3UEYA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVFNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
molecule keywords Protein kinase C delta type
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ueyA01
5FUXA 1KBEA 2WVJA 5FUYA 5FUVA 3UGLA 4UXHA 1FARA 2QQEA 1PTQA 2UZ3A 1XA6A 1W4RA 4L9MA 3UEJA 1Y8FA 2QPOA 3UFFA 1TBNA 1RFHA 1XX6A 2QQ0A 2JA1A 3KY9A 2FNFX 2ROWA 4UXIA 2ENZA 2ORWA 1XBTA 3UEYA 2J9RA 2E73A 1TBOA 2J87A 2GVIA 1R79A 2ELIA 5FUWA 3UGIA 4FKDA 1PTRA 2DB6A 1FAQA 2ENNA 2YUUA 3BJIA 4UXJA 3UGDA 2ORVA 2VRWB 4B6DA 1KBFA 3CXLA 2B8TA 3E2IA
chains in the Genus database with same CATH superfamily
1CT4I 5FUYA 1TIHA 1UHAA 2XRCA 2F3CI 4JCVE 4MPIA 2QQEA 1PTQA 2K9HA 3SEKC 1Y1BA 1WGTA 2L7XA 3UEJA 2M5XA 1ULMA 1PPFI 1UVGA 3UFFA 1NUBA 4HGUA 1RFHA 1FY7A 1XX6A 2NU3I 3GOXA 1SGQI 5EX0A 3KY9A 1CGII 1TGSI 3R5CA 5J8FA 1K7UA 1IY6A 2OD1A 2CWHA 2E73A 2RC4A 1BUSA 1TBOA 3FC3A 7WGAA 1OMTA 1M8BA 3VDUA 2N52A 4OVOA 3HH2C 1TBRR 4FKDA 1X74A 1BMOA 1CGJI 2Y0MA 2SGPI 2X3TA 5E3RA 2B8TA 3TO9A 1K7TA 1MT1A 5FUXA 1N13A 3UGLA 2LUYA 2GKTI 1FARA 2BUSA 2UZ3A 1R0RI 1HPTA 1CT2I 1YU6C 1Z2IA 2GKRI 3OXFA 1PJUA 3TO7A 1Y8FA 2NU4I 2KMPA 3FSYA 1SGEI 2E5RA 1S20A 2V53A 2QQ0A 1TURA 1WGCA 2JA1A 2JW6A 3OXLA 2KMQA 2ROWA 1AN1I 1V1HA 2X52A 4UXIA 2ORWA 1H0ZA 2NU1I 3UEYA 2JZMA 2ERWA 1DS3I 2CJSC 2GIVA 2OVOA 2J87A 3SGBI 5J8CA 5E3QA 2P6AC 5FUWA 3TOAA 5HQ8A 4GI3C 1IW4A 2CWFA 2SGDI 1PTRA 2DB6A 2CWGA 1WKXA 1K7VA 2QQCA 2RIJA 2YQPA 2YUUA 3OXGA 4UXJA 2ORVA 3R5AA 5HI7A 2KMRA 1LR9A 3VDPA 3CXLA 1KBEA 2B0UC 2N17A 3PDNA 1M8CA 3RU0A 3TO6A 1LR8A 1U5KA 1Z7KB 2JYYA 1TOTA 2ODDA 1XA6A 2WGCA 2ARPF 1W4RA 2SGEI 1PCEA 1SGRI 1V1IA 2L8EA 1SGYI 3D00A 2KMOA 1DS2I 3UOEA 1TBQR 2SGFI 3R5BA 1YTPA 4E1RA 4WP4A 2LB7A 1HDLA 4A24A 3QWPA 1X4SA 2FNFX 1KMAA 1OVOA 1OMUA 1WTJA 1XBTA 1CSOI 5E3PA 1CHOI 2KCXA 2A20A 2GVIA 2QQDA 1HJAI 1R79A 2N71A 2NU0I 3MEKA 3TOBA 1Q9BA 1UVFA 3OVOA 1UUCA 3UGDA 4SGBI 1ULNA 3E2IA 1FYBA 2GKVA 2WVJA 5FUVA 2UVOA 1HEVA 1SGPI 1TUSA 4UXHA 1OYVI 2N1AB 2JXDA 5JHWC 2W0TA 2LEOA 4L9MA 1MJBA 3VE5A 1W3SA 4E1PA 2QPOA 5DAEA 3TJQA 2NU2I 1TBNA 2DKVA 5CCLA 2OU2A 3QTLD 1Y1CA 5EX3A 1MJ9A 2SGQI 4DNCA 2OZUA 3OL0A 9WGAA 3R5DA 1CE3A 2ENZA 1P9GA 2WCYA 1ULKA 1MJAA 1VDDA 2DIPA 3E59A 2J9RA 4AMLA 1FAQA 1SGNI 3FSXA 3SGQI 2ELIA 5CCMA 3QAHA 1CT0I 2ENNA 1IY5A 2V1CA 3BJIA 2V1CC 2PQ8A 1LR7A 2VRWB 4B6DA 1KBFA 3UGIA 3B4VC 1P9ZA 1NXUA 1SGDI
chains in the Genus database with same CATH topology
1CT4I 5FUYA 1TIHA 2XRCA 2F3CI 4JCVE 2QQEA 1PTQA 2K9HA 3SEKC 1Y1BA 2L7XA 3UEJA 2M5XA 1PPFI 1UVGA 3UFFA 1NUBA 4HGUA 1RFHA 1XX6A 2NU3I 3GOXA 1SGQI 5EX0A 3KY9A 1CGII 1TGSI 1IY6A 2OD1A 2E73A 1BUSA 1TBOA 3FC3A 1OMTA 1M8BA 3VDUA 2N52A 4OVOA 3HH2C 1TBRR 4FKDA 1X74A 1BMOA 1CGJI 2SGPI 2B8TA 1MT1A 5FUXA 1N13A 3UGLA 2LUYA 2GKTI 1FARA 2BUSA 2UZ3A 1R0RI 1HPTA 1CT2I 1YU6C 2GKRI 3OXFA 1PJUA 1Y8FA 2NU4I 2KMPA 1SGEI 2E5RA 2V53A 2QQ0A 1TURA 2JA1A 2JW6A 3OXLA 2KMQA 2ROWA 1AN1I 1V1HA 4UXIA 2ORWA 1H0ZA 2NU1I 3UEYA 2JZMA 2ERWA 1DS3I 2OVOA 2J87A 3SGBI 2P6AC 5FUWA 5HQ8A 1IW4A 4GI3C 2SGDI 1PTRA 2DB6A 2QQCA 2YQPA 2YUUA 3OXGA 5HI7A 4A24A 4UXJA 1FAQA 2ORVA 3VDPA 2KMRA 1LR9A 3CXLA 1KBEA 2B0UC 2N17A 3PDNA 1M8CA 3RU0A 1LR8A 1U5KA 1Z7KB 2JYYA 1TOTA 2ODDA 1XA6A 2ARPF 1W4RA 2SGEI 1PCEA 1SGRI 1V1IA 2L8EA 1SGYI 3D00A 2KMOA 1DS2I 1TBQR 2SGFI 1YTPA 4E1RA 1HDLA 3QWPA 1X4SA 2FNFX 1KMAA 1OVOA 1OMUA 1XBTA 1CSOI 1CHOI 2KCXA 2A20A 2GVIA 2QQDA 1HJAI 1R79A 2N71A 2NU0I 3MEKA 1UVFA 3OVOA 1UUCA 3UGDA 4SGBI 3E2IA 1FYBA 2GKVA 2WVJA 5FUVA 1SGPI 1TUSA 4UXHA 1OYVI 2N1AB 2JXDA 5JHWC 2W0TA 2LEOA 4L9MA 3VE5A 4E1PA 1W3SA 2QPOA 5DAEA 3TJQA 2NU2I 1TBNA 5CCLA 3QTLD 1Y1CA 5EX3A 2SGQI 3OL0A 1CE3A 2ENZA 2WCYA 2DIPA 1VDDA 3E59A 2J9RA 1SGNI 3SGQI 2ELIA 5CCMA 1CT0I 2ENNA 1IY5A 2V1CA 3BJIA 2V1CC 1LR7A 2VRWB 4B6DA 1KBFA 3UGIA 3B4VC 2CJSC 1SGDI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUX A;  1KBE A;  2WVJ A;  5FUY A;  5FUV A;  3UGL A;  4UXH A;  1FAR A;  2QQE A;  1PTQ A;  2UZ3 A;  1XA6 A;  1W4R A;  4L9M A;  3UEJ A;  1Y8F A;  2QPO A;  3UFF A;  1TBN A;  1RFH A;  1XX6 A;  2QQ0 A;  2JA1 A;  3KY9 A;  2FNF X;  2ROW A;  4UXI A;  2ENZ A;  2ORW A;  1XBT A;  3UEY A;  2J9R A;  2E73 A;  1TBO A;  2J87 A;  2GVI A;  1R79 A;  2ELI A;  5FUW A;  3UGI A;  4FKD A;  1PTR A;  2DB6 A;  1FAQ A;  2ENN A;  2YUU A;  3BJI A;  4UXJ A;  3UGD A;  2ORV A;  2VRW B;  4B6D A;  1KBF A;  3CXL A;  2B8T A;  3E2I A; 
#chains in the Genus database with same CATH topology
 1CT4 I;  5FUY A;  1TIH A;  1UHA A;  2XRC A;  2F3C I;  4JCV E;  4MPI A;  2QQE A;  1PTQ A;  2K9H A;  3SEK C;  1Y1B A;  1WGT A;  2L7X A;  3UEJ A;  2M5X A;  1ULM A;  1PPF I;  1UVG A;  3UFF A;  1NUB A;  4HGU A;  1RFH A;  1FY7 A;  1XX6 A;  2NU3 I;  3GOX A;  1SGQ I;  5EX0 A;  3KY9 A;  1CGI I;  1TGS I;  3R5C A;  5J8F A;  1K7U A;  1IY6 A;  2OD1 A;  2CWH A;  2E73 A;  2RC4 A;  1BUS A;  1TBO A;  3FC3 A;  7WGA A;  1OMT A;  1M8B A;  3VDU A;  2N52 A;  4OVO A;  3HH2 C;  1TBR R;  4FKD A;  1X74 A;  1BMO A;  1CGJ I;  2Y0M A;  2SGP I;  2X3T A;  5E3R A;  2B8T A;  3TO9 A;  1K7T A;  1MT1 A;  5FUX A;  1N13 A;  3UGL A;  2LUY A;  2GKT I;  1FAR A;  2BUS A;  2UZ3 A;  1R0R I;  1HPT A;  1CT2 I;  1YU6 C;  1Z2I A;  2GKR I;  3OXF A;  1PJU A;  3TO7 A;  1Y8F A;  2NU4 I;  2KMP A;  3FSY A;  1SGE I;  2E5R A;  1S20 A;  2V53 A;  2QQ0 A;  1TUR A;  1WGC A;  2JA1 A;  2JW6 A;  3OXL A;  2KMQ A;  2ROW A;  1AN1 I;  1V1H A;  2X52 A;  4UXI A;  2ORW A;  1H0Z A;  2NU1 I;  3UEY A;  2JZM A;  2ERW A;  1DS3 I;  2CJS C;  2GIV A;  2OVO A;  2J87 A;  3SGB I;  5J8C A;  5E3Q A;  2P6A C;  5FUW A;  3TOA A;  5HQ8 A;  4GI3 C;  1IW4 A;  2CWF A;  2SGD I;  1PTR A;  2DB6 A;  2CWG A;  1WKX A;  1K7V A;  2QQC A;  2RIJ A;  2YQP A;  2YUU A;  3OXG A;  4UXJ A;  2ORV A;  3R5A A;  5HI7 A;  2KMR A;  1LR9 A;  3VDP A;  3CXL A;  1KBE A;  2B0U C;  2N17 A;  3PDN A;  1M8C A;  3RU0 A;  3TO6 A;  1LR8 A;  1U5K A;  1Z7K B;  2JYY A;  1TOT A;  2ODD A;  1XA6 A;  2WGC A;  2ARP F;  1W4R A;  2SGE I;  1PCE A;  1SGR I;  1V1I A;  2L8E A;  1SGY I;  3D00 A;  2KMO A;  1DS2 I;  3UOE A;  1TBQ R;  2SGF I;  3R5B A;  1YTP A;  4E1R A;  4WP4 A;  2LB7 A;  1HDL A;  4A24 A;  3QWP A;  1X4S A;  2FNF X;  1KMA A;  1OVO A;  1OMU A;  1WTJ A;  1XBT A;  1CSO I;  5E3P A;  1CHO I;  2KCX A;  2A20 A;  2GVI A;  2QQD A;  1HJA I;  1R79 A;  2N71 A;  2NU0 I;  3MEK A;  3TOB A;  1Q9B A;  1UVF A;  3OVO A;  1UUC A;  3UGD A;  4SGB I;  1ULN A;  3E2I A;  1FYB A;  2GKV A;  2WVJ A;  5FUV A;  2UVO A;  1HEV A;  1SGP I;  1TUS A;  4UXH A;  1OYV I;  2N1A B;  2JXD A;  5JHW C;  2W0T A;  2LEO A;  4L9M A;  1MJB A;  3VE5 A;  1W3S A;  4E1P A;  2QPO A;  5DAE A;  3TJQ A;  2NU2 I;  1TBN A;  2DKV A;  5CCL A;  2OU2 A;  3QTL D;  1Y1C A;  5EX3 A;  1MJ9 A;  2SGQ I;  4DNC A;  2OZU A;  3OL0 A;  9WGA A;  3R5D A;  1CE3 A;  2ENZ A;  1P9G A;  2WCY A;  1ULK A;  1MJA A;  1VDD A;  2DIP A;  3E59 A;  2J9R A;  4AML A;  1FAQ A;  1SGN I;  3FSX A;  3SGQ I;  2ELI A;  5CCM A;  3QAH A;  1CT0 I;  2ENN A;  1IY5 A;  2V1C A;  3BJI A;  2V1C C;  2PQ8 A;  1LR7 A;  2VRW B;  4B6D A;  1KBF A;  3UGI A;  3B4V C;  1P9Z A;  1NXU A;  1SGD I; 
#chains in the Genus database with same CATH homology
 1CT4 I;  5FUY A;  1TIH A;  2XRC A;  2F3C I;  4JCV E;  2QQE A;  1PTQ A;  2K9H A;  3SEK C;  1Y1B A;  2L7X A;  3UEJ A;  2M5X A;  1PPF I;  1UVG A;  3UFF A;  1NUB A;  4HGU A;  1RFH A;  1XX6 A;  2NU3 I;  3GOX A;  1SGQ I;  5EX0 A;  3KY9 A;  1CGI I;  1TGS I;  1IY6 A;  2OD1 A;  2E73 A;  1BUS A;  1TBO A;  3FC3 A;  1OMT A;  1M8B A;  3VDU A;  2N52 A;  4OVO A;  3HH2 C;  1TBR R;  4FKD A;  1X74 A;  1BMO A;  1CGJ I;  2SGP I;  2B8T A;  1MT1 A;  5FUX A;  1N13 A;  3UGL A;  2LUY A;  2GKT I;  1FAR A;  2BUS A;  2UZ3 A;  1R0R I;  1HPT A;  1CT2 I;  1YU6 C;  2GKR I;  3OXF A;  1PJU A;  1Y8F A;  2NU4 I;  2KMP A;  1SGE I;  2E5R A;  2V53 A;  2QQ0 A;  1TUR A;  2JA1 A;  2JW6 A;  3OXL A;  2KMQ A;  2ROW A;  1AN1 I;  1V1H A;  4UXI A;  2ORW A;  1H0Z A;  2NU1 I;  3UEY A;  2JZM A;  2ERW A;  1DS3 I;  2OVO A;  2J87 A;  3SGB I;  2P6A C;  5FUW A;  5HQ8 A;  1IW4 A;  4GI3 C;  2SGD I;  1PTR A;  2DB6 A;  2QQC A;  2YQP A;  2YUU A;  3OXG A;  5HI7 A;  4A24 A;  4UXJ A;  1FAQ A;  2ORV A;  3VDP A;  2KMR A;  1LR9 A;  3CXL A;  1KBE A;  2B0U C;  2N17 A;  3PDN A;  1M8C A;  3RU0 A;  1LR8 A;  1U5K A;  1Z7K B;  2JYY A;  1TOT A;  2ODD A;  1XA6 A;  2ARP F;  1W4R A;  2SGE I;  1PCE A;  1SGR I;  1V1I A;  2L8E A;  1SGY I;  3D00 A;  2KMO A;  1DS2 I;  1TBQ R;  2SGF I;  1YTP A;  4E1R A;  1HDL A;  3QWP A;  1X4S A;  2FNF X;  1KMA A;  1OVO A;  1OMU A;  1XBT A;  1CSO I;  1CHO I;  2KCX A;  2A20 A;  2GVI A;  2QQD A;  1HJA I;  1R79 A;  2N71 A;  2NU0 I;  3MEK A;  1UVF A;  3OVO A;  1UUC A;  3UGD A;  4SGB I;  3E2I A;  1FYB A;  2GKV A;  2WVJ A;  5FUV A;  1SGP I;  1TUS A;  4UXH A;  1OYV I;  2N1A B;  2JXD A;  5JHW C;  2W0T A;  2LEO A;  4L9M A;  3VE5 A;  4E1P A;  1W3S A;  2QPO A;  5DAE A;  3TJQ A;  2NU2 I;  1TBN A;  5CCL A;  3QTL D;  1Y1C A;  5EX3 A;  2SGQ I;  3OL0 A;  1CE3 A;  2ENZ A;  2WCY A;  2DIP A;  1VDD A;  3E59 A;  2J9R A;  1SGN I;  3SGQ I;  2ELI A;  5CCM A;  1CT0 I;  2ENN A;  1IY5 A;  2V1C A;  3BJI A;  2V1C C;  1LR7 A;  2VRW B;  4B6D A;  1KBF A;  3UGI A;  3B4V C;  2CJS C;  1SGD I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...