA 3KEQA 4M6YA 5K7FA 5DCFA 3IEHA 3VOEA 4UEFA 3OXLA 4UIBA 1S7AA 1W5CC 4WJBA 2LRDA 2FBIA 4GXOA 4YIRX 2VE9A 3D7FA 5CVUA 3W6XA 2O3FA 5CLSA 3FEEA 1J7KA 2AQFA 3FVLA 4G7ZF 4FKDA 2LK2A 4AIHA 3PBEA 3J7YJ 2EK9A 1V3FA 4LB5A 2P5VA 4JCVE 9ANTA 1AYEA 4AB7A 4Z2YA 2L02A 4MIMA 1IY5A 3DV8A 3MWMA 2GXBA 4CGLA 3I64A 1ETVA 3LSMA 1IRXA 5E1XA 1JKOC 1IUYA 2ZSIB 4E7SA 4ETSA 1FX7A 2NS0A 3RYRA 2KCXA 1AHDP 1R0RI 2V79A 2IJLA 2MLKA 1J59A 2N71A 4BGDA 5E3OA 4NHJA 2FS5A 2V1UA 4AG9A 2A05A 4BS9A 2DK8A 4RBOA 1O7FA 1U6MA 1R1TA 1UVFA 3BWGA 3HG9A 1FEXA 3E59A 1CBXA 2V8DA 3IL2A 1MH4A 1R4NB 3CMAI 2HDCA 1TIHA 4QVTA 1TBQR 4D5FA 7WGAA 3S6GA 2Q4ZA 1FARA 2FQ3A 4XORA 3CQZJ 4ZY0A 2QVOA 2OTLI 2F5CA 1X1PA 2EV5A 3SI1A 1BL0A 4PJJA 4IQJA 4J01A 1BIAA 3RSNA 3S3MA 1YITI 5DV5A 3GX4X 3MZHA 2FJ1A 2FOWA 5GP9A 4AG7A 3M07A 2JDDA 3IH3A 3LWUA 1YW7A 4UXNA 1QMUA 2LD5A 1J75A 2H27A 1U5TB 4ABZA 1P0HA 2OB0A 4AVBA 1I21A 1B72B 2GLJA 3B6CA 3LL7A 4ZZDA 2E1MC 4YEJA 3P9CA 3CO6C 1EA3A 1FTTA 3K4NA 2JZYA 2FA5A 3ABLH 3KYDB 2PCUA 4GO1A 3W2AA 1S6LA 2WAFA 4ZI6A 2VBQA 2GKTI 2HYJA 4DYCA 4FWUA 1DUXC 1D1AA 3ZCOA 4I49A 3G1LA 4UV8A 1G3TA 4LUAA 2WAEA 1ZQ3P 1RO5A 4U5YA 3KIOA 1XG1A 1OQYA 1OYYA 5DCMB 3TO9A 2J8RA 4OP4A 1XCVA 3DTIA 3HEFA 5ED4A 2A3SA 3FHNA 3RPUD 3LSHA 1VQ8I 1QVUA 2VODA 1BR4A 2DOEA 2OD1A 2HQRA 2LKXA 1M8BA 4IRGA 2H94A 2CU7A 3JSPA 4ZYHA 4V19K 1ZLHA 4MNUA 4MY3A 1ZG5A 3E2IA 2W25A 1B6AA 1D8KA 2HQAA 2LYCA 3DKWA 1GUUA 2DJIA 2P5LC 3CO7C 4AYBA 2R5YB 4O3MA 1IY7A 4X3RA 3R96A 3D5SC 1TURA 2VL1A 4NGPA 4Z65A 2R7QA 1ELMP 1R5GA 3V38A 1MJBA 3ZQIA 2XEFA 2WUUA 5J3LA 3FKIJ 3FBIB 2KIQA 5E1ZB 4M6XA 2HUZA 2WB1N 4JX5A 4Y3OA 5DDGA 1IRGA 1XGNA 1E17A 2GKRI 3PSIA 2JA6J 2I10A 3BOQA 5FLXZ 3FB3A 2CTCA 2KJCA 2A5YB 1EJ9A 4B12A 3FX3A 2W4SA 1WJFA 2OCCH 4LQ6A 3CUQB 3NQOA 5F04A 4F93B 1AKHB 1DU6A 3HOVJ 2OQGA 2FBHA 3JREA 2W1OA 1RR8C 4U9YA 4F9VA 3PL8A 2BSWA 1WZ2A 5EX0A 1CP7A 4FT8A 3Q0WA 1KUYA 3DR6A 2ZFWA 2IW5A 3CCVI 1Y0YA 4M3SA 2DA3A 2WAQA 4ZTJA 2R4GA 5JFRA 1MW7A 5HDKA 3J80Z 2ISZA 5HVFA 2CWFA 2Y9YA 3BZKA 5G22A 1W3SA 4MHGA 4CGPA 1YIOA 2XPUA 1CHOI 2R7UA 2X52A 2VLAA 3JRCA 3FXLA 3IWEA 1Y8RB 5D4RA 2VQGA 4XONA 3ASNH 4EFDA 2JRMA 3TDUC 3K4MA 2PR1A 3M4OJ 1U3EM 5E3RA 5EEHA 3KASA 1AU7A 3CXPA 2PJRB 5M3FJ 3F8MA 3BG9A 3E0KA 3HRTA 1FMVA 1W36C 5THWA 2W0TA 1PTQA 4KIBA 4WCGA 2L0KA 1K79A 3NH4A 1Z3YA 3EXNA 3M8JA 5E3QA 5ILUA 4HNUA 1KZFA 1PP8F 1O57A 2FOKA 4HQMA 2IS2A 1QU3A 4Y33A 4AUXA 4B6DA 4C7IA 3DFGA 4XPLA 1Z9UA 1QGPA 1KA8A 1JKPC 2AFSA 2UXNA 2Z9OA 3MN8A 4UEEA 5ILVA 4B44A 3NWTA 4EVYA 2HOSA 3HPGA 3OMYA 2P6EA 4UXIA 2O28A 1WJAA 3HOZJ 4P44A 2MG4A 1Z4RA 3BCAA 1KUVA 2PRQA 3VYTB 4ORFA 1S60A 2VXKA 2WTEA 2HKOA 2YR2A 3KP6A 5HVGA 4E2AA 5EDNA 2CRGA 2K4BA 3LAJA 2QQCA 3A03A 3UEYA 4OC5A 1XD7A 2M8GX 2VC1A 2JVGA 2ZEGA 4P4IA 2LREA 2V8HA 3OXGA 5J1UA 2ZEMA 4ZDLA 5F48A 2DXQA 2E7WA 3R6SA 3LSRA 1S8NA 3CXQA 2NS8A 4L9MA 1YTYA 2VXDA 3VWEA 4MHZA 2KIMA 3A0HC 3WTZA 1KGSA 4NUBA 3WTUC 4XLNF 1GHEA 3D8PA 4C7HA 3K4CA 1R7JA 1SGRI 3K1MA 2ZFUA 4L89A 5B5EC 1MH3A 2QBYB 3LSKA 1IN4A 1Z91A 2P6TA 2Z1DA 4AC0A 2O5RA 2A4NA 2BY3A 3IJ3A 2TRTA 3GCMA 1UCRA 3ZMVA 3ZP5A 3GY9A 3SFIA 4AIDA 2ECBA 3A4CA 2FQ4A 3SHPA 3JTGA 3BJIA 1MK4A 4BDZA 2YQPA 2E5NA 5AGEA 2XPVA 2DTZA 2E36A 2PMUA 1U8BA 1SGPI 5F6FA 3GFMA 3RZDJ 2AHQA 3F5BA 3G1MA 2F8HA 3KZYA 1O4XA 4N4NB 5BPIA 3MQ0A 4RGUA 1OYIA 1R49A 1SFUA 3QPLA 5DAEA 4YU9A 2QF7A 4KSFA 2WAQN 4BJTA 3DLJA 1SD5A 1NMTA 2HU9A 4KMUX 2DCEA 2JW6A 2JDCA 4XNHC 4NQWB 3TCVA 2IRFG 2E35A 3BPVA 2PQ8A 1JKRC 5LYIA 1LFBA 4RA2A 3F8NA 2EA2A 2PJRA 2RN7A 3F72A 3GTQJ 3FBUA 2CSOA 2IPQX 4MFLA 2N17A 4UEZA 2FRHA 3A1YA 1F5TA 5FKMA 1ZREA 1UMQA 2ODDA 4PPZA 1B8IB 1XSVA 2EQRA 1X4SA 3WC7A 1T0FC 2QKLB 2XHKA 3DPLC 2CO5A 2QQ9A 1J9IA 3HKZN 1V5GA 4CUGA 3ZJ0A 4RAZA 4HKFA 5LGUA 1JUPA 1IXCA 4XPKA 2A68F 2WGCA 3GWZA 3VE5A 2VZZA 4C2XA 2HOEA 2E2HJ 3IH4A 4HW0A 1CPXA 4FAIA 2KT0A 2F6CA 5KHDA 3H0GJ 3CMEI 1D8JA 3KR4A 5C3EJ 2OZ6A 4GCVA 3WGHA 1NSAA 3MVPA 2VBXA 5F09A 1ETYA 2JK3A 2DMNA 3QPSA 3D66A 1F9NA 3KP5A 2NXNB 3I4MJ 1FBQA 1A04A 2FX0A 4KOWA 3EO4A 2CQKA 4B3AA 2DLLA 1W5SA 5FLMJ 4G94A 1XMTA 3BG3A 3WE3A 1JJ6C 4EMSA 3BZ6A 3D0SA 3ESWB 3RTRA 3FNCA 5HH1A 4C2ZA 1WI9A 2AQEA 4RAYA 2F4MB 5E17F 4CCLA 4DBQA 2G3AA 3WTWC 3AG4H 2JPCA 2DA6A 2W24A 3FISA 2ZO4A 5GTIC 3RI4A 1YJNI 1ZRDA 2FT0A 5FFXA 2PEXA 2OR4A 1DQUA 2P81A 1FMWA 1K83J 2FD5A 1XSDA 1KZHA 3TBIA 2XEJA 2X1DA 1XMKA 1CM0A 3TT2A 1TNSA 3I3GA 4C2YA 4GYGA 3ZOBA 3UGIA 4MFKA 1Y1VJ 2OAZA 3CCJI 3L2VA 4KT5C 3GEZA 1JT6A 3FSYA 4FD4A 4PXBA 1S72I 3EYYA 2L9VA 3KZIC 1ZTRA 1DU0A 2GU2A 2DXIA 1I6HJ 1IRZA 1AWCA 1RKWA 4I6ZA 3HRMA 3K4JA 5D8LB 3OIPA 3J7AO 5FGMA 1W36D 3BR5A 2Q1ZB 3FC3A 4KSAA 3F21A 8CPAA 4L9NA 4OIRF 3IRQA 4AVCA 4M74A 4I01A 1LVAA 2RVCA 2ARPF 1UFMA 2Z16A 2GVIA 3UGDA 2PBIA 3NE7A 2RKHA 3AG3H 2GXGA 2LDUA 3H8EA 3P2FA 2CS3A 5HXDA 1RNLA 1ZELA 2KIFA 2RC4A 4IHTA 3CXLA 3IWWA 3ZMSA 4DNCA 1DP7P 2E73A 1YG2A 2WBMA 2X6XA 4CH7A 4L5EA 5TGTA 4IRIA 1KBEA 3WR7A 4DYQA 1KYWA 3CC2I 2Z0ZA 3QB8A 2RFHA 1BW6A 3K2KA 2FL4A 2LG4A 4AU7A 5F1RA 2EK5A 3D2MA 2BEOA
chains in the Genus database with same CATH topology
1FT9A 3AAFA 4R87A 2W85A 4KUMA 5BS6A 2JRTA 3P7NA 1D3YA 2LF7A 1SAXA 3E6DA 3SZPA 3BJ8A 5FVJA 1ZO0A 3QAHA 3I71A 4F0YA 3RKYA 4CRZB 3ABTA 4OAEA 1O3RA 4EM2A 4HV6A 5JR3A 3GFLA 3EC4A 3GKRA 1FZPB 3N4MA 3V8LA 4RB2C 2C6YA 1ZLJA 3GO5A 2KIUA 1TQIA 5LLQA 2D1VA 1W7PA 2E1CA 1B1BA 1QSRA 2M1BA 3P9KA 2BL1A 3KZZA 1USSA 1B59A 4LJZF 4BYYA 3WTXC 5G21A 4EGYA 1XGSA 1TBXA 3KLOA 4MTDA 2CXAA 4FD6A 4I0AA 3S6HA 3GXOA 4G6DA 3Q9SA 4JXRA 1REPC 4YFKF 3HHGA 2K7LA 2OBPA 4YFXF 4RI1A 1CF7B 1S3ZA 1YFHA 2O6GE 4D0PA 3D2PA 3QU6A 3W91A 2IP2A 2FSWA 4YFNF 5JI6A 2STTA 2ADUA 4CXFA 5HLIA 4UCNA 4JQFA 3FXQA 3J81K 3HTSB 3LD2A 3RJPA 2DPDA 3G3ZA 4BHBA 4KNYA 3K0LA 4OIPF 1RIOH 1LNWA 4HF1A 3F23A 1S7FA 1S29A 3RYOA 4R3KA 1V4RA 5HOOA 4NF1A 5D4SA 4KN7X 3H3ZA 2QM3A 2ESHA 2AJ6A 2ZCWA 2L4AA 3S6FA 4L9VA 5LBQA 2V9VA 1TTYA 2Z11A 3BJOA 3QRFF 2K02A 2YNEA 3EUHA 1Z4EA 3F8BA 4LX9A 5IB0A 2K5TA 1V0CA 4A31A 5DYMA 4UA3A 3RDIA 3V7CA 2J8MA 1IZ1A 4RGRA 4CDGA 4HLYA 2KCWA 4ZYGA 3QPTA 2CGPA 3K2ZA 1B87A 2EFQA 4QC6A 3WTVC 1S5KA 1BI0A 3TOBA 1XMAA 4PZJA 5L3GA 4P55A 4I0BA 4NQWA 1YYVA 2HYGD 4M9XA 1JGSA 1SD4A 1Y9KA 1BM9A 4MFQA 1P4NA 5C88A 4XPDC 1B9NA 2F2EA 3T0YA 2Q8KA 4OADA 5IV0A 4H0EA 4BHCA 1WWZA 5H6RA 5A2QZ 4LK1F 2ZBKA 5F46A 1TLHB 2IT0A 2Z3MA 3TGNA 3TDZC 3IHUA 3DSBA 4KIFA 4NB5A 4A6DA 5A2QK 1I6XA 4KOSA 2FE3A 2NNYA 1U5TA 3QU3A 3O2PE 2B4DA 4KOUA 1LJ9A 3CJNA 1MDMA 3M1EA 5H84A 1XF8A 2ISYA 1YO5C 3KEOA 4U88A 1IB1E 5HS7A 2B4DB