3UEYA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
b'GSRRASVGSHRFKVFNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C delta type
publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ueyA01
2ELIA 1W4RA 1PTQA 2B8TA 4FKDA 3UGIA 4B6DA 3KY9A 4L9MA 3UFFA 1TBNA 2GVIA 3BJIA 1XX6A 2J9RA 1Y8FA 2UZ3A 2ROWA 5FUVA 3UGLA 2WVJA 2E73A 1R79A 1XA6A 2ORVA 2ENZA 1TBOA 1RFHA 3CXLA 2JA1A 3E2IA 4UXJA 2DB6A 2QQ0A 2YUUA 1KBEA 3UEYA 5FUWA 4UXIA 1FAQA 2ORWA 2VRWB 4UXHA 1KBFA 2QQEA 1XBTA 2QPOA 3UGDA 5FUYA 1FARA 2FNFX 3UEJA 2J87A 1PTRA 2ENNA 5FUXA
chains in the Genus database with same CATH superfamily
3PDNA 2Y0MA 3OL0A 2KMPA 1TGSI 1OYVI 1ULNA 4E1PA 1PTQA 3UGIA 2CWGA 2DKVA 2KMRA 3TO9A 2B0UC 2QQCA 3VDPA 2NU4I 2SGDI 1TOTA 2GVIA 2PQ8A 2J9RA 1TUSA 2ARPF 1OMUA 2DIPA 1K7UA 1UUCA 3QWPA 1WKXA 3R5BA 4AMLA 1ULMA 3OXGA 5FUVA 1FY7A 2CWFA 2UVOA 1OVOA 3UGLA 5JHWC 1MJAA 1R79A 2WCYA 1TURA 2ENZA 2M5XA 1V1HA 2N17A 2JA1A 3FSYA 2NU0I 2YUUA 1CHOI 1CE3A 1Y1CA 4HGUA 2ORWA 2VRWB 3SGQI 1FAQA 3TO7A 1KBFA 2SGEI 3R5DA 2GIVA 3UGDA 2A20A 2SGPI 1FARA 1SGYI 2X52A 2YQPA 3GOXA 1CT0I 2N71A 3SEKC 2OVOA 2LB7A 2KMOA 1BMOA 3OXFA 4FKDA 5HQ8A 1IY6A 3FC3A 1M8CA 5CCMA 9WGAA 1AN1I 1TBNA 1CGJI 1SGQI 1CT4I 1TIHA 1W3SA 1HEVA 1WGCA 1VDDA 2N52A 1UVGA 5J8FA 2F3CI 2N1AB 2NU2I 3HH2C 4GI3C 4MPIA 3QAHA 2WVJA 4JCVE 1TBQR 2KCXA 1RFHA 1CT2I 1HPTA 1LR8A 2L8EA 3E2IA 2QQ0A 2JW6A 3OVOA 4SGBI 5CCLA 1LR7A 1DS3I 1PPFI 1X4SA 1DS2I 2K9HA 1SGDI 1CSOI 2QQEA 2RIJA 2E5RA 2WGCA 4UXHA 2OZUA 1YU6C 2QPOA 2P6AC 2XRCA 5DAEA 1MT1A 2L7XA 1M8BA 2LUYA 2V1CC 1N13A 3VDUA 3UEJA 2OD1A 1HDLA 2LEOA 2ENNA 3TOBA 1OMTA 1S20A 1P9ZA 1Y1BA 1W4RA 2SGQI 2B8TA 4WP4A 5HI7A 2GKVA 1Q9BA 2CWHA 4B6DA 3KY9A 3UFFA 3UOEA 1P9GA 1CGII 1SGPI 1XX6A 1NXUA 3E59A 2CJSC 2KMQA 2W0TA 5E3PA 5EX0A 2ODDA 7WGAA 1PJUA 4OVOA 1PCEA 2JXDA 4UXJA 2X3TA 1UVFA 1MJBA 2DB6A 1LR9A 3UEYA 5FUWA 3TO6A 3QTLD 1K7TA 1H0ZA 2NU1I 1WTJA 1TBRR 1HJAI 3VE5A 3TOAA 2J87A 1SGRI 3BJIA 5FUXA 2ELIA 4DNCA 5J8CA 3TJQA 1Z7KB 1YTPA 2ERWA 1WGTA 1K7VA 2OU2A 4L9MA 1SGEI 1U5KA 3B4VC 1UHAA 1Z2IA 2NU3I 1V1IA 3SGBI 4E1RA 4A24A 2JZMA 1FYBA 1BUSA 2SGFI 5EX3A 1KMAA 1Y8FA 2UZ3A 2ROWA 5E3RA 2BUSA 3D00A 2RC4A 1SGNI 2E73A 2V53A 1XA6A 2ORVA 3R5AA 1TBOA 5E3QA 3CXLA 3OXLA 3RU0A 3R5CA 1KBEA 1IW4A 4UXIA 2QQDA 3MEKA 1ULKA 1IY5A 1MJ9A 1XBTA 2GKRI 1NUBA 2JYYA 2GKTI 3FSXA 5FUYA 2V1CA 2FNFX 1PTRA 1R0RI 1X74A
chains in the Genus database with same CATH topology
3PDNA 3OL0A 2KMPA 1TGSI 1OYVI 4E1PA 1PTQA 3UGIA 2KMRA 2B0UC 2QQCA 3VDPA 2NU4I 2SGDI 1TOTA 2GVIA 2J9RA 1TUSA 2ARPF 1OMUA 2DIPA 1UUCA 3QWPA 3OXGA 5FUVA 3UGLA 1OVOA 5JHWC 1R79A 2WCYA 1TURA 2ENZA 2M5XA 1V1HA 2N17A 2JA1A 2NU0I 2YUUA 1CHOI 1CE3A 1Y1CA 4HGUA 2ORWA 2VRWB 3SGQI 1FAQA 1KBFA 2SGEI 3UGDA 2A20A 2SGPI 1FARA 1SGYI 2YQPA 3GOXA 1CT0I 2N71A 3SEKC 2OVOA 2KMOA 1BMOA 3OXFA 4FKDA 5HQ8A 1IY6A 3FC3A 1M8CA 5CCMA 1AN1I 1TBNA 1CGJI 1SGQI 1CT4I 1TIHA 1W3SA 1VDDA 2N52A 1UVGA 2F3CI 2N1AB 2NU2I 3HH2C 4GI3C 2WVJA 4JCVE 1TBQR 2KCXA 1RFHA 1CT2I 1HPTA 1LR8A 2L8EA 3E2IA 2QQ0A 2JW6A 3OVOA 4SGBI 5CCLA 1LR7A 1DS3I 1PPFI 1X4SA 1DS2I 2K9HA 1SGDI 1CSOI 2QQEA 4UXHA 2E5RA 1YU6C 2QPOA 2P6AC 2XRCA 5DAEA 1MT1A 2L7XA 1M8BA 2LUYA 2V1CC 1N13A 3VDUA 3UEJA 2OD1A 1HDLA 2LEOA 2ENNA 1OMTA 1Y1BA 1W4RA 2SGQI 2B8TA 5HI7A 2GKVA 4B6DA 3KY9A 3UFFA 1CGII 1SGPI 1XX6A 3E59A 2CJSC 2KMQA 2W0TA 5EX0A 2ODDA 1PJUA 4OVOA 1PCEA 2JXDA 4UXJA 1UVFA 2DB6A 3UEYA 1LR9A 5FUWA 3QTLD 2NU1I 1TBRR 1HJAI 3VE5A 2J87A 1SGRI 3BJIA 5FUXA 2ELIA 3TJQA 1Z7KB 1YTPA 2ERWA 4L9MA 1SGEI 1U5KA 3B4VC 2NU3I 4E1RA 1V1IA 3SGBI 4A24A 2JZMA 1FYBA 1BUSA 2SGFI 5EX3A 1KMAA 1Y8FA 2UZ3A 2ROWA 2BUSA 3D00A 1SGNI 2E73A 2V53A 1XA6A 2ORVA 1H0ZA 1TBOA 3CXLA 3OXLA 3RU0A 1KBEA 1IW4A 4UXIA 2QQDA 3MEKA 1IY5A 1XBTA 2GKRI 1NUBA 2JYYA 2GKTI 5FUYA 2V1CA 2FNFX 1PTRA 1R0RI 1X74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELI A;  1W4R A;  1PTQ A;  2B8T A;  4FKD A;  3UGI A;  4B6D A;  3KY9 A;  4L9M A;  3UFF A;  1TBN A;  2GVI A;  3BJI A;  1XX6 A;  2J9R A;  1Y8F A;  2UZ3 A;  2ROW A;  5FUV A;  3UGL A;  2WVJ A;  2E73 A;  1R79 A;  1XA6 A;  2ORV A;  2ENZ A;  1TBO A;  1RFH A;  3CXL A;  2JA1 A;  3E2I A;  4UXJ A;  2DB6 A;  2QQ0 A;  2YUU A;  1KBE A;  3UEY A;  5FUW A;  4UXI A;  1FAQ A;  2ORW A;  2VRW B;  4UXH A;  1KBF A;  2QQE A;  1XBT A;  2QPO A;  3UGD A;  5FUY A;  1FAR A;  2FNF X;  3UEJ A;  2J87 A;  1PTR A;  2ENN A;  5FUX A; 
#chains in the Genus database with same CATH topology
 3PDN A;  2Y0M A;  3OL0 A;  2KMP A;  1TGS I;  1OYV I;  1ULN A;  4E1P A;  1PTQ A;  3UGI A;  2CWG A;  2DKV A;  2KMR A;  3TO9 A;  2B0U C;  2QQC A;  3VDP A;  2NU4 I;  2SGD I;  1TOT A;  2GVI A;  2PQ8 A;  2J9R A;  1TUS A;  2ARP F;  1OMU A;  2DIP A;  1K7U A;  1UUC A;  3QWP A;  1WKX A;  3R5B A;  4AML A;  1ULM A;  3OXG A;  5FUV A;  1FY7 A;  2CWF A;  2UVO A;  1OVO A;  3UGL A;  5JHW C;  1MJA A;  1R79 A;  2WCY A;  1TUR A;  2ENZ A;  2M5X A;  1V1H A;  2N17 A;  2JA1 A;  3FSY A;  2NU0 I;  2YUU A;  1CHO I;  1CE3 A;  1Y1C A;  4HGU A;  2ORW A;  2VRW B;  3SGQ I;  1FAQ A;  3TO7 A;  1KBF A;  2SGE I;  3R5D A;  2GIV A;  3UGD A;  2A20 A;  2SGP I;  1FAR A;  1SGY I;  2X52 A;  2YQP A;  3GOX A;  1CT0 I;  2N71 A;  3SEK C;  2OVO A;  2LB7 A;  2KMO A;  1BMO A;  3OXF A;  4FKD A;  5HQ8 A;  1IY6 A;  3FC3 A;  1M8C A;  5CCM A;  9WGA A;  1AN1 I;  1TBN A;  1CGJ I;  1SGQ I;  1CT4 I;  1TIH A;  1W3S A;  1HEV A;  1WGC A;  1VDD A;  2N52 A;  1UVG A;  5J8F A;  2F3C I;  2N1A B;  2NU2 I;  3HH2 C;  4GI3 C;  4MPI A;  3QAH A;  2WVJ A;  4JCV E;  1TBQ R;  2KCX A;  1RFH A;  1CT2 I;  1HPT A;  1LR8 A;  2L8E A;  3E2I A;  2QQ0 A;  2JW6 A;  3OVO A;  4SGB I;  5CCL A;  1LR7 A;  1DS3 I;  1PPF I;  1X4S A;  1DS2 I;  2K9H A;  1SGD I;  1CSO I;  2QQE A;  2RIJ A;  2E5R A;  2WGC A;  4UXH A;  2OZU A;  1YU6 C;  2QPO A;  2P6A C;  2XRC A;  5DAE A;  1MT1 A;  2L7X A;  1M8B A;  2LUY A;  2V1C C;  1N13 A;  3VDU A;  3UEJ A;  2OD1 A;  1HDL A;  2LEO A;  2ENN A;  3TOB A;  1OMT A;  1S20 A;  1P9Z A;  1Y1B A;  1W4R A;  2SGQ I;  2B8T A;  4WP4 A;  5HI7 A;  2GKV A;  1Q9B A;  2CWH A;  4B6D A;  3KY9 A;  3UFF A;  3UOE A;  1P9G A;  1CGI I;  1SGP I;  1XX6 A;  1NXU A;  3E59 A;  2CJS C;  2KMQ A;  2W0T A;  5E3P A;  5EX0 A;  2ODD A;  7WGA A;  1PJU A;  4OVO A;  1PCE A;  2JXD A;  4UXJ A;  2X3T A;  1UVF A;  1MJB A;  2DB6 A;  1LR9 A;  3UEY A;  5FUW A;  3TO6 A;  3QTL D;  1K7T A;  1H0Z A;  2NU1 I;  1WTJ A;  1TBR R;  1HJA I;  3VE5 A;  3TOA A;  2J87 A;  1SGR I;  3BJI A;  5FUX A;  2ELI A;  4DNC A;  5J8C A;  3TJQ A;  1Z7K B;  1YTP A;  2ERW A;  1WGT A;  1K7V A;  2OU2 A;  4L9M A;  1SGE I;  1U5K A;  3B4V C;  1UHA A;  1Z2I A;  2NU3 I;  1V1I A;  3SGB I;  4E1R A;  4A24 A;  2JZM A;  1FYB A;  1BUS A;  2SGF I;  5EX3 A;  1KMA A;  1Y8F A;  2UZ3 A;  2ROW A;  5E3R A;  2BUS A;  3D00 A;  2RC4 A;  1SGN I;  2E73 A;  2V53 A;  1XA6 A;  2ORV A;  3R5A A;  1TBO A;  5E3Q A;  3CXL A;  3OXL A;  3RU0 A;  3R5C A;  1KBE A;  1IW4 A;  4UXI A;  2QQD A;  3MEK A;  1ULK A;  1IY5 A;  1MJ9 A;  1XBT A;  2GKR I;  1NUB A;  2JYY A;  2GKT I;  3FSX A;  5FUY A;  2V1C A;  2FNF X;  1PTR A;  1R0R I;  1X74 A; 
#chains in the Genus database with same CATH homology
 3PDN A;  3OL0 A;  2KMP A;  1TGS I;  1OYV I;  4E1P A;  1PTQ A;  3UGI A;  2KMR A;  2B0U C;  2QQC A;  3VDP A;  2NU4 I;  2SGD I;  1TOT A;  2GVI A;  2J9R A;  1TUS A;  2ARP F;  1OMU A;  2DIP A;  1UUC A;  3QWP A;  3OXG A;  5FUV A;  3UGL A;  1OVO A;  5JHW C;  1R79 A;  2WCY A;  1TUR A;  2ENZ A;  2M5X A;  1V1H A;  2N17 A;  2JA1 A;  2NU0 I;  2YUU A;  1CHO I;  1CE3 A;  1Y1C A;  4HGU A;  2ORW A;  2VRW B;  3SGQ I;  1FAQ A;  1KBF A;  2SGE I;  3UGD A;  2A20 A;  2SGP I;  1FAR A;  1SGY I;  2YQP A;  3GOX A;  1CT0 I;  2N71 A;  3SEK C;  2OVO A;  2KMO A;  1BMO A;  3OXF A;  4FKD A;  5HQ8 A;  1IY6 A;  3FC3 A;  1M8C A;  5CCM A;  1AN1 I;  1TBN A;  1CGJ I;  1SGQ I;  1CT4 I;  1TIH A;  1W3S A;  1VDD A;  2N52 A;  1UVG A;  2F3C I;  2N1A B;  2NU2 I;  3HH2 C;  4GI3 C;  2WVJ A;  4JCV E;  1TBQ R;  2KCX A;  1RFH A;  1CT2 I;  1HPT A;  1LR8 A;  2L8E A;  3E2I A;  2QQ0 A;  2JW6 A;  3OVO A;  4SGB I;  5CCL A;  1LR7 A;  1DS3 I;  1PPF I;  1X4S A;  1DS2 I;  2K9H A;  1SGD I;  1CSO I;  2QQE A;  4UXH A;  2E5R A;  1YU6 C;  2QPO A;  2P6A C;  2XRC A;  5DAE A;  1MT1 A;  2L7X A;  1M8B A;  2LUY A;  2V1C C;  1N13 A;  3VDU A;  3UEJ A;  2OD1 A;  1HDL A;  2LEO A;  2ENN A;  1OMT A;  1Y1B A;  1W4R A;  2SGQ I;  2B8T A;  5HI7 A;  2GKV A;  4B6D A;  3KY9 A;  3UFF A;  1CGI I;  1SGP I;  1XX6 A;  3E59 A;  2CJS C;  2KMQ A;  2W0T A;  5EX0 A;  2ODD A;  1PJU A;  4OVO A;  1PCE A;  2JXD A;  4UXJ A;  1UVF A;  2DB6 A;  3UEY A;  1LR9 A;  5FUW A;  3QTL D;  2NU1 I;  1TBR R;  1HJA I;  3VE5 A;  2J87 A;  1SGR I;  3BJI A;  5FUX A;  2ELI A;  3TJQ A;  1Z7K B;  1YTP A;  2ERW A;  4L9M A;  1SGE I;  1U5K A;  3B4V C;  2NU3 I;  4E1R A;  1V1I A;  3SGB I;  4A24 A;  2JZM A;  1FYB A;  1BUS A;  2SGF I;  5EX3 A;  1KMA A;  1Y8F A;  2UZ3 A;  2ROW A;  2BUS A;  3D00 A;  1SGN I;  2E73 A;  2V53 A;  1XA6 A;  2ORV A;  1H0Z A;  1TBO A;  3CXL A;  3OXL A;  3RU0 A;  1KBE A;  1IW4 A;  4UXI A;  2QQD A;  3MEK A;  1IY5 A;  1XBT A;  2GKR I;  1NUB A;  2JYY A;  2GKT I;  5FUY A;  2V1C A;  2FNF X;  1PTR A;  1R0R I;  1X74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...