3UEYA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVFNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Protein kinase C delta type
publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
source organism Mus musculus
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ueyA01
1Y8FA 1KBEA 4UXIA 4UXJA 1TBNA 1PTRA 2B8TA 2UZ3A 1KBFA 3KY9A 2ORWA 2GVIA 3BJIA 2FNFX 1FAQA 4UXHA 1PTQA 1R79A 2E73A 4FKDA 5FUXA 5FUWA 2VRWB 3E2IA 3UGDA 2J9RA 1W4RA 5FUVA 1XX6A 3UGLA 3UGIA 4B6DA 1RFHA 2ROWA 3UEYA 3UEJA 1FARA 1XA6A 2J87A 2JA1A 2YUUA 3CXLA 2DB6A 2ELIA 3UFFA 2WVJA 2QQEA 2ENZA 2QQ0A 5FUYA 1XBTA 2QPOA 2ENNA 4L9MA 1TBOA 2ORVA
chains in the Genus database with same CATH superfamily
4E1PA 2SGEI 1M8BA 1TBQR 1OVOA 3TOAA 1TBNA 3TO7A 3R5DA 3RU0A 1CT0I 3QWPA 3OXLA 2GVIA 1LR9A 3OXFA 2GIVA 3FSXA 1R79A 4UXHA 5E3RA 1UVFA 2KMRA 4FKDA 3FSYA 2BUSA 5DAEA 1V1IA 3PDNA 5FUXA 2JYYA 5HI7A 3E2IA 3UGDA 1CHOI 1K7VA 1MJ9A 1S20A 1R0RI 1XX6A 2PQ8A 1Q9BA 3UGLA 2GKVA 1M8CA 3UEJA 1FARA 3QTLD 1SGQI 3UOEA 2ARPF 1NXUA 2L8EA 2YUUA 3CXLA 1FYBA 3TO6A 1YU6C 2ELIA 1BUSA 1WGCA 2ENZA 1OMUA 2NU3I 2B0UC 2V53A 2V1CC 2Y0MA 1OMTA 1BMOA 1Y1BA 1MJBA 1CT2I 5E3PA 2WGCA 1HDLA 4UXJA 1DS2I 2CWFA 2UZ3A 2WCYA 3VE5A 3KY9A 2F3CI 2NU1I 1TURA 2CWHA 2GKTI 2ORWA 3B4VC 1V1HA 1Y1CA 7WGAA 3BJIA 1DS3I 3GOXA 2E73A 2KMOA 2OZUA 4HGUA 3TJQA 1SGEI 2A20A 2SGFI 1SGPI 2CJSC 2J9RA 5CCLA 3UGIA 1RFHA 3R5CA 2LEOA 3R5AA 4JCVE 4OVOA 1IW4A 1PCEA 4DNCA 3E59A 1OYVI 1PPFI 1HJAI 2WVJA 3UFFA 2QQEA 5E3QA 1H0ZA 2QQ0A 1XBTA 1UUCA 2NU2I 4L9MA 1MT1A 1VDDA 4A24A 2JXDA 1HEVA 5HQ8A 1Y8FA 2E5RA 2JW6A 2LUYA 1LR8A 2B8TA 2KCXA 1KBFA 2SGPI 1ULNA 1TBRR 2DKVA 1FAQA 2FNFX 3VDPA 3HH2C 5J8FA 1AN1I 1FY7A 2L7XA 2UVOA 3MEKA 5FUWA 5J8CA 1SGRI 2K9HA 3SGQI 1W4RA 2M5XA 3OXGA 2QQDA 1Z7KB 4MPIA 5EX3A 5FUVA 3VDUA 4B6DA 1CE3A 2J87A 1IY6A 1SGNI 2YQPA 4WP4A 3SGBI 2N1AB 2CWGA 2ODDA 3SEKC 1Z2IA 2DIPA 3D00A 3TO9A 1UHAA 2LB7A 2KMQA 1TUSA 2QQCA 2QPOA 1P9ZA 1ULKA 2X3TA 4GI3C 1WKXA 1TOTA 2NU0I 3R5BA 2ORVA 2OU2A 2SGDI 1KBEA 3OVOA 1KMAA 2OVOA 4UXIA 1ULMA 1PTRA 2RIJA 1WTJA 1N13A 1X74A 1YTPA 2NU4I 2OD1A 1IY5A 1CGJI 3FC3A 1PTQA 5EX0A 1HPTA 1SGDI 2JZMA 2P6AC 2VRWB 2W0TA 1K7TA 2XRCA 2V1CA 1TIHA 1K7UA 2RC4A 3OL0A 1W3SA 4AMLA 9WGAA 2ROWA 1CT4I 1CGII 2SGQI 3UEYA 5JHWC 1XA6A 1TGSI 3TOBA 2JA1A 2N17A 4SGBI 1U5KA 1SGYI 2DB6A 2KMPA 1PJUA 2GKRI 2N52A 1CSOI 3QAHA 2ERWA 1MJAA 1X4SA 1LR7A 1P9GA 1WGTA 2ENNA 5FUYA 1UVGA 5CCMA 1TBOA 2N71A 2X52A 4E1RA 1NUBA
chains in the Genus database with same CATH topology
4E1PA 2SGEI 1M8BA 1TBQR 1OVOA 1TBNA 3RU0A 1CT0I 3QWPA 3OXLA 2GVIA 1LR9A 3OXFA 4UXHA 1R79A 1UVFA 2KMRA 4FKDA 5DAEA 2BUSA 5FUXA 1V1IA 3PDNA 2JYYA 5HI7A 3E2IA 3UGDA 1CHOI 1R0RI 1XX6A 3UGLA 2GKVA 1M8CA 3UEJA 1FARA 3QTLD 1SGQI 2ARPF 2L8EA 2YUUA 3CXLA 1FYBA 1BUSA 1YU6C 2ELIA 2ENZA 1OMUA 2NU3I 2B0UC 2V53A 2V1CC 1OMTA 1Y1BA 1BMOA 1CT2I 1HDLA 4UXJA 1DS2I 2WCYA 2UZ3A 3VE5A 3KY9A 2F3CI 2NU1I 1TURA 2GKTI 2ORWA 3B4VC 5JHWC 1V1HA 1Y1CA 3BJIA 1DS3I 3GOXA 2E73A 2KMOA 4HGUA 3TJQA 1SGEI 2A20A 2SGFI 1SGPI 2CJSC 2J9RA 5CCLA 3UGIA 1RFHA 2LEOA 1IW4A 4JCVE 4OVOA 1PCEA 3E59A 1OYVI 1PPFI 1HJAI 2WVJA 3UFFA 2QQEA 1H0ZA 2QQ0A 1XBTA 1UUCA 2NU2I 4L9MA 1MT1A 1VDDA 4A24A 2JXDA 5HQ8A 1Y8FA 2E5RA 2JW6A 2LUYA 1LR8A 2B8TA 2KCXA 1KBFA 2SGPI 1TBRR 1FAQA 2FNFX 3VDPA 3HH2C 1AN1I 3MEKA 2L7XA 5FUWA 1SGRI 2K9HA 3SGQI 1W4RA 2M5XA 3OXGA 2QQDA 1Z7KB 5EX3A 5FUVA 3VDUA 4B6DA 1CE3A 2J87A 1IY6A 1SGNI 2YQPA 3SGBI 2N1AB 2ODDA 3SEKC 2DIPA 3D00A 2KMQA 1TUSA 2QQCA 2QPOA 4GI3C 2NU0I 1TOTA 2ORVA 2SGDI 1KBEA 3OVOA 1KMAA 2OVOA 4UXIA 1PTRA 1N13A 1X74A 1YTPA 2NU4I 2OD1A 1IY5A 1CGJI 3FC3A 1PTQA 5EX0A 1HPTA 1SGDI 2JZMA 2P6AC 2VRWB 2W0TA 2XRCA 2V1CA 1TIHA 3OL0A 1W3SA 2ROWA 1CT4I 1CGII 2SGQI 3UEYA 1XA6A 1TGSI 2JA1A 2N17A 4SGBI 1U5KA 1SGYI 2DB6A 2KMPA 1PJUA 2GKRI 2N52A 1CSOI 2ERWA 5FUYA 1X4SA 1LR7A 2ENNA 1UVGA 5CCMA 1TBOA 2N71A 4E1RA 1NUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8F A;  1KBE A;  4UXI A;  4UXJ A;  1TBN A;  1PTR A;  2B8T A;  2UZ3 A;  1KBF A;  3KY9 A;  2ORW A;  2GVI A;  3BJI A;  2FNF X;  1FAQ A;  4UXH A;  1PTQ A;  1R79 A;  2E73 A;  4FKD A;  5FUX A;  5FUW A;  2VRW B;  3E2I A;  3UGD A;  2J9R A;  1W4R A;  5FUV A;  1XX6 A;  3UGL A;  3UGI A;  4B6D A;  1RFH A;  2ROW A;  3UEY A;  3UEJ A;  1FAR A;  1XA6 A;  2J87 A;  2JA1 A;  2YUU A;  3CXL A;  2DB6 A;  2ELI A;  3UFF A;  2WVJ A;  2QQE A;  2ENZ A;  2QQ0 A;  5FUY A;  1XBT A;  2QPO A;  2ENN A;  4L9M A;  1TBO A;  2ORV A; 
#chains in the Genus database with same CATH topology
 4E1P A;  2SGE I;  1M8B A;  1TBQ R;  1OVO A;  3TOA A;  1TBN A;  3TO7 A;  3R5D A;  3RU0 A;  1CT0 I;  3QWP A;  3OXL A;  2GVI A;  1LR9 A;  3OXF A;  2GIV A;  3FSX A;  1R79 A;  4UXH A;  5E3R A;  1UVF A;  2KMR A;  4FKD A;  3FSY A;  2BUS A;  5DAE A;  1V1I A;  3PDN A;  5FUX A;  2JYY A;  5HI7 A;  3E2I A;  3UGD A;  1CHO I;  1K7V A;  1MJ9 A;  1S20 A;  1R0R I;  1XX6 A;  2PQ8 A;  1Q9B A;  3UGL A;  2GKV A;  1M8C A;  3UEJ A;  1FAR A;  3QTL D;  1SGQ I;  3UOE A;  2ARP F;  1NXU A;  2L8E A;  2YUU A;  3CXL A;  1FYB A;  3TO6 A;  1YU6 C;  2ELI A;  1BUS A;  1WGC A;  2ENZ A;  1OMU A;  2NU3 I;  2B0U C;  2V53 A;  2V1C C;  2Y0M A;  1OMT A;  1BMO A;  1Y1B A;  1MJB A;  1CT2 I;  5E3P A;  2WGC A;  1HDL A;  4UXJ A;  1DS2 I;  2CWF A;  2UZ3 A;  2WCY A;  3VE5 A;  3KY9 A;  2F3C I;  2NU1 I;  1TUR A;  2CWH A;  2GKT I;  2ORW A;  3B4V C;  1V1H A;  1Y1C A;  7WGA A;  3BJI A;  1DS3 I;  3GOX A;  2E73 A;  2KMO A;  2OZU A;  4HGU A;  3TJQ A;  1SGE I;  2A20 A;  2SGF I;  1SGP I;  2CJS C;  2J9R A;  5CCL A;  3UGI A;  1RFH A;  3R5C A;  2LEO A;  3R5A A;  4JCV E;  4OVO A;  1IW4 A;  1PCE A;  4DNC A;  3E59 A;  1OYV I;  1PPF I;  1HJA I;  2WVJ A;  3UFF A;  2QQE A;  5E3Q A;  1H0Z A;  2QQ0 A;  1XBT A;  1UUC A;  2NU2 I;  4L9M A;  1MT1 A;  1VDD A;  4A24 A;  2JXD A;  1HEV A;  5HQ8 A;  1Y8F A;  2E5R A;  2JW6 A;  2LUY A;  1LR8 A;  2B8T A;  2KCX A;  1KBF A;  2SGP I;  1ULN A;  1TBR R;  2DKV A;  1FAQ A;  2FNF X;  3VDP A;  3HH2 C;  5J8F A;  1AN1 I;  1FY7 A;  2L7X A;  2UVO A;  3MEK A;  5FUW A;  5J8C A;  1SGR I;  2K9H A;  3SGQ I;  1W4R A;  2M5X A;  3OXG A;  2QQD A;  1Z7K B;  4MPI A;  5EX3 A;  5FUV A;  3VDU A;  4B6D A;  1CE3 A;  2J87 A;  1IY6 A;  1SGN I;  2YQP A;  4WP4 A;  3SGB I;  2N1A B;  2CWG A;  2ODD A;  3SEK C;  1Z2I A;  2DIP A;  3D00 A;  3TO9 A;  1UHA A;  2LB7 A;  2KMQ A;  1TUS A;  2QQC A;  2QPO A;  1P9Z A;  1ULK A;  2X3T A;  4GI3 C;  1WKX A;  1TOT A;  2NU0 I;  3R5B A;  2ORV A;  2OU2 A;  2SGD I;  1KBE A;  3OVO A;  1KMA A;  2OVO A;  4UXI A;  1ULM A;  1PTR A;  2RIJ A;  1WTJ A;  1N13 A;  1X74 A;  1YTP A;  2NU4 I;  2OD1 A;  1IY5 A;  1CGJ I;  3FC3 A;  1PTQ A;  5EX0 A;  1HPT A;  1SGD I;  2JZM A;  2P6A C;  2VRW B;  2W0T A;  1K7T A;  2XRC A;  2V1C A;  1TIH A;  1K7U A;  2RC4 A;  3OL0 A;  1W3S A;  4AML A;  9WGA A;  2ROW A;  1CT4 I;  1CGI I;  2SGQ I;  3UEY A;  5JHW C;  1XA6 A;  1TGS I;  3TOB A;  2JA1 A;  2N17 A;  4SGB I;  1U5K A;  1SGY I;  2DB6 A;  2KMP A;  1PJU A;  2GKR I;  2N52 A;  1CSO I;  3QAH A;  2ERW A;  1MJA A;  1X4S A;  1LR7 A;  1P9G A;  1WGT A;  2ENN A;  5FUY A;  1UVG A;  5CCM A;  1TBO A;  2N71 A;  2X52 A;  4E1R A;  1NUB A; 
#chains in the Genus database with same CATH homology
 4E1P A;  2SGE I;  1M8B A;  1TBQ R;  1OVO A;  1TBN A;  3RU0 A;  1CT0 I;  3QWP A;  3OXL A;  2GVI A;  1LR9 A;  3OXF A;  4UXH A;  1R79 A;  1UVF A;  2KMR A;  4FKD A;  5DAE A;  2BUS A;  5FUX A;  1V1I A;  3PDN A;  2JYY A;  5HI7 A;  3E2I A;  3UGD A;  1CHO I;  1R0R I;  1XX6 A;  3UGL A;  2GKV A;  1M8C A;  3UEJ A;  1FAR A;  3QTL D;  1SGQ I;  2ARP F;  2L8E A;  2YUU A;  3CXL A;  1FYB A;  1BUS A;  1YU6 C;  2ELI A;  2ENZ A;  1OMU A;  2NU3 I;  2B0U C;  2V53 A;  2V1C C;  1OMT A;  1Y1B A;  1BMO A;  1CT2 I;  1HDL A;  4UXJ A;  1DS2 I;  2WCY A;  2UZ3 A;  3VE5 A;  3KY9 A;  2F3C I;  2NU1 I;  1TUR A;  2GKT I;  2ORW A;  3B4V C;  5JHW C;  1V1H A;  1Y1C A;  3BJI A;  1DS3 I;  3GOX A;  2E73 A;  2KMO A;  4HGU A;  3TJQ A;  1SGE I;  2A20 A;  2SGF I;  1SGP I;  2CJS C;  2J9R A;  5CCL A;  3UGI A;  1RFH A;  2LEO A;  1IW4 A;  4JCV E;  4OVO A;  1PCE A;  3E59 A;  1OYV I;  1PPF I;  1HJA I;  2WVJ A;  3UFF A;  2QQE A;  1H0Z A;  2QQ0 A;  1XBT A;  1UUC A;  2NU2 I;  4L9M A;  1MT1 A;  1VDD A;  4A24 A;  2JXD A;  5HQ8 A;  1Y8F A;  2E5R A;  2JW6 A;  2LUY A;  1LR8 A;  2B8T A;  2KCX A;  1KBF A;  2SGP I;  1TBR R;  1FAQ A;  2FNF X;  3VDP A;  3HH2 C;  1AN1 I;  3MEK A;  2L7X A;  5FUW A;  1SGR I;  2K9H A;  3SGQ I;  1W4R A;  2M5X A;  3OXG A;  2QQD A;  1Z7K B;  5EX3 A;  5FUV A;  3VDU A;  4B6D A;  1CE3 A;  2J87 A;  1IY6 A;  1SGN I;  2YQP A;  3SGB I;  2N1A B;  2ODD A;  3SEK C;  2DIP A;  3D00 A;  2KMQ A;  1TUS A;  2QQC A;  2QPO A;  4GI3 C;  2NU0 I;  1TOT A;  2ORV A;  2SGD I;  1KBE A;  3OVO A;  1KMA A;  2OVO A;  4UXI A;  1PTR A;  1N13 A;  1X74 A;  1YTP A;  2NU4 I;  2OD1 A;  1IY5 A;  1CGJ I;  3FC3 A;  1PTQ A;  5EX0 A;  1HPT A;  1SGD I;  2JZM A;  2P6A C;  2VRW B;  2W0T A;  2XRC A;  2V1C A;  1TIH A;  3OL0 A;  1W3S A;  2ROW A;  1CT4 I;  1CGI I;  2SGQ I;  3UEY A;  1XA6 A;  1TGS I;  2JA1 A;  2N17 A;  4SGB I;  1U5K A;  1SGY I;  2DB6 A;  2KMP A;  1PJU A;  2GKR I;  2N52 A;  1CSO I;  2ERW A;  5FUY A;  1X4S A;  1LR7 A;  2ENN A;  1UVG A;  5CCM A;  1TBO A;  2N71 A;  4E1R A;  1NUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...