3UEYA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVFNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C delta type
publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ueyA01
1XA6A 2ORWA 1TBOA 4UXHA 1FAQA 2QQEA 5FUXA 2ORVA 1Y8FA 2J87A 2ROWA 2J9RA 2QQ0A 2QPOA 2DB6A 2ENZA 2GVIA 2YUUA 3BJIA 2UZ3A 2ELIA 2ENNA 4UXJA 2JA1A 3E2IA 3UFFA 3UGDA 3UGIA 3KY9A 5FUVA 2VRWB 1R79A 1PTRA 1XX6A 3UGLA 1PTQA 4L9MA 2WVJA 3CXLA 5FUWA 1KBEA 1XBTA 2FNFX 1TBNA 3UEYA 4B6DA 1KBFA 4FKDA 3UEJA 2B8TA 2E73A 1W4RA 1RFHA 4UXIA 5FUYA 1FARA
chains in the Genus database with same CATH superfamily
1TBOA 1FAQA 2CJSC 1UUCA 5EX0A 4HGUA 2SGDI 4JCVE 3VDPA 4E1PA 5CCLA 1Y8FA 2PQ8A 1OVOA 2J87A 2WGCA 1UVFA 2OVOA 5E3PA 2V1CC 1TGSI 3RU0A 2ENZA 2BUSA 2M5XA 2YUUA 3UOEA 2P6AC 3MEKA 3E2IA 3OVOA 5J8FA 4WP4A 1LR9A 1MJ9A 2SGPI 2JZMA 3UGLA 2A20A 1N13A 1R0RI 2KMRA 2L7XA 2NU3I 4E1RA 5FUWA 1CGII 1P9GA 1TBNA 1HJAI 7WGAA 3UEYA 4B6DA 1IW4A 3FC3A 1Z7KB 3VDUA 2B8TA 2KMOA 1WGTA 3SEKC 2ORWA 2JXDA 2NU0I 3QTLD 3B4VC 1OYVI 2QQEA 2KMPA 1SGPI 1TIHA 2X3TA 3PDNA 3R5CA 3R5DA 5CCMA 2ROWA 2DKVA 1TBQR 3BJIA 2X52A 2UZ3A 1DS2I 2ENNA 5DAEA 3VE5A 1VDDA 1Y1BA 5FUVA 1HEVA 2N71A 2XRCA 1YTPA 2V53A 1CSOI 2KCXA 2V1CA 1DS3I 3FSXA 3OXLA 1XBTA 1K7UA 1FY7A 4MPIA 4AMLA 1BUSA 1SGNI 4FKDA 2UVOA 1U5KA 1FYBA 2QQCA 3OXGA 1SGYI 3R5BA 3SGQI 1RFHA 4UXIA 1LR8A 1CHOI 1YU6C 1TOTA 2ERWA 1FARA 2F3CI 4UXHA 1IY5A 1S20A 1MJBA 3QWPA 2L8EA 1OMTA 1OMUA 3TO9A 2CWGA 3QAHA 3D00A 1TUSA 2GIVA 1AN1I 3TO7A 1W3SA 1CE3A 1M8BA 3OXFA 2DIPA 3UFFA 2JA1A 2ARPF 3UGIA 2QQDA 2CWFA 2RIJA 2YQPA 3KY9A 1H0ZA 2VRWB 1R79A 3TJQA 1TBRR 1SGRI 1XX6A 1PPFI 1SGDI 2JYYA 5E3RA 1MT1A 1HPTA 1MJAA 4L9MA 1K7TA 4SGBI 3CXLA 2OU2A 3HH2C 2FNFX 1SGEI 1WKXA 2GKRI 1ULKA 1TURA 2NU1I 1PCEA 3R5AA 3TOAA 1M8CA 5JHWC 3UEJA 2E73A 1K7VA 1SGQI 4DNCA 1BMOA 1KMAA 5EX3A 1XA6A 2LB7A 1CT4I 2GKTI 5FUXA 1V1IA 1CGJI 1UHAA 2ORVA 2OD1A 3FSYA 2LEOA 1UVGA 9WGAA 2SGEI 2N52A 3GOXA 2J9RA 2NU2I 2QQ0A 5E3QA 2QPOA 3SGBI 4A24A 2DB6A 1NXUA 1Z2IA 1ULMA 1WGCA 2GVIA 2K9HA 2LUYA 1WTJA 2N1AB 2ODDA 2RC4A 4OVOA 2ELIA 2SGQI 1CT2I 1V1HA 4UXJA 2KMQA 3UGDA 2E5RA 1Y1CA 1CT0I 2GKVA 2SGFI 5HQ8A 1PTRA 1PJUA 1IY6A 1PTQA 1Q9BA 1LR7A 3E59A 3OL0A 2WVJA 2N17A 1X74A 1KBEA 1HDLA 1P9ZA 2CWHA 1NUBA 2NU4I 2WCYA 4GI3C 1KBFA 2Y0MA 2B0UC 3TO6A 1W4RA 1X4SA 2W0TA 5HI7A 5J8CA 3TOBA 1ULNA 2JW6A 5FUYA 2OZUA
chains in the Genus database with same CATH topology
1TBOA 1FAQA 2CJSC 1UUCA 5EX0A 4HGUA 2SGDI 4JCVE 3VDPA 4E1PA 5CCLA 1Y8FA 1OVOA 2J87A 1UVFA 2OVOA 2V1CC 1TGSI 3RU0A 2ENZA 2BUSA 2M5XA 2YUUA 2P6AC 3MEKA 3E2IA 3OVOA 1LR9A 2SGPI 2JZMA 3UGLA 2A20A 1N13A 1R0RI 2KMRA 2L7XA 2NU3I 4E1RA 5FUWA 1CGII 1TBNA 1HJAI 3UEYA 4B6DA 1IW4A 3FC3A 1Z7KB 3VDUA 2B8TA 2KMOA 3SEKC 2ORWA 2JXDA 2NU0I 3QTLD 3B4VC 1OYVI 2QQEA 2KMPA 1SGPI 1TIHA 3PDNA 5CCMA 2ROWA 1TBQR 3BJIA 2UZ3A 1DS2I 2ENNA 5DAEA 3VE5A 1VDDA 1Y1BA 5FUVA 2N71A 2XRCA 1YTPA 2V53A 1CSOI 2KCXA 2V1CA 1DS3I 3OXLA 1XBTA 1BUSA 1SGNI 4FKDA 1U5KA 2QQCA 3OXGA 1SGYI 3SGQI 1RFHA 4UXIA 1LR8A 1CHOI 1YU6C 1TOTA 2ERWA 1FARA 2F3CI 4UXHA 1IY5A 1FYBA 3QWPA 2L8EA 1OMTA 1OMUA 1TUSA 1AN1I 1W3SA 1M8BA 3OXFA 2DIPA 3UFFA 2JA1A 2ARPF 3UGIA 2QQDA 3KY9A 2YQPA 1H0ZA 2VRWB 1R79A 3TJQA 1TBRR 1SGRI 1XX6A 1PPFI 1SGDI 2JYYA 1MT1A 1HPTA 4L9MA 4SGBI 3CXLA 3HH2C 2FNFX 1SGEI 2GKRI 2NU1I 1TURA 1PCEA 1M8CA 5JHWC 3UEJA 2E73A 1SGQI 1BMOA 1KMAA 5EX3A 1XA6A 1CT4I 2GKTI 5FUXA 1V1IA 1CGJI 2ORVA 1HDLA 2OD1A 3GOXA 2LEOA 1UVGA 2SGEI 2N52A 2J9RA 2NU2I 2QQ0A 3SGBI 2QPOA 4A24A 2DB6A 2GVIA 2N1AB 3D00A 2ODDA 2K9HA 2LUYA 4OVOA 1CE3A 2ELIA 2SGQI 1CT2I 1V1HA 4UXJA 2KMQA 3UGDA 2E5RA 1Y1CA 1CT0I 2GKVA 2SGFI 5HQ8A 1PTRA 1PJUA 1IY6A 1PTQA 1LR7A 3E59A 3OL0A 2WVJA 2N17A 1X74A 1KBEA 2WCYA 1NUBA 2NU4I 4GI3C 1KBFA 2B0UC 1W4RA 1X4SA 2W0TA 5HI7A 2JW6A 5FUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XA6 A;  2ORW A;  1TBO A;  4UXH A;  1FAQ A;  2QQE A;  5FUX A;  2ORV A;  1Y8F A;  2J87 A;  2ROW A;  2J9R A;  2QQ0 A;  2QPO A;  2DB6 A;  2ENZ A;  2GVI A;  2YUU A;  3BJI A;  2UZ3 A;  2ELI A;  2ENN A;  4UXJ A;  2JA1 A;  3E2I A;  3UFF A;  3UGD A;  3UGI A;  3KY9 A;  5FUV A;  2VRW B;  1R79 A;  1PTR A;  1XX6 A;  3UGL A;  1PTQ A;  4L9M A;  2WVJ A;  3CXL A;  5FUW A;  1KBE A;  1XBT A;  2FNF X;  1TBN A;  3UEY A;  4B6D A;  1KBF A;  4FKD A;  3UEJ A;  2B8T A;  2E73 A;  1W4R A;  1RFH A;  4UXI A;  5FUY A;  1FAR A; 
#chains in the Genus database with same CATH topology
 1TBO A;  1FAQ A;  2CJS C;  1UUC A;  5EX0 A;  4HGU A;  2SGD I;  4JCV E;  3VDP A;  4E1P A;  5CCL A;  1Y8F A;  2PQ8 A;  1OVO A;  2J87 A;  2WGC A;  1UVF A;  2OVO A;  5E3P A;  2V1C C;  1TGS I;  3RU0 A;  2ENZ A;  2BUS A;  2M5X A;  2YUU A;  3UOE A;  2P6A C;  3MEK A;  3E2I A;  3OVO A;  5J8F A;  4WP4 A;  1LR9 A;  1MJ9 A;  2SGP I;  2JZM A;  3UGL A;  2A20 A;  1N13 A;  1R0R I;  2KMR A;  2L7X A;  2NU3 I;  4E1R A;  5FUW A;  1CGI I;  1P9G A;  1TBN A;  1HJA I;  7WGA A;  3UEY A;  4B6D A;  1IW4 A;  3FC3 A;  1Z7K B;  3VDU A;  2B8T A;  2KMO A;  1WGT A;  3SEK C;  2ORW A;  2JXD A;  2NU0 I;  3QTL D;  3B4V C;  1OYV I;  2QQE A;  2KMP A;  1SGP I;  1TIH A;  2X3T A;  3PDN A;  3R5C A;  3R5D A;  5CCM A;  2ROW A;  2DKV A;  1TBQ R;  3BJI A;  2X52 A;  2UZ3 A;  1DS2 I;  2ENN A;  5DAE A;  3VE5 A;  1VDD A;  1Y1B A;  5FUV A;  1HEV A;  2N71 A;  2XRC A;  1YTP A;  2V53 A;  1CSO I;  2KCX A;  2V1C A;  1DS3 I;  3FSX A;  3OXL A;  1XBT A;  1K7U A;  1FY7 A;  4MPI A;  4AML A;  1BUS A;  1SGN I;  4FKD A;  2UVO A;  1U5K A;  1FYB A;  2QQC A;  3OXG A;  1SGY I;  3R5B A;  3SGQ I;  1RFH A;  4UXI A;  1LR8 A;  1CHO I;  1YU6 C;  1TOT A;  2ERW A;  1FAR A;  2F3C I;  4UXH A;  1IY5 A;  1S20 A;  1MJB A;  3QWP A;  2L8E A;  1OMT A;  1OMU A;  3TO9 A;  2CWG A;  3QAH A;  3D00 A;  1TUS A;  2GIV A;  1AN1 I;  3TO7 A;  1W3S A;  1CE3 A;  1M8B A;  3OXF A;  2DIP A;  3UFF A;  2JA1 A;  2ARP F;  3UGI A;  2QQD A;  2CWF A;  2RIJ A;  2YQP A;  3KY9 A;  1H0Z A;  2VRW B;  1R79 A;  3TJQ A;  1TBR R;  1SGR I;  1XX6 A;  1PPF I;  1SGD I;  2JYY A;  5E3R A;  1MT1 A;  1HPT A;  1MJA A;  4L9M A;  1K7T A;  4SGB I;  3CXL A;  2OU2 A;  3HH2 C;  2FNF X;  1SGE I;  1WKX A;  2GKR I;  1ULK A;  1TUR A;  2NU1 I;  1PCE A;  3R5A A;  3TOA A;  1M8C A;  5JHW C;  3UEJ A;  2E73 A;  1K7V A;  1SGQ I;  4DNC A;  1BMO A;  1KMA A;  5EX3 A;  1XA6 A;  2LB7 A;  1CT4 I;  2GKT I;  5FUX A;  1V1I A;  1CGJ I;  1UHA A;  2ORV A;  2OD1 A;  3FSY A;  2LEO A;  1UVG A;  9WGA A;  2SGE I;  2N52 A;  3GOX A;  2J9R A;  2NU2 I;  2QQ0 A;  5E3Q A;  2QPO A;  3SGB I;  4A24 A;  2DB6 A;  1NXU A;  1Z2I A;  1ULM A;  1WGC A;  2GVI A;  2K9H A;  2LUY A;  1WTJ A;  2N1A B;  2ODD A;  2RC4 A;  4OVO A;  2ELI A;  2SGQ I;  1CT2 I;  1V1H A;  4UXJ A;  2KMQ A;  3UGD A;  2E5R A;  1Y1C A;  1CT0 I;  2GKV A;  2SGF I;  5HQ8 A;  1PTR A;  1PJU A;  1IY6 A;  1PTQ A;  1Q9B A;  1LR7 A;  3E59 A;  3OL0 A;  2WVJ A;  2N17 A;  1X74 A;  1KBE A;  1HDL A;  1P9Z A;  2CWH A;  1NUB A;  2NU4 I;  2WCY A;  4GI3 C;  1KBF A;  2Y0M A;  2B0U C;  3TO6 A;  1W4R A;  1X4S A;  2W0T A;  5HI7 A;  5J8C A;  3TOB A;  1ULN A;  2JW6 A;  5FUY A;  2OZU A; 
#chains in the Genus database with same CATH homology
 1TBO A;  1FAQ A;  2CJS C;  1UUC A;  5EX0 A;  4HGU A;  2SGD I;  4JCV E;  3VDP A;  4E1P A;  5CCL A;  1Y8F A;  1OVO A;  2J87 A;  1UVF A;  2OVO A;  2V1C C;  1TGS I;  3RU0 A;  2ENZ A;  2BUS A;  2M5X A;  2YUU A;  2P6A C;  3MEK A;  3E2I A;  3OVO A;  1LR9 A;  2SGP I;  2JZM A;  3UGL A;  2A20 A;  1N13 A;  1R0R I;  2KMR A;  2L7X A;  2NU3 I;  4E1R A;  5FUW A;  1CGI I;  1TBN A;  1HJA I;  3UEY A;  4B6D A;  1IW4 A;  3FC3 A;  1Z7K B;  3VDU A;  2B8T A;  2KMO A;  3SEK C;  2ORW A;  2JXD A;  2NU0 I;  3QTL D;  3B4V C;  1OYV I;  2QQE A;  2KMP A;  1SGP I;  1TIH A;  3PDN A;  5CCM A;  2ROW A;  1TBQ R;  3BJI A;  2UZ3 A;  1DS2 I;  2ENN A;  5DAE A;  3VE5 A;  1VDD A;  1Y1B A;  5FUV A;  2N71 A;  2XRC A;  1YTP A;  2V53 A;  1CSO I;  2KCX A;  2V1C A;  1DS3 I;  3OXL A;  1XBT A;  1BUS A;  1SGN I;  4FKD A;  1U5K A;  2QQC A;  3OXG A;  1SGY I;  3SGQ I;  1RFH A;  4UXI A;  1LR8 A;  1CHO I;  1YU6 C;  1TOT A;  2ERW A;  1FAR A;  2F3C I;  4UXH A;  1IY5 A;  1FYB A;  3QWP A;  2L8E A;  1OMT A;  1OMU A;  1TUS A;  1AN1 I;  1W3S A;  1M8B A;  3OXF A;  2DIP A;  3UFF A;  2JA1 A;  2ARP F;  3UGI A;  2QQD A;  3KY9 A;  2YQP A;  1H0Z A;  2VRW B;  1R79 A;  3TJQ A;  1TBR R;  1SGR I;  1XX6 A;  1PPF I;  1SGD I;  2JYY A;  1MT1 A;  1HPT A;  4L9M A;  4SGB I;  3CXL A;  3HH2 C;  2FNF X;  1SGE I;  2GKR I;  2NU1 I;  1TUR A;  1PCE A;  1M8C A;  5JHW C;  3UEJ A;  2E73 A;  1SGQ I;  1BMO A;  1KMA A;  5EX3 A;  1XA6 A;  1CT4 I;  2GKT I;  5FUX A;  1V1I A;  1CGJ I;  2ORV A;  1HDL A;  2OD1 A;  3GOX A;  2LEO A;  1UVG A;  2SGE I;  2N52 A;  2J9R A;  2NU2 I;  2QQ0 A;  3SGB I;  2QPO A;  4A24 A;  2DB6 A;  2GVI A;  2N1A B;  3D00 A;  2ODD A;  2K9H A;  2LUY A;  4OVO A;  1CE3 A;  2ELI A;  2SGQ I;  1CT2 I;  1V1H A;  4UXJ A;  2KMQ A;  3UGD A;  2E5R A;  1Y1C A;  1CT0 I;  2GKV A;  2SGF I;  5HQ8 A;  1PTR A;  1PJU A;  1IY6 A;  1PTQ A;  1LR7 A;  3E59 A;  3OL0 A;  2WVJ A;  2N17 A;  1X74 A;  1KBE A;  2WCY A;  1NUB A;  2NU4 I;  4GI3 C;  1KBF A;  2B0U C;  1W4R A;  1X4S A;  2W0T A;  5HI7 A;  2JW6 A;  5FUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...