2JXDA

Nmr structure of human serine protease inhibitor kazal type ii (spink2)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
PQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Serine protease inhibitor Kazal-type 2
publication title Identification of trypsin-inhibitory site and structure determination of human SPINK2 serine proteinase inhibitor
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2jxdA00
1M8CA 2NU2I 1LR8A 2F3CI 4SGBI 1PCEA 2GKRI 4HGUA 1CT0I 1FYBA 1SGPI 2NU0I 2NU3I 1HPTA 1TGSI 2GKVA 1OMTA 1Y1BA 1HJAI 1BMOA 2KMOA 2QQDA 2P6AC 1SGEI 1UUCA 1M8BA 1OMUA 1NUBA 1DS2I 2KMPA 4GI3C 2JYYA 1SGQI 2WCYA 1SGDI 1SGRI 2SGFI 1N13A 2NU1I 1YU6C 5DAEA 2SGEI 2JXDA 3TJQA 2B0UC 1UVGA 2KMRA 4OVOA 1CHOI 3B4VC 2XRCA 1SGYI 1OVOA 2LEOA 1MT1A 1CGII 2JZMA 3SGQI 1H0ZA 2KMQA 2ARPF 1TBQR 1AN1I 1Z7KB 2V53A 3HH2C 2SGPI 1CT4I 2GKTI 3QTLD 2ERWA 3OVOA 2NU4I 2KCXA 1LR7A 1YTPA 2OVOA 2BUSA 2M5XA 2SGQI 2QQCA 1Y1CA 1TBRR 1IW4A 1BUSA 1PJUA 1SGNI 1CGJI 1TIHA 3SEKC 1CT2I 1IY6A 1IY5A 2N17A 2N52A 2N71A 3SGBI 1DS3I 1UVFA 1PPFI 1R0RI 1LR9A 1TUSA 1KMAA 5JHWC 1HDLA 1CE3A 1TURA 1CSOI 1OYVI 2SGDI
chains in the Genus database with same CATH superfamily
2UZ3A 1M8CA 3D00A 2NU2I 2PQ8A 1LR8A 2F3CI 4SGBI 1P9ZA 2UVOA 1PCEA 1TBNA 1Z2IA 3R5BA 2ORVA 4WP4A 2B8TA 2DIPA 2GKRI 4HGUA 1CT0I 1FYBA 1SGPI 2J9RA 2NU0I 1U5KA 1K7UA 2NU3I 1HPTA 1TGSI 2GKVA 1OMTA 9WGAA 5J8CA 1Y1BA 1HJAI 1HEVA 1BMOA 1PTRA 2ENNA 2KMOA 3TO7A 2QQDA 2P6AC 1SGEI 1WKXA 1UUCA 2X52A 4B6DA 3TO6A 1NXUA 3PDNA 7WGAA 1V1HA 5FUVA 1M8BA 2LB7A 1XBTA 1VDDA 3GOXA 1PTQA 2CJSC 1OMUA 1NUBA 3KY9A 1DS2I 2ENZA 2KMPA 1MJAA 1XA6A 2JYYA 1SGQI 2ROWA 4GI3C 5E3RA 1FAQA 3FSYA 2QPOA 2WCYA 1SGDI 1SGRI 1Y8FA 2OU2A 2SGFI 1N13A 2NU1I 3CXLA 3OL0A 1YU6C 3R5AA 2ELIA 2GIVA 5DAEA 2SGEI 1W3SA 4MPIA 3UGDA 3UGLA 2JXDA 3TJQA 2VRWB 2B0UC 3OXFA 1R79A 1UVGA 2OZUA 2KMRA 2W0TA 4UXHA 1TBOA 2FNFX 3TO9A 2J87A 2L8EA 1CHOI 2CWHA 4OVOA 4DNCA 2A20A 3B4VC 2ORWA 3R5DA 2Y0MA 3QAHA 2XRCA 1SGYI 2CWFA 1MJBA 1ULKA 5EX0A 1OVOA 2LEOA 2WVJA 5FUWA 3VDUA 5CCLA 1MT1A 1CGII 1WGCA 2JZMA 5HI7A 3SGQI 1H0ZA 2KMQA 2ARPF 2WGCA 1TBQR 3VDPA 4AMLA 1AN1I 2GVIA 1Z7KB 2JA1A 4A24A 2X3TA 1P9GA 2V53A 3HH2C 2SGPI 2RC4A 3MEKA 3VE5A 1CT4I 3FSXA 2GKTI 2ODDA 2ERWA 3QTLD 1KBFA 5FUYA 3OVOA 2NU4I 1MJ9A 2KCXA 1LR7A 5EX3A 1W4RA 2N1AB 1WGTA 1YTPA 1XX6A 5CCMA 1KBEA 2OVOA 5HQ8A 4JCVE 1ULNA 1TOTA 3UFFA 3FC3A 2BUSA 2LUYA 2M5XA 4L9MA 2SGQI 2QQCA 1Y1CA 1TBRR 2V1CC 5E3QA 1S20A 1IW4A 4UXIA 3UEYA 1BUSA 3UOEA 1PJUA 1SGNI 1CGJI 2E73A 1FARA 2YUUA 1TIHA 3SEKC 3QWPA 2E5RA 1RFHA 3RU0A 1CT2I 1X4SA 5FUXA 1IY6A 5J8FA 1K7TA 3UGIA 2DB6A 1IY5A 2N17A 2N52A 4E1PA 2RIJA 2K9HA 2N71A 1WTJA 5E3PA 2DKVA 2JW6A 3SGBI 3E2IA 1DS3I 1UVFA 3OXLA 1K7VA 2OD1A 1PPFI 3TOAA 1R0RI 4E1RA 2QQEA 1LR9A 1TUSA 1KMAA 2V1CA 4UXJA 3E59A 5JHWC 1HDLA 1CE3A 3OXGA 1TURA 1CSOI 1V1IA 1OYVI 1X74A 2YQPA 4FKDA 3TOBA 3UEJA 2CWGA 1Q9BA 2SGDI 3BJIA 1FY7A 2L7XA 3R5CA 1ULMA 2QQ0A 1UHAA
chains in the Genus database with same CATH topology
2UZ3A 1M8CA 3D00A 2NU2I 1LR8A 2F3CI 4SGBI 1PCEA 1TBNA 2ORVA 2B8TA 2DIPA 2GKRI 4HGUA 1CT0I 1FYBA 1SGPI 2J9RA 2NU0I 1U5KA 2NU3I 1HPTA 1TGSI 2GKVA 1OMTA 1Y1BA 1HJAI 1BMOA 1PTRA 2ENNA 2KMOA 2QQDA 2P6AC 1SGEI 1UUCA 4B6DA 3PDNA 1V1HA 5FUVA 1M8BA 1XBTA 1VDDA 3GOXA 1PTQA 2CJSC 1OMUA 1NUBA 3KY9A 1DS2I 2ENZA 2KMPA 1XA6A 2JYYA 2ROWA 1SGQI 4GI3C 1FAQA 2QPOA 2WCYA 1SGDI 1SGRI 1Y8FA 2SGFI 1N13A 2NU1I 3CXLA 3OL0A 1YU6C 2ELIA 5DAEA 2SGEI 1W3SA 3UGDA 3UGLA 2JXDA 3TJQA 2VRWB 2B0UC 3OXFA 1R79A 1UVGA 2KMRA 2W0TA 4UXHA 1TBOA 2FNFX 2J87A 2L8EA 1CHOI 4OVOA 2A20A 3B4VC 2ORWA 2XRCA 1SGYI 5EX0A 1OVOA 2LEOA 2WVJA 5FUWA 3VDUA 5CCLA 1MT1A 1CGII 2JZMA 5HI7A 3SGQI 1H0ZA 2KMQA 2ARPF 1TBQR 3VDPA 1AN1I 2GVIA 1Z7KB 2JA1A 4A24A 2V53A 3HH2C 2SGPI 3MEKA 3VE5A 1CT4I 2GKTI 2ODDA 2ERWA 3QTLD 1KBFA 5FUYA 3OVOA 2NU4I 2KCXA 1LR7A 5EX3A 1W4RA 2N1AB 1YTPA 1XX6A 5CCMA 1KBEA 2OVOA 5HQ8A 4JCVE 1TOTA 3UFFA 3FC3A 2BUSA 2LUYA 2M5XA 4L9MA 2SGQI 2QQCA 1Y1CA 1TBRR 2V1CC 1IW4A 4UXIA 3UEYA 1BUSA 1PJUA 1SGNI 1CGJI 2E73A 1FARA 2YUUA 1TIHA 3SEKC 3QWPA 2E5RA 1RFHA 3RU0A 1CT2I 1X4SA 5FUXA 1IY6A 3UGIA 2DB6A 1IY5A 2N17A 2N52A 4E1PA 2K9HA 2N71A 3SGBI 2JW6A 3E2IA 1DS3I 1UVFA 3OXLA 2OD1A 1PPFI 1R0RI 4E1RA 2QQEA 1LR9A 1TUSA 1KMAA 2V1CA 4UXJA 3E59A 5JHWC 1HDLA 1CE3A 3OXGA 1TURA 1CSOI 1V1IA 1OYVI 1X74A 2YQPA 4FKDA 3UEJA 2SGDI 3BJIA 2L7XA 2QQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8C A;  2NU2 I;  1LR8 A;  2F3C I;  4SGB I;  1PCE A;  2GKR I;  4HGU A;  1CT0 I;  1FYB A;  1SGP I;  2NU0 I;  2NU3 I;  1HPT A;  1TGS I;  2GKV A;  1OMT A;  1Y1B A;  1HJA I;  1BMO A;  2KMO A;  2QQD A;  2P6A C;  1SGE I;  1UUC A;  1M8B A;  1OMU A;  1NUB A;  1DS2 I;  2KMP A;  4GI3 C;  2JYY A;  1SGQ I;  2WCY A;  1SGD I;  1SGR I;  2SGF I;  1N13 A;  2NU1 I;  1YU6 C;  5DAE A;  2SGE I;  2JXD A;  3TJQ A;  2B0U C;  1UVG A;  2KMR A;  4OVO A;  1CHO I;  3B4V C;  2XRC A;  1SGY I;  1OVO A;  2LEO A;  1MT1 A;  1CGI I;  2JZM A;  3SGQ I;  1H0Z A;  2KMQ A;  2ARP F;  1TBQ R;  1AN1 I;  1Z7K B;  2V53 A;  3HH2 C;  2SGP I;  1CT4 I;  2GKT I;  3QTL D;  2ERW A;  3OVO A;  2NU4 I;  2KCX A;  1LR7 A;  1YTP A;  2OVO A;  2BUS A;  2M5X A;  2SGQ I;  2QQC A;  1Y1C A;  1TBR R;  1IW4 A;  1BUS A;  1PJU A;  1SGN I;  1CGJ I;  1TIH A;  3SEK C;  1CT2 I;  1IY6 A;  1IY5 A;  2N17 A;  2N52 A;  2N71 A;  3SGB I;  1DS3 I;  1UVF A;  1PPF I;  1R0R I;  1LR9 A;  1TUS A;  1KMA A;  5JHW C;  1HDL A;  1CE3 A;  1TUR A;  1CSO I;  1OYV I;  2SGD I; 
#chains in the Genus database with same CATH topology
 2UZ3 A;  1M8C A;  3D00 A;  2NU2 I;  2PQ8 A;  1LR8 A;  2F3C I;  4SGB I;  1P9Z A;  2UVO A;  1PCE A;  1TBN A;  1Z2I A;  3R5B A;  2ORV A;  4WP4 A;  2B8T A;  2DIP A;  2GKR I;  4HGU A;  1CT0 I;  1FYB A;  1SGP I;  2J9R A;  2NU0 I;  1U5K A;  1K7U A;  2NU3 I;  1HPT A;  1TGS I;  2GKV A;  1OMT A;  9WGA A;  5J8C A;  1Y1B A;  1HJA I;  1HEV A;  1BMO A;  1PTR A;  2ENN A;  2KMO A;  3TO7 A;  2QQD A;  2P6A C;  1SGE I;  1WKX A;  1UUC A;  2X52 A;  4B6D A;  3TO6 A;  1NXU A;  3PDN A;  7WGA A;  1V1H A;  5FUV A;  1M8B A;  2LB7 A;  1XBT A;  1VDD A;  3GOX A;  1PTQ A;  2CJS C;  1OMU A;  1NUB A;  3KY9 A;  1DS2 I;  2ENZ A;  2KMP A;  1MJA A;  1XA6 A;  2JYY A;  1SGQ I;  2ROW A;  4GI3 C;  5E3R A;  1FAQ A;  3FSY A;  2QPO A;  2WCY A;  1SGD I;  1SGR I;  1Y8F A;  2OU2 A;  2SGF I;  1N13 A;  2NU1 I;  3CXL A;  3OL0 A;  1YU6 C;  3R5A A;  2ELI A;  2GIV A;  5DAE A;  2SGE I;  1W3S A;  4MPI A;  3UGD A;  3UGL A;  2JXD A;  3TJQ A;  2VRW B;  2B0U C;  3OXF A;  1R79 A;  1UVG A;  2OZU A;  2KMR A;  2W0T A;  4UXH A;  1TBO A;  2FNF X;  3TO9 A;  2J87 A;  2L8E A;  1CHO I;  2CWH A;  4OVO A;  4DNC A;  2A20 A;  3B4V C;  2ORW A;  3R5D A;  2Y0M A;  3QAH A;  2XRC A;  1SGY I;  2CWF A;  1MJB A;  1ULK A;  5EX0 A;  1OVO A;  2LEO A;  2WVJ A;  5FUW A;  3VDU A;  5CCL A;  1MT1 A;  1CGI I;  1WGC A;  2JZM A;  5HI7 A;  3SGQ I;  1H0Z A;  2KMQ A;  2ARP F;  2WGC A;  1TBQ R;  3VDP A;  4AML A;  1AN1 I;  2GVI A;  1Z7K B;  2JA1 A;  4A24 A;  2X3T A;  1P9G A;  2V53 A;  3HH2 C;  2SGP I;  2RC4 A;  3MEK A;  3VE5 A;  1CT4 I;  3FSX A;  2GKT I;  2ODD A;  2ERW A;  3QTL D;  1KBF A;  5FUY A;  3OVO A;  2NU4 I;  1MJ9 A;  2KCX A;  1LR7 A;  5EX3 A;  1W4R A;  2N1A B;  1WGT A;  1YTP A;  1XX6 A;  5CCM A;  1KBE A;  2OVO A;  5HQ8 A;  4JCV E;  1ULN A;  1TOT A;  3UFF A;  3FC3 A;  2BUS A;  2LUY A;  2M5X A;  4L9M A;  2SGQ I;  2QQC A;  1Y1C A;  1TBR R;  2V1C C;  5E3Q A;  1S20 A;  1IW4 A;  4UXI A;  3UEY A;  1BUS A;  3UOE A;  1PJU A;  1SGN I;  1CGJ I;  2E73 A;  1FAR A;  2YUU A;  1TIH A;  3SEK C;  3QWP A;  2E5R A;  1RFH A;  3RU0 A;  1CT2 I;  1X4S A;  5FUX A;  1IY6 A;  5J8F A;  1K7T A;  3UGI A;  2DB6 A;  1IY5 A;  2N17 A;  2N52 A;  4E1P A;  2RIJ A;  2K9H A;  2N71 A;  1WTJ A;  5E3P A;  2DKV A;  2JW6 A;  3SGB I;  3E2I A;  1DS3 I;  1UVF A;  3OXL A;  1K7V A;  2OD1 A;  1PPF I;  3TOA A;  1R0R I;  4E1R A;  2QQE A;  1LR9 A;  1TUS A;  1KMA A;  2V1C A;  4UXJ A;  3E59 A;  5JHW C;  1HDL A;  1CE3 A;  3OXG A;  1TUR A;  1CSO I;  1V1I A;  1OYV I;  1X74 A;  2YQP A;  4FKD A;  3TOB A;  3UEJ A;  2CWG A;  1Q9B A;  2SGD I;  3BJI A;  1FY7 A;  2L7X A;  3R5C A;  1ULM A;  2QQ0 A;  1UHA A; 
#chains in the Genus database with same CATH homology
 2UZ3 A;  1M8C A;  3D00 A;  2NU2 I;  1LR8 A;  2F3C I;  4SGB I;  1PCE A;  1TBN A;  2ORV A;  2B8T A;  2DIP A;  2GKR I;  4HGU A;  1CT0 I;  1FYB A;  1SGP I;  2J9R A;  2NU0 I;  1U5K A;  2NU3 I;  1HPT A;  1TGS I;  2GKV A;  1OMT A;  1Y1B A;  1HJA I;  1BMO A;  1PTR A;  2ENN A;  2KMO A;  2QQD A;  2P6A C;  1SGE I;  1UUC A;  4B6D A;  3PDN A;  1V1H A;  5FUV A;  1M8B A;  1XBT A;  1VDD A;  3GOX A;  1PTQ A;  2CJS C;  1OMU A;  1NUB A;  3KY9 A;  1DS2 I;  2ENZ A;  2KMP A;  1XA6 A;  2JYY A;  2ROW A;  1SGQ I;  4GI3 C;  1FAQ A;  2QPO A;  2WCY A;  1SGD I;  1SGR I;  1Y8F A;  2SGF I;  1N13 A;  2NU1 I;  3CXL A;  3OL0 A;  1YU6 C;  2ELI A;  5DAE A;  2SGE I;  1W3S A;  3UGD A;  3UGL A;  2JXD A;  3TJQ A;  2VRW B;  2B0U C;  3OXF A;  1R79 A;  1UVG A;  2KMR A;  2W0T A;  4UXH A;  1TBO A;  2FNF X;  2J87 A;  2L8E A;  1CHO I;  4OVO A;  2A20 A;  3B4V C;  2ORW A;  2XRC A;  1SGY I;  5EX0 A;  1OVO A;  2LEO A;  2WVJ A;  5FUW A;  3VDU A;  5CCL A;  1MT1 A;  1CGI I;  2JZM A;  5HI7 A;  3SGQ I;  1H0Z A;  2KMQ A;  2ARP F;  1TBQ R;  3VDP A;  1AN1 I;  2GVI A;  1Z7K B;  2JA1 A;  4A24 A;  2V53 A;  3HH2 C;  2SGP I;  3MEK A;  3VE5 A;  1CT4 I;  2GKT I;  2ODD A;  2ERW A;  3QTL D;  1KBF A;  5FUY A;  3OVO A;  2NU4 I;  2KCX A;  1LR7 A;  5EX3 A;  1W4R A;  2N1A B;  1YTP A;  1XX6 A;  5CCM A;  1KBE A;  2OVO A;  5HQ8 A;  4JCV E;  1TOT A;  3UFF A;  3FC3 A;  2BUS A;  2LUY A;  2M5X A;  4L9M A;  2SGQ I;  2QQC A;  1Y1C A;  1TBR R;  2V1C C;  1IW4 A;  4UXI A;  3UEY A;  1BUS A;  1PJU A;  1SGN I;  1CGJ I;  2E73 A;  1FAR A;  2YUU A;  1TIH A;  3SEK C;  3QWP A;  2E5R A;  1RFH A;  3RU0 A;  1CT2 I;  1X4S A;  5FUX A;  1IY6 A;  3UGI A;  2DB6 A;  1IY5 A;  2N17 A;  2N52 A;  4E1P A;  2K9H A;  2N71 A;  3SGB I;  2JW6 A;  3E2I A;  1DS3 I;  1UVF A;  3OXL A;  2OD1 A;  1PPF I;  1R0R I;  4E1R A;  2QQE A;  1LR9 A;  1TUS A;  1KMA A;  2V1C A;  4UXJ A;  3E59 A;  5JHW C;  1HDL A;  1CE3 A;  3OXG A;  1TUR A;  1CSO I;  1V1I A;  1OYV I;  1X74 A;  2YQP A;  4FKD A;  3UEJ A;  2SGD I;  3BJI A;  2L7X A;  2QQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...