2JXDA

Nmr structure of human serine protease inhibitor kazal type ii (spink2)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
PQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease inhibitor Kazal-type 2
publication title Identification of trypsin-inhibitory site and structure determination of human SPINK2 serine proteinase inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 9
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2jxdA00
2WCYA 2F3CI 2SGFI 3HH2C 1TUSA 1BMOA 1SGRI 2NU1I 1CT4I 2KMRA 2XRCA 2QQDA 1SGQI 1SGDI 1UVFA 2N17A 1TURA 1CGJI 1UVGA 2KMQA 3QTLD 1CGII 1Z7KB 2NU4I 1YTPA 4HGUA 4SGBI 1PJUA 3OVOA 1OMTA 1IY6A 2GKRI 1Y1BA 2GKVA 2ERWA 2LEOA 4OVOA 2SGQI 2M5XA 2N52A 2BUSA 1FYBA 2NU0I 1BUSA 1KMAA 2SGDI 1CSOI 1MT1A 2N71A 2B0UC 1IW4A 1Y1CA 1LR7A 2SGEI 2KMPA 1PPFI 2QQCA 1NUBA 1AN1I 2JXDA 1TGSI 2NU3I 3B4VC 2KMOA 1SGEI 2ARPF 1HPTA 5DAEA 1M8BA 2OVOA 1CHOI 3TJQA 1DS3I 2V53A 2NU2I 1CT0I 1SGYI 1IY5A 3SGQI 1OVOA 1TBQR 5JHWC 1PCEA 2JZMA 1N13A 1LR8A 3SEKC 1HDLA 2JYYA 1CE3A 1SGPI 1YU6C 1LR9A 4GI3C 3SGBI 2SGPI 1OYVI 1CT2I 1M8CA 2P6AC 1H0ZA 2KCXA 1R0RI 2GKTI 1SGNI 1DS2I 1TIHA 1OMUA 1UUCA 1TBRR 1HJAI
chains in the Genus database with same CATH superfamily
1MJAA 5CCLA 1V1HA 2J9RA 3UEYA 2WGCA 2L8EA 2WCYA 3VDUA 2F3CI 2SGFI 3HH2C 2FNFX 1TUSA 1TOTA 1BMOA 1SGRI 2NU1I 1CT4I 2KMRA 3OL0A 2XRCA 2QQDA 1SGQI 3TO6A 2YUUA 5HI7A 1SGDI 2X52A 1UVFA 2UZ3A 2N17A 1TURA 1CGJI 3E59A 1UVGA 2V1CA 2KMQA 3QTLD 4AMLA 1CGII 3UGIA 1Z7KB 2GVIA 1YTPA 2NU4I 4MPIA 4HGUA 2ENZA 4SGBI 1PJUA 2DB6A 3OXGA 4UXIA 3OVOA 1Y8FA 1OMTA 2ORWA 1X4SA 1IY6A 1P9ZA 1Y1BA 2GKRI 2ERWA 2GKVA 3QWPA 4L9MA 2LEOA 1K7TA 1PTQA 1K7VA 2M5XA 2E73A 2N52A 2OU2A 1Q9BA 1ULKA 2SGQI 2W0TA 4UXHA 1TBNA 2CWHA 2BUSA 1FYBA 2QPOA 4JCVE 2NU0I 2DIPA 1BUSA 2VRWB 1KMAA 3CXLA 3VDPA 2SGDI 1W3SA 3R5BA 3FC3A 2QQEA 5E3PA 2J87A 1CSOI 1MT1A 2CJSC 2E5RA 2N71A 3R5CA 5EX3A 2B0UC 1IW4A 1KBFA 1UHAA 1Y1CA 3FSYA 1LR7A 1TBOA 2ENNA 2SGEI 2KMPA 3UOEA 1PPFI 2QQCA 2QQ0A 2YQPA 1NUBA 2CWFA 1AN1I 5FUYA 2JXDA 1TGSI 1NXUA 2ODDA 2NU3I 3B4VC 2DKVA 1SGEI 2KMOA 4A24A 3QAHA 1FAQA 2RC4A 1Z2IA 2ARPF 2PQ8A 5E3QA 4E1RA 3GOXA 2WVJA 1HPTA 5DAEA 5J8FA 1XBTA 2ROWA 1WKXA 3OXLA 1M8BA 2OVOA 2OZUA 3UGDA 1CHOI 3TJQA 4B6DA 2K9HA 3OXFA 3KY9A 1ULMA 2JW6A 1DS3I 1W4RA 4E1PA 1WGTA 1RFHA 2V53A 4WP4A 4DNCA 1WGCA 1U5KA 2NU2I 1CT0I 3RU0A 1SGYI 2B8TA 3SGQI 1IY5A 3UGLA 3TOBA 3UFFA 1MJBA 3UEJA 1OVOA 1TBQR 1XX6A 5JHWC 1PCEA 2JZMA 2ORVA 2GIVA 1N13A 3TO9A 1HEVA 5FUVA 1LR8A 2JA1A 5FUXA 1X74A 3SEKC 1VDDA 5EX0A 1HDLA 2JYYA 4FKDA 1CE3A 2V1CC 1SGPI 1YU6C 1P9GA 2X3TA 3BJIA 9WGAA 1LR9A 2L7XA 4GI3C 3TO7A 7WGAA 3SGBI 3PDNA 1XA6A 5FUWA 2SGPI 1KBEA 5CCMA 1OYVI 1PTRA 3FSXA 2N1AB 1CT2I 1M8CA 2P6AC 2LUYA 3TOAA 1H0ZA 2ELIA 2KCXA 1FY7A 1K7UA 1R0RI 1R79A 2GKTI 3E2IA 1ULNA 3R5DA 1V1IA 2OD1A 1S20A 5J8CA 1SGNI 1DS2I 1TIHA 1WTJA 2UVOA 1FARA 3MEKA 1OMUA 5HQ8A 1MJ9A 1UUCA 3VE5A 5E3RA 2CWGA 4UXJA 2A20A 2Y0MA 2LB7A 3D00A 3R5AA 1TBRR 1HJAI 4OVOA 2RIJA
chains in the Genus database with same CATH topology
5CCLA 1V1HA 2J9RA 3UEYA 2L8EA 2WCYA 3VDUA 2F3CI 2SGFI 3HH2C 2FNFX 1TUSA 1TOTA 1BMOA 1SGRI 2NU1I 1CT4I 2KMRA 3OL0A 2XRCA 2QQDA 1SGQI 2YUUA 5HI7A 1SGDI 1UVFA 2UZ3A 2N17A 1TURA 1CGJI 3E59A 1UVGA 2V1CA 2KMQA 3QTLD 1CGII 3UGIA 1Z7KB 2GVIA 1YTPA 2NU4I 4HGUA 2ENZA 4SGBI 1PJUA 2DB6A 3OXGA 4UXIA 3OVOA 1Y8FA 1OMTA 2ORWA 1X4SA 1IY6A 2GKRI 1Y1BA 2GKVA 2ERWA 3QWPA 4L9MA 2LEOA 4OVOA 1PTQA 2SGQI 2M5XA 2E73A 2N52A 2W0TA 4UXHA 1TBNA 2BUSA 1FYBA 2QPOA 4JCVE 2NU0I 2DIPA 1BUSA 2VRWB 1KMAA 3CXLA 3VDPA 2SGDI 1W3SA 3FC3A 2QQEA 2J87A 1CSOI 1MT1A 2CJSC 2E5RA 2N71A 5EX3A 2B0UC 1IW4A 1KBFA 1Y1CA 1LR7A 1TBOA 2ENNA 2SGEI 2KMPA 1PPFI 2QQCA 2QQ0A 2YQPA 1NUBA 1AN1I 5FUYA 2JXDA 1TGSI 2ODDA 2NU3I 3B4VC 2KMOA 1SGEI 4A24A 1FAQA 2ARPF 4E1RA 3GOXA 2WVJA 1HPTA 5DAEA 1XBTA 2ROWA 3OXLA 1M8BA 2OVOA 3UGDA 1CHOI 3TJQA 4B6DA 2K9HA 3OXFA 3KY9A 2JW6A 4E1PA 1DS3I 1W4RA 1RFHA 2V53A 2NU2I 1U5KA 3RU0A 1CT0I 1SGYI 2B8TA 3SGQI 1IY5A 3UGLA 3UFFA 3UEJA 1OVOA 1TBQR 1XX6A 5JHWC 1PCEA 2JZMA 2ORVA 1N13A 5FUVA 1LR8A 2JA1A 5FUXA 1X74A 3SEKC 1VDDA 5EX0A 1HDLA 2JYYA 4FKDA 1CE3A 2V1CC 1SGPI 1YU6C 3BJIA 1LR9A 2L7XA 4GI3C 3SGBI 3PDNA 1XA6A 5FUWA 2SGPI 1KBEA 5CCMA 1OYVI 1PTRA 2N1AB 1CT2I 1M8CA 2P6AC 2LUYA 1H0ZA 2ELIA 2KCXA 3E2IA 1R0RI 1R79A 2GKTI 1V1IA 2OD1A 1SGNI 1DS2I 1TIHA 1FARA 3MEKA 1OMUA 5HQ8A 1UUCA 3VE5A 4UXJA 2A20A 3D00A 1TBRR 1HJAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCY A;  2F3C I;  2SGF I;  3HH2 C;  1TUS A;  1BMO A;  1SGR I;  2NU1 I;  1CT4 I;  2KMR A;  2XRC A;  2QQD A;  1SGQ I;  1SGD I;  1UVF A;  2N17 A;  1TUR A;  1CGJ I;  1UVG A;  2KMQ A;  3QTL D;  1CGI I;  1Z7K B;  2NU4 I;  1YTP A;  4HGU A;  4SGB I;  1PJU A;  3OVO A;  1OMT A;  1IY6 A;  2GKR I;  1Y1B A;  2GKV A;  2ERW A;  2LEO A;  4OVO A;  2SGQ I;  2M5X A;  2N52 A;  2BUS A;  1FYB A;  2NU0 I;  1BUS A;  1KMA A;  2SGD I;  1CSO I;  1MT1 A;  2N71 A;  2B0U C;  1IW4 A;  1Y1C A;  1LR7 A;  2SGE I;  2KMP A;  1PPF I;  2QQC A;  1NUB A;  1AN1 I;  2JXD A;  1TGS I;  2NU3 I;  3B4V C;  2KMO A;  1SGE I;  2ARP F;  1HPT A;  5DAE A;  1M8B A;  2OVO A;  1CHO I;  3TJQ A;  1DS3 I;  2V53 A;  2NU2 I;  1CT0 I;  1SGY I;  1IY5 A;  3SGQ I;  1OVO A;  1TBQ R;  5JHW C;  1PCE A;  2JZM A;  1N13 A;  1LR8 A;  3SEK C;  1HDL A;  2JYY A;  1CE3 A;  1SGP I;  1YU6 C;  1LR9 A;  4GI3 C;  3SGB I;  2SGP I;  1OYV I;  1CT2 I;  1M8C A;  2P6A C;  1H0Z A;  2KCX A;  1R0R I;  2GKT I;  1SGN I;  1DS2 I;  1TIH A;  1OMU A;  1UUC A;  1TBR R;  1HJA I; 
#chains in the Genus database with same CATH topology
 1MJA A;  5CCL A;  1V1H A;  2J9R A;  3UEY A;  2WGC A;  2L8E A;  2WCY A;  3VDU A;  2F3C I;  2SGF I;  3HH2 C;  2FNF X;  1TUS A;  1TOT A;  1BMO A;  1SGR I;  2NU1 I;  1CT4 I;  2KMR A;  3OL0 A;  2XRC A;  2QQD A;  1SGQ I;  3TO6 A;  2YUU A;  5HI7 A;  1SGD I;  2X52 A;  1UVF A;  2UZ3 A;  2N17 A;  1TUR A;  1CGJ I;  3E59 A;  1UVG A;  2V1C A;  2KMQ A;  3QTL D;  4AML A;  1CGI I;  3UGI A;  1Z7K B;  2GVI A;  1YTP A;  2NU4 I;  4MPI A;  4HGU A;  2ENZ A;  4SGB I;  1PJU A;  2DB6 A;  3OXG A;  4UXI A;  3OVO A;  1Y8F A;  1OMT A;  2ORW A;  1X4S A;  1IY6 A;  1P9Z A;  1Y1B A;  2GKR I;  2ERW A;  2GKV A;  3QWP A;  4L9M A;  2LEO A;  1K7T A;  1PTQ A;  1K7V A;  2M5X A;  2E73 A;  2N52 A;  2OU2 A;  1Q9B A;  1ULK A;  2SGQ I;  2W0T A;  4UXH A;  1TBN A;  2CWH A;  2BUS A;  1FYB A;  2QPO A;  4JCV E;  2NU0 I;  2DIP A;  1BUS A;  2VRW B;  1KMA A;  3CXL A;  3VDP A;  2SGD I;  1W3S A;  3R5B A;  3FC3 A;  2QQE A;  5E3P A;  2J87 A;  1CSO I;  1MT1 A;  2CJS C;  2E5R A;  2N71 A;  3R5C A;  5EX3 A;  2B0U C;  1IW4 A;  1KBF A;  1UHA A;  1Y1C A;  3FSY A;  1LR7 A;  1TBO A;  2ENN A;  2SGE I;  2KMP A;  3UOE A;  1PPF I;  2QQC A;  2QQ0 A;  2YQP A;  1NUB A;  2CWF A;  1AN1 I;  5FUY A;  2JXD A;  1TGS I;  1NXU A;  2ODD A;  2NU3 I;  3B4V C;  2DKV A;  1SGE I;  2KMO A;  4A24 A;  3QAH A;  1FAQ A;  2RC4 A;  1Z2I A;  2ARP F;  2PQ8 A;  5E3Q A;  4E1R A;  3GOX A;  2WVJ A;  1HPT A;  5DAE A;  5J8F A;  1XBT A;  2ROW A;  1WKX A;  3OXL A;  1M8B A;  2OVO A;  2OZU A;  3UGD A;  1CHO I;  3TJQ A;  4B6D A;  2K9H A;  3OXF A;  3KY9 A;  1ULM A;  2JW6 A;  1DS3 I;  1W4R A;  4E1P A;  1WGT A;  1RFH A;  2V53 A;  4WP4 A;  4DNC A;  1WGC A;  1U5K A;  2NU2 I;  1CT0 I;  3RU0 A;  1SGY I;  2B8T A;  3SGQ I;  1IY5 A;  3UGL A;  3TOB A;  3UFF A;  1MJB A;  3UEJ A;  1OVO A;  1TBQ R;  1XX6 A;  5JHW C;  1PCE A;  2JZM A;  2ORV A;  2GIV A;  1N13 A;  3TO9 A;  1HEV A;  5FUV A;  1LR8 A;  2JA1 A;  5FUX A;  1X74 A;  3SEK C;  1VDD A;  5EX0 A;  1HDL A;  2JYY A;  4FKD A;  1CE3 A;  2V1C C;  1SGP I;  1YU6 C;  1P9G A;  2X3T A;  3BJI A;  9WGA A;  1LR9 A;  2L7X A;  4GI3 C;  3TO7 A;  7WGA A;  3SGB I;  3PDN A;  1XA6 A;  5FUW A;  2SGP I;  1KBE A;  5CCM A;  1OYV I;  1PTR A;  3FSX A;  2N1A B;  1CT2 I;  1M8C A;  2P6A C;  2LUY A;  3TOA A;  1H0Z A;  2ELI A;  2KCX A;  1FY7 A;  1K7U A;  1R0R I;  1R79 A;  2GKT I;  3E2I A;  1ULN A;  3R5D A;  1V1I A;  2OD1 A;  1S20 A;  5J8C A;  1SGN I;  1DS2 I;  1TIH A;  1WTJ A;  2UVO A;  1FAR A;  3MEK A;  1OMU A;  5HQ8 A;  1MJ9 A;  1UUC A;  3VE5 A;  5E3R A;  2CWG A;  4UXJ A;  2A20 A;  2Y0M A;  2LB7 A;  3D00 A;  3R5A A;  1TBR R;  1HJA I;  4OVO A;  2RIJ A; 
#chains in the Genus database with same CATH homology
 5CCL A;  1V1H A;  2J9R A;  3UEY A;  2L8E A;  2WCY A;  3VDU A;  2F3C I;  2SGF I;  3HH2 C;  2FNF X;  1TUS A;  1TOT A;  1BMO A;  1SGR I;  2NU1 I;  1CT4 I;  2KMR A;  3OL0 A;  2XRC A;  2QQD A;  1SGQ I;  2YUU A;  5HI7 A;  1SGD I;  1UVF A;  2UZ3 A;  2N17 A;  1TUR A;  1CGJ I;  3E59 A;  1UVG A;  2V1C A;  2KMQ A;  3QTL D;  1CGI I;  3UGI A;  1Z7K B;  2GVI A;  1YTP A;  2NU4 I;  4HGU A;  2ENZ A;  4SGB I;  1PJU A;  2DB6 A;  3OXG A;  4UXI A;  3OVO A;  1Y8F A;  1OMT A;  2ORW A;  1X4S A;  1IY6 A;  2GKR I;  1Y1B A;  2GKV A;  2ERW A;  3QWP A;  4L9M A;  2LEO A;  4OVO A;  1PTQ A;  2SGQ I;  2M5X A;  2E73 A;  2N52 A;  2W0T A;  4UXH A;  1TBN A;  2BUS A;  1FYB A;  2QPO A;  4JCV E;  2NU0 I;  2DIP A;  1BUS A;  2VRW B;  1KMA A;  3CXL A;  3VDP A;  2SGD I;  1W3S A;  3FC3 A;  2QQE A;  2J87 A;  1CSO I;  1MT1 A;  2CJS C;  2E5R A;  2N71 A;  5EX3 A;  2B0U C;  1IW4 A;  1KBF A;  1Y1C A;  1LR7 A;  1TBO A;  2ENN A;  2SGE I;  2KMP A;  1PPF I;  2QQC A;  2QQ0 A;  2YQP A;  1NUB A;  1AN1 I;  5FUY A;  2JXD A;  1TGS I;  2ODD A;  2NU3 I;  3B4V C;  2KMO A;  1SGE I;  4A24 A;  1FAQ A;  2ARP F;  4E1R A;  3GOX A;  2WVJ A;  1HPT A;  5DAE A;  1XBT A;  2ROW A;  3OXL A;  1M8B A;  2OVO A;  3UGD A;  1CHO I;  3TJQ A;  4B6D A;  2K9H A;  3OXF A;  3KY9 A;  2JW6 A;  4E1P A;  1DS3 I;  1W4R A;  1RFH A;  2V53 A;  2NU2 I;  1U5K A;  3RU0 A;  1CT0 I;  1SGY I;  2B8T A;  3SGQ I;  1IY5 A;  3UGL A;  3UFF A;  3UEJ A;  1OVO A;  1TBQ R;  1XX6 A;  5JHW C;  1PCE A;  2JZM A;  2ORV A;  1N13 A;  5FUV A;  1LR8 A;  2JA1 A;  5FUX A;  1X74 A;  3SEK C;  1VDD A;  5EX0 A;  1HDL A;  2JYY A;  4FKD A;  1CE3 A;  2V1C C;  1SGP I;  1YU6 C;  3BJI A;  1LR9 A;  2L7X A;  4GI3 C;  3SGB I;  3PDN A;  1XA6 A;  5FUW A;  2SGP I;  1KBE A;  5CCM A;  1OYV I;  1PTR A;  2N1A B;  1CT2 I;  1M8C A;  2P6A C;  2LUY A;  1H0Z A;  2ELI A;  2KCX A;  3E2I A;  1R0R I;  1R79 A;  2GKT I;  1V1I A;  2OD1 A;  1SGN I;  1DS2 I;  1TIH A;  1FAR A;  3MEK A;  1OMU A;  5HQ8 A;  1UUC A;  3VE5 A;  4UXJ A;  2A20 A;  3D00 A;  1TBR R;  1HJA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...