3UEYA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVFNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
molecule keywords Protein kinase C delta type
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ueyA01
3UGDA 4B6DA 2ORWA 5FUYA 5FUXA 2B8TA 2ENZA 2UZ3A 2QQ0A 1TBOA 2ROWA 1RFHA 4UXJA 1XX6A 5FUWA 1XBTA 2WVJA 3UEJA 1W4RA 2QQEA 4FKDA 3CXLA 2J87A 2VRWB 3BJIA 1PTRA 2ENNA 2GVIA 1FARA 1Y8FA 2FNFX 4UXHA 3UFFA 2DB6A 2JA1A 2YUUA 1TBNA 1PTQA 2ORVA 3UGIA 2E73A 2QPOA 4UXIA 1R79A 1FAQA 4L9MA 1XA6A 3KY9A 2J9RA 1KBEA 3UGLA 1KBFA 5FUVA 3UEYA 2ELIA 3E2IA
chains in the Genus database with same CATH superfamily
2KCXA 3VDPA 2KMQA 2NU0I 1SGNI 2X3TA 1V1HA 1P9ZA 1SGQI 2SGQI 1YTPA 2UZ3A 5FUWA 4UXJA 3UEJA 2WVJA 2DIPA 2N17A 3OXGA 2V53A 4DNCA 2ODDA 1X74A 3SGBI 3TOAA 1P9GA 1PTRA 2NU2I 4GI3C 2FNFX 4A24A 1MJ9A 1K7TA 4E1RA 3OXLA 2YUUA 2K9HA 1TBNA 1PTQA 1MJBA 2NU3I 2ORVA 1X4SA 2Y0MA 2E73A 3QWPA 3FSYA 4MPIA 1NUBA 2M5XA 2ERWA 2NU4I 3KY9A 4HGUA 5E3PA 1TURA 2OD1A 1KMAA 5E3QA 1UHAA 3E2IA 3SGQI 2OU2A 1HDLA 4AMLA 1CGJI 2BUSA 5FUXA 2B8TA 2JZMA 4SGBI 1MT1A 1BUSA 2WCYA 2XRCA 4OVOA 3RU0A 2ARPF 1CT2I 1LR7A 4FKDA 1ULNA 5HQ8A 1MJAA 3D00A 5J8CA 3E59A 2F3CI 2J87A 2OZUA 2VRWB 3QTLD 5E3RA 2ENNA 1Y8FA 1CT0I 1UUCA 1PCEA 1HEVA 2RIJA 1WKXA 4E1PA 3UGIA 2GKRI 2KMOA 2QPOA 4UXIA 2RC4A 3TO7A 1OVOA 1UVGA 1Q9BA 1YU6C 2KMPA 1XA6A 3OXFA 1KBFA 2QQCA 2E5RA 2N1AB 3UEYA 1H0ZA 5J8FA 2CWHA 2ELIA 1S20A 1FY7A 1BMOA 1TGSI 2SGFI 1N13A 1VDDA 3OL0A 3QAHA 3UGDA 5CCLA 2CWFA 1LR8A 2CWGA 2DKVA 1CHOI 1TBOA 3SEKC 1M8CA 1XX6A 1FYBA 1XBTA 2B0UC 2N71A 2QQEA 2CJSC 2JXDA 1CT4I 1SGDI 2LUYA 2LB7A 3R5CA 1U5KA 1TBRR 3CXLA 1OYVI 3BJIA 2GVIA 3UFFA 1FARA 2L7XA 5HI7A 2SGDI 1HPTA 1TIHA 2DB6A 2JA1A 2KMRA 1PPFI 1R0RI 1SGYI 2A20A 1W3SA 3VE5A 2GKVA 1IW4A 1SGEI 1CGII 1TOTA 2QQDA 1WGTA 1R79A 3OVOA 1WTJA 2X52A 4L9MA 1AN1I 1K7UA 1KBEA 3UGLA 1UVFA 2SGEI 2V1CC 3TJQA 1WGCA 1HJAI 5FUVA 3VDUA 1OMTA 3PDNA 1CSOI 5CCMA 4B6DA 2ORWA 2UVOA 5FUYA 3GOXA 1TUSA 2ENZA 2L8EA 1V1IA 2JYYA 2QQ0A 1RFHA 2ROWA 3FC3A 1IY6A 1Y1BA 1LR9A 1W4RA 1TBQR 2PQ8A 2GKTI 1Y1CA 1DS2I 1NXUA 2YQPA 1Z7KB 1SGPI 3FSXA 3UOEA 1SGRI 3HH2C 4UXHA 2N52A 4JCVE 1CE3A 1DS3I 3B4VC 2NU1I 3R5BA 1PJUA 1OMUA 3TO6A 2WGCA 3MEKA 1Z2IA 1K7VA 3R5DA 3TOBA 7WGAA 3R5AA 5JHWC 1IY5A 2V1CA 1FAQA 5EX0A 2OVOA 4WP4A 2LEOA 5DAEA 2P6AC 1ULMA 1M8BA 2J9RA 5EX3A 9WGAA 2GIVA 2SGPI 2W0TA 2JW6A 1ULKA 3TO9A
chains in the Genus database with same CATH topology
2KCXA 3VDPA 2KMQA 2NU0I 1SGNI 1V1HA 1SGQI 2SGQI 1YTPA 2UZ3A 5FUWA 4UXJA 3UEJA 2WVJA 2DIPA 2N17A 3OXGA 2V53A 2ODDA 1X74A 3SGBI 1PTRA 2NU2I 4GI3C 2FNFX 4A24A 4E1RA 3OXLA 2YUUA 2K9HA 1TBNA 1PTQA 2NU3I 2ORVA 1X4SA 2E73A 3QWPA 1NUBA 2M5XA 2ERWA 2NU4I 3KY9A 4HGUA 1TURA 2OD1A 1KMAA 3E2IA 3SGQI 1HDLA 1CGJI 2BUSA 5FUXA 2B8TA 2JZMA 4SGBI 1MT1A 1BUSA 2WCYA 2XRCA 4OVOA 3RU0A 2ARPF 1CT2I 1LR7A 4FKDA 5HQ8A 3D00A 3E59A 2F3CI 2J87A 2VRWB 3QTLD 2ENNA 1Y8FA 1CT0I 1UUCA 1PCEA 4E1PA 3UGIA 2GKRI 2KMOA 2QPOA 4UXIA 1OVOA 1UVGA 1YU6C 2KMPA 1XA6A 3OXFA 1KBFA 2QQCA 2E5RA 2N1AB 3UEYA 1H0ZA 2ELIA 1BMOA 1TGSI 2SGFI 1N13A 1VDDA 3OL0A 3UGDA 5CCLA 1LR8A 1CHOI 1TBOA 3SEKC 1M8CA 1XX6A 1FYBA 1XBTA 2B0UC 2N71A 2QQEA 2CJSC 2JXDA 1CT4I 1SGDI 2LUYA 1U5KA 1TBRR 3CXLA 1OYVI 3BJIA 2GVIA 3UFFA 1FARA 2L7XA 5HI7A 2SGDI 1HPTA 1TIHA 2DB6A 2JA1A 2KMRA 1PPFI 1R0RI 1SGYI 2A20A 1W3SA 3VE5A 2GKVA 1SGEI 1CGII 1TOTA 2QQDA 1R79A 3OVOA 4L9MA 1AN1I 1KBEA 3UGLA 1UVFA 2SGEI 2V1CC 3TJQA 5FUVA 1HJAI 3VDUA 1OMTA 3PDNA 1CSOI 5CCMA 4B6DA 2ORWA 5FUYA 3GOXA 1TUSA 2ENZA 2L8EA 1V1IA 2JYYA 2QQ0A 1RFHA 2ROWA 3FC3A 1IY6A 1Y1BA 1LR9A 1W4RA 1TBQR 2GKTI 1Y1CA 1DS2I 2YQPA 1Z7KB 1SGPI 1SGRI 3HH2C 4UXHA 2N52A 4JCVE 1CE3A 1DS3I 3B4VC 2NU1I 1PJUA 1OMUA 1IW4A 3MEKA 5JHWC 1IY5A 2V1CA 1FAQA 5EX0A 2OVOA 2LEOA 5DAEA 2P6AC 5EX3A 1M8BA 2J9RA 2SGPI 2W0TA 2JW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UGD A;  4B6D A;  2ORW A;  5FUY A;  5FUX A;  2B8T A;  2ENZ A;  2UZ3 A;  2QQ0 A;  1TBO A;  2ROW A;  1RFH A;  4UXJ A;  1XX6 A;  5FUW A;  1XBT A;  2WVJ A;  3UEJ A;  1W4R A;  2QQE A;  4FKD A;  3CXL A;  2J87 A;  2VRW B;  3BJI A;  1PTR A;  2ENN A;  2GVI A;  1FAR A;  1Y8F A;  2FNF X;  4UXH A;  3UFF A;  2DB6 A;  2JA1 A;  2YUU A;  1TBN A;  1PTQ A;  2ORV A;  3UGI A;  2E73 A;  2QPO A;  4UXI A;  1R79 A;  1FAQ A;  4L9M A;  1XA6 A;  3KY9 A;  2J9R A;  1KBE A;  3UGL A;  1KBF A;  5FUV A;  3UEY A;  2ELI A;  3E2I A; 
#chains in the Genus database with same CATH topology
 2KCX A;  3VDP A;  2KMQ A;  2NU0 I;  1SGN I;  2X3T A;  1V1H A;  1P9Z A;  1SGQ I;  2SGQ I;  1YTP A;  2UZ3 A;  5FUW A;  4UXJ A;  3UEJ A;  2WVJ A;  2DIP A;  2N17 A;  3OXG A;  2V53 A;  4DNC A;  2ODD A;  1X74 A;  3SGB I;  3TOA A;  1P9G A;  1PTR A;  2NU2 I;  4GI3 C;  2FNF X;  4A24 A;  1MJ9 A;  1K7T A;  4E1R A;  3OXL A;  2YUU A;  2K9H A;  1TBN A;  1PTQ A;  1MJB A;  2NU3 I;  2ORV A;  1X4S A;  2Y0M A;  2E73 A;  3QWP A;  3FSY A;  4MPI A;  1NUB A;  2M5X A;  2ERW A;  2NU4 I;  3KY9 A;  4HGU A;  5E3P A;  1TUR A;  2OD1 A;  1KMA A;  5E3Q A;  1UHA A;  3E2I A;  3SGQ I;  2OU2 A;  1HDL A;  4AML A;  1CGJ I;  2BUS A;  5FUX A;  2B8T A;  2JZM A;  4SGB I;  1MT1 A;  1BUS A;  2WCY A;  2XRC A;  4OVO A;  3RU0 A;  2ARP F;  1CT2 I;  1LR7 A;  4FKD A;  1ULN A;  5HQ8 A;  1MJA A;  3D00 A;  5J8C A;  3E59 A;  2F3C I;  2J87 A;  2OZU A;  2VRW B;  3QTL D;  5E3R A;  2ENN A;  1Y8F A;  1CT0 I;  1UUC A;  1PCE A;  1HEV A;  2RIJ A;  1WKX A;  4E1P A;  3UGI A;  2GKR I;  2KMO A;  2QPO A;  4UXI A;  2RC4 A;  3TO7 A;  1OVO A;  1UVG A;  1Q9B A;  1YU6 C;  2KMP A;  1XA6 A;  3OXF A;  1KBF A;  2QQC A;  2E5R A;  2N1A B;  3UEY A;  1H0Z A;  5J8F A;  2CWH A;  2ELI A;  1S20 A;  1FY7 A;  1BMO A;  1TGS I;  2SGF I;  1N13 A;  1VDD A;  3OL0 A;  3QAH A;  3UGD A;  5CCL A;  2CWF A;  1LR8 A;  2CWG A;  2DKV A;  1CHO I;  1TBO A;  3SEK C;  1M8C A;  1XX6 A;  1FYB A;  1XBT A;  2B0U C;  2N71 A;  2QQE A;  2CJS C;  2JXD A;  1CT4 I;  1SGD I;  2LUY A;  2LB7 A;  3R5C A;  1U5K A;  1TBR R;  3CXL A;  1OYV I;  3BJI A;  2GVI A;  3UFF A;  1FAR A;  2L7X A;  5HI7 A;  2SGD I;  1HPT A;  1TIH A;  2DB6 A;  2JA1 A;  2KMR A;  1PPF I;  1R0R I;  1SGY I;  2A20 A;  1W3S A;  3VE5 A;  2GKV A;  1IW4 A;  1SGE I;  1CGI I;  1TOT A;  2QQD A;  1WGT A;  1R79 A;  3OVO A;  1WTJ A;  2X52 A;  4L9M A;  1AN1 I;  1K7U A;  1KBE A;  3UGL A;  1UVF A;  2SGE I;  2V1C C;  3TJQ A;  1WGC A;  1HJA I;  5FUV A;  3VDU A;  1OMT A;  3PDN A;  1CSO I;  5CCM A;  4B6D A;  2ORW A;  2UVO A;  5FUY A;  3GOX A;  1TUS A;  2ENZ A;  2L8E A;  1V1I A;  2JYY A;  2QQ0 A;  1RFH A;  2ROW A;  3FC3 A;  1IY6 A;  1Y1B A;  1LR9 A;  1W4R A;  1TBQ R;  2PQ8 A;  2GKT I;  1Y1C A;  1DS2 I;  1NXU A;  2YQP A;  1Z7K B;  1SGP I;  3FSX A;  3UOE A;  1SGR I;  3HH2 C;  4UXH A;  2N52 A;  4JCV E;  1CE3 A;  1DS3 I;  3B4V C;  2NU1 I;  3R5B A;  1PJU A;  1OMU A;  3TO6 A;  2WGC A;  3MEK A;  1Z2I A;  1K7V A;  3R5D A;  3TOB A;  7WGA A;  3R5A A;  5JHW C;  1IY5 A;  2V1C A;  1FAQ A;  5EX0 A;  2OVO A;  4WP4 A;  2LEO A;  5DAE A;  2P6A C;  1ULM A;  1M8B A;  2J9R A;  5EX3 A;  9WGA A;  2GIV A;  2SGP I;  2W0T A;  2JW6 A;  1ULK A;  3TO9 A; 
#chains in the Genus database with same CATH homology
 2KCX A;  3VDP A;  2KMQ A;  2NU0 I;  1SGN I;  1V1H A;  1SGQ I;  2SGQ I;  1YTP A;  2UZ3 A;  5FUW A;  4UXJ A;  3UEJ A;  2WVJ A;  2DIP A;  2N17 A;  3OXG A;  2V53 A;  2ODD A;  1X74 A;  3SGB I;  1PTR A;  2NU2 I;  4GI3 C;  2FNF X;  4A24 A;  4E1R A;  3OXL A;  2YUU A;  2K9H A;  1TBN A;  1PTQ A;  2NU3 I;  2ORV A;  1X4S A;  2E73 A;  3QWP A;  1NUB A;  2M5X A;  2ERW A;  2NU4 I;  3KY9 A;  4HGU A;  1TUR A;  2OD1 A;  1KMA A;  3E2I A;  3SGQ I;  1HDL A;  1CGJ I;  2BUS A;  5FUX A;  2B8T A;  2JZM A;  4SGB I;  1MT1 A;  1BUS A;  2WCY A;  2XRC A;  4OVO A;  3RU0 A;  2ARP F;  1CT2 I;  1LR7 A;  4FKD A;  5HQ8 A;  3D00 A;  3E59 A;  2F3C I;  2J87 A;  2VRW B;  3QTL D;  2ENN A;  1Y8F A;  1CT0 I;  1UUC A;  1PCE A;  4E1P A;  3UGI A;  2GKR I;  2KMO A;  2QPO A;  4UXI A;  1OVO A;  1UVG A;  1YU6 C;  2KMP A;  1XA6 A;  3OXF A;  1KBF A;  2QQC A;  2E5R A;  2N1A B;  3UEY A;  1H0Z A;  2ELI A;  1BMO A;  1TGS I;  2SGF I;  1N13 A;  1VDD A;  3OL0 A;  3UGD A;  5CCL A;  1LR8 A;  1CHO I;  1TBO A;  3SEK C;  1M8C A;  1XX6 A;  1FYB A;  1XBT A;  2B0U C;  2N71 A;  2QQE A;  2CJS C;  2JXD A;  1CT4 I;  1SGD I;  2LUY A;  1U5K A;  1TBR R;  3CXL A;  1OYV I;  3BJI A;  2GVI A;  3UFF A;  1FAR A;  2L7X A;  5HI7 A;  2SGD I;  1HPT A;  1TIH A;  2DB6 A;  2JA1 A;  2KMR A;  1PPF I;  1R0R I;  1SGY I;  2A20 A;  1W3S A;  3VE5 A;  2GKV A;  1SGE I;  1CGI I;  1TOT A;  2QQD A;  1R79 A;  3OVO A;  4L9M A;  1AN1 I;  1KBE A;  3UGL A;  1UVF A;  2SGE I;  2V1C C;  3TJQ A;  5FUV A;  1HJA I;  3VDU A;  1OMT A;  3PDN A;  1CSO I;  5CCM A;  4B6D A;  2ORW A;  5FUY A;  3GOX A;  1TUS A;  2ENZ A;  2L8E A;  1V1I A;  2JYY A;  2QQ0 A;  1RFH A;  2ROW A;  3FC3 A;  1IY6 A;  1Y1B A;  1LR9 A;  1W4R A;  1TBQ R;  2GKT I;  1Y1C A;  1DS2 I;  2YQP A;  1Z7K B;  1SGP I;  1SGR I;  3HH2 C;  4UXH A;  2N52 A;  4JCV E;  1CE3 A;  1DS3 I;  3B4V C;  2NU1 I;  1PJU A;  1OMU A;  1IW4 A;  3MEK A;  5JHW C;  1IY5 A;  2V1C A;  1FAQ A;  5EX0 A;  2OVO A;  2LEO A;  5DAE A;  2P6A C;  5EX3 A;  1M8B A;  2J9R A;  2SGP I;  2W0T A;  2JW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...