3UGLA

Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GSRRASVGSHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proteine kinase C delta type
publication title Structural and Functional Characterization of an Anesthetic Binding Site in the Second Cysteine-Rich Domain of Protein Kinase Cdelta
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 11
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3uglA01
2DB6A 5FUXA 4UXHA 2YUUA 1R79A 2ORWA 3BJIA 3UGLA 1KBFA 1W4RA 2ENNA 3KY9A 2QQ0A 1TBNA 1RFHA 1XA6A 2QQEA 4UXIA 3UGDA 1TBOA 3CXLA 5FUYA 2E73A 2ORVA 4FKDA 2B8TA 5FUVA 3UFFA 1FAQA 2JA1A 4B6DA 1XX6A 4L9MA 2UZ3A 1Y8FA 2ELIA 3E2IA 2GVIA 2ROWA 5FUWA 2J9RA 2QPOA 2ENZA 2WVJA 1PTQA 2VRWB 3UEYA 1FARA 1PTRA 1KBEA 2FNFX 3UGIA 2J87A 4UXJA 1XBTA 3UEJA
chains in the Genus database with same CATH superfamily
4E1PA 1YU6C 2NU1I 2WGCA 2NU3I 2RC4A 3R5AA 2QQ0A 3MEKA 1PJUA 3CXLA 3VDPA 9WGAA 4FKDA 2B8TA 1Y1CA 1N13A 1V1IA 2LB7A 2B0UC 2NU0I 2W0TA 1W3SA 3FSXA 1UUCA 2CWFA 2XRCA 2N17A 3UGLA 1ULKA 1OYVI 2A20A 3SGQI 3QTLD 2ELIA 1NXUA 1OMUA 1M8BA 3E2IA 2KMQA 5CCMA 2DIPA 2M5XA 2Y0MA 2JYYA 2J9RA 1FY7A 2ENZA 2OVOA 1CGII 1M8CA 1PCEA 2VRWB 1CHOI 2X52A 1SGYI 1ULNA 4JCVE 3OXFA 4GI3C 4MPIA 5DAEA 3TOBA 3UEYA 2QQDA 1HJAI 1TIHA 2JXDA 3D00A 1LR9A 1SGQI 1XBTA 2L8EA 3PDNA 1MJBA 1TOTA 1UVFA 3R5DA 2CWGA 2UVOA 2YQPA 1R79A 2ORWA 3GOXA 2SGEI 1WGCA 1K7UA 1RFHA 2V1CC 1TBQR 3VDUA 4HGUA 3R5BA 3SEKC 1P9ZA 1V1HA 1S20A 1CE3A 1WKXA 2NU2I 3TOAA 3B4VC 1PPFI 2UZ3A 5E3PA 1TGSI 4DNCA 3TO7A 2GVIA 2ROWA 4OVOA 3OL0A 1VDDA 5HQ8A 1MJ9A 1DS3I 1SGDI 4WP4A 1PTRA 2CWHA 2BUSA 4A24A 3HH2C 3UGIA 5CCLA 1MJAA 2SGQI 1OMTA 3FC3A 1KMAA 2DB6A 5FUXA 1K7VA 5E3RA 1MT1A 7WGAA 3TO9A 1KBFA 2ENNA 2OU2A 3KY9A 3UOEA 1CGJI 1XA6A 2F3CI 2PQ8A 3FSYA 1TBOA 3SGBI 2ARPF 4SGBI 2NU4I 2QQCA 2E73A 5EX3A 2KMPA 2ORVA 4AMLA 1K7TA 2V1CA 4E1RA 5E3QA 1TBRR 2OD1A 1NUBA 1WTJA 2KMOA 2RIJA 2OZUA 5FUVA 3UFFA 4B6DA 1HPTA 2K9HA 5JHWC 1Y1BA 2GKTI 1AN1I 2GKVA 1CT4I 1LR7A 2KCXA 3TO6A 2P6AC 1X4SA 2CJSC 5J8FA 2QPOA 1BMOA 2JW6A 2WVJA 3TJQA 1YTPA 3OXLA 2GIVA 2L7XA 3R5CA 1FYBA 1IY6A 2J87A 1CSOI 1SGEI 2V53A 4UXJA 2JZMA 3RU0A 3OVOA 3UEJA 1IY5A 2ERWA 2SGDI 3OXGA 4UXHA 2YUUA 2X3TA 2GKRI 1P9GA 1X74A 1U5KA 1W4RA 1WGTA 1Z2IA 2LUYA 2WCYA 3BJIA 1TBNA 4UXIA 1IW4A 2QQEA 3UGDA 1CT2I 2SGPI 2KMRA 1DS2I 5FUYA 1SGPI 2SGFI 1TUSA 1SGRI 2N1AB 1FAQA 1UVGA 2JA1A 1SGNI 1Z7KB 1R0RI 1XX6A 1Q9BA 1CT0I 1UHAA 2DKVA 4L9MA 1TURA 2N52A 5HI7A 2LEOA 1Y8FA 3VE5A 5FUWA 3QAHA 1OVOA 3QWPA 1H0ZA 1PTQA 1ULMA 5J8CA 1HDLA 1FARA 2E5RA 1KBEA 1LR8A 2FNFX 2N71A 5EX0A 1BUSA 1HEVA 2ODDA 3E59A
chains in the Genus database with same CATH topology
4E1PA 1YU6C 2NU1I 2NU3I 2QQ0A 1PJUA 3CXLA 3VDPA 4FKDA 2B8TA 1Y1CA 1N13A 1V1IA 2B0UC 2NU0I 2W0TA 1W3SA 1UUCA 2XRCA 2N17A 1OYVI 2A20A 3SGQI 3QTLD 2ELIA 1OMUA 1M8BA 3E2IA 2KMQA 5CCMA 2DIPA 2M5XA 2JYYA 2J9RA 2ENZA 2OVOA 1CGII 1M8CA 1PCEA 2VRWB 1CHOI 3UEYA 1SGYI 4JCVE 3OXFA 4GI3C 5DAEA 2QQDA 1HJAI 1TIHA 2JXDA 3D00A 1LR9A 1XBTA 1SGQI 2L8EA 3PDNA 1TOTA 1UVFA 2YQPA 1R79A 2ORWA 3GOXA 2SGEI 1RFHA 2V1CC 1TBQR 3VDUA 4HGUA 3SEKC 1V1HA 1CE3A 2NU2I 3B4VC 1PPFI 2UZ3A 1TGSI 2GVIA 2ROWA 4OVOA 3OL0A 1VDDA 5HQ8A 1DS3I 1SGDI 1PTRA 4A24A 2BUSA 3HH2C 3UGIA 5CCLA 2SGQI 1OMTA 3FC3A 1KMAA 2DB6A 5FUXA 1MT1A 1KBFA 2ENNA 3KY9A 1CGJI 1XA6A 2F3CI 3SGBI 1TBOA 2ARPF 4SGBI 2NU4I 2QQCA 2E73A 5EX3A 2KMPA 2ORVA 2V1CA 4E1RA 5FUVA 1TBRR 2OD1A 1NUBA 2KMOA 3UFFA 4B6DA 1HPTA 2K9HA 5JHWC 1Y1BA 2GKTI 1AN1I 2GKVA 1CT4I 1LR7A 2KCXA 2P6AC 1X4SA 2CJSC 2QPOA 1BMOA 2JW6A 2WVJA 3TJQA 1YTPA 3OXLA 2L7XA 1FYBA 1IY6A 2J87A 1CSOI 1SGEI 2V53A 4UXJA 2JZMA 3RU0A 3OVOA 3UEJA 1IY5A 2ERWA 2SGDI 3OXGA 4UXHA 2YUUA 3MEKA 2GKRI 1X74A 2LUYA 1U5KA 1W4RA 3BJIA 2WCYA 3UGLA 4UXIA 1TBNA 1IW4A 2QQEA 3UGDA 1CT2I 2SGPI 2KMRA 1DS2I 5FUYA 1SGPI 2SGFI 1TUSA 1SGRI 2N1AB 1FAQA 1UVGA 2JA1A 1SGNI 1Z7KB 1R0RI 1XX6A 1CT0I 4L9MA 5HI7A 1TURA 2N52A 2LEOA 1Y8FA 3VE5A 5FUWA 1OVOA 3QWPA 1H0ZA 1PTQA 1HDLA 1FARA 2E5RA 1KBEA 1LR8A 2FNFX 2N71A 5EX0A 1BUSA 2ODDA 3E59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DB6 A;  5FUX A;  4UXH A;  2YUU A;  1R79 A;  2ORW A;  3BJI A;  3UGL A;  1KBF A;  1W4R A;  2ENN A;  3KY9 A;  2QQ0 A;  1TBN A;  1RFH A;  1XA6 A;  2QQE A;  4UXI A;  3UGD A;  1TBO A;  3CXL A;  5FUY A;  2E73 A;  2ORV A;  4FKD A;  2B8T A;  5FUV A;  3UFF A;  1FAQ A;  2JA1 A;  4B6D A;  1XX6 A;  4L9M A;  2UZ3 A;  1Y8F A;  2ELI A;  3E2I A;  2GVI A;  2ROW A;  5FUW A;  2J9R A;  2QPO A;  2ENZ A;  2WVJ A;  1PTQ A;  2VRW B;  3UEY A;  1FAR A;  1PTR A;  1KBE A;  2FNF X;  3UGI A;  2J87 A;  4UXJ A;  1XBT A;  3UEJ A; 
#chains in the Genus database with same CATH topology
 4E1P A;  1YU6 C;  2NU1 I;  2WGC A;  2NU3 I;  2RC4 A;  3R5A A;  2QQ0 A;  3MEK A;  1PJU A;  3CXL A;  3VDP A;  9WGA A;  4FKD A;  2B8T A;  1Y1C A;  1N13 A;  1V1I A;  2LB7 A;  2B0U C;  2NU0 I;  2W0T A;  1W3S A;  3FSX A;  1UUC A;  2CWF A;  2XRC A;  2N17 A;  3UGL A;  1ULK A;  1OYV I;  2A20 A;  3SGQ I;  3QTL D;  2ELI A;  1NXU A;  1OMU A;  1M8B A;  3E2I A;  2KMQ A;  5CCM A;  2DIP A;  2M5X A;  2Y0M A;  2JYY A;  2J9R A;  1FY7 A;  2ENZ A;  2OVO A;  1CGI I;  1M8C A;  1PCE A;  2VRW B;  1CHO I;  2X52 A;  1SGY I;  1ULN A;  4JCV E;  3OXF A;  4GI3 C;  4MPI A;  5DAE A;  3TOB A;  3UEY A;  2QQD A;  1HJA I;  1TIH A;  2JXD A;  3D00 A;  1LR9 A;  1SGQ I;  1XBT A;  2L8E A;  3PDN A;  1MJB A;  1TOT A;  1UVF A;  3R5D A;  2CWG A;  2UVO A;  2YQP A;  1R79 A;  2ORW A;  3GOX A;  2SGE I;  1WGC A;  1K7U A;  1RFH A;  2V1C C;  1TBQ R;  3VDU A;  4HGU A;  3R5B A;  3SEK C;  1P9Z A;  1V1H A;  1S20 A;  1CE3 A;  1WKX A;  2NU2 I;  3TOA A;  3B4V C;  1PPF I;  2UZ3 A;  5E3P A;  1TGS I;  4DNC A;  3TO7 A;  2GVI A;  2ROW A;  4OVO A;  3OL0 A;  1VDD A;  5HQ8 A;  1MJ9 A;  1DS3 I;  1SGD I;  4WP4 A;  1PTR A;  2CWH A;  2BUS A;  4A24 A;  3HH2 C;  3UGI A;  5CCL A;  1MJA A;  2SGQ I;  1OMT A;  3FC3 A;  1KMA A;  2DB6 A;  5FUX A;  1K7V A;  5E3R A;  1MT1 A;  7WGA A;  3TO9 A;  1KBF A;  2ENN A;  2OU2 A;  3KY9 A;  3UOE A;  1CGJ I;  1XA6 A;  2F3C I;  2PQ8 A;  3FSY A;  1TBO A;  3SGB I;  2ARP F;  4SGB I;  2NU4 I;  2QQC A;  2E73 A;  5EX3 A;  2KMP A;  2ORV A;  4AML A;  1K7T A;  2V1C A;  4E1R A;  5E3Q A;  1TBR R;  2OD1 A;  1NUB A;  1WTJ A;  2KMO A;  2RIJ A;  2OZU A;  5FUV A;  3UFF A;  4B6D A;  1HPT A;  2K9H A;  5JHW C;  1Y1B A;  2GKT I;  1AN1 I;  2GKV A;  1CT4 I;  1LR7 A;  2KCX A;  3TO6 A;  2P6A C;  1X4S A;  2CJS C;  5J8F A;  2QPO A;  1BMO A;  2JW6 A;  2WVJ A;  3TJQ A;  1YTP A;  3OXL A;  2GIV A;  2L7X A;  3R5C A;  1FYB A;  1IY6 A;  2J87 A;  1CSO I;  1SGE I;  2V53 A;  4UXJ A;  2JZM A;  3RU0 A;  3OVO A;  3UEJ A;  1IY5 A;  2ERW A;  2SGD I;  3OXG A;  4UXH A;  2YUU A;  2X3T A;  2GKR I;  1P9G A;  1X74 A;  1U5K A;  1W4R A;  1WGT A;  1Z2I A;  2LUY A;  2WCY A;  3BJI A;  1TBN A;  4UXI A;  1IW4 A;  2QQE A;  3UGD A;  1CT2 I;  2SGP I;  2KMR A;  1DS2 I;  5FUY A;  1SGP I;  2SGF I;  1TUS A;  1SGR I;  2N1A B;  1FAQ A;  1UVG A;  2JA1 A;  1SGN I;  1Z7K B;  1R0R I;  1XX6 A;  1Q9B A;  1CT0 I;  1UHA A;  2DKV A;  4L9M A;  1TUR A;  2N52 A;  5HI7 A;  2LEO A;  1Y8F A;  3VE5 A;  5FUW A;  3QAH A;  1OVO A;  3QWP A;  1H0Z A;  1PTQ A;  1ULM A;  5J8C A;  1HDL A;  1FAR A;  2E5R A;  1KBE A;  1LR8 A;  2FNF X;  2N71 A;  5EX0 A;  1BUS A;  1HEV A;  2ODD A;  3E59 A; 
#chains in the Genus database with same CATH homology
 4E1P A;  1YU6 C;  2NU1 I;  2NU3 I;  2QQ0 A;  1PJU A;  3CXL A;  3VDP A;  4FKD A;  2B8T A;  1Y1C A;  1N13 A;  1V1I A;  2B0U C;  2NU0 I;  2W0T A;  1W3S A;  1UUC A;  2XRC A;  2N17 A;  1OYV I;  2A20 A;  3SGQ I;  3QTL D;  2ELI A;  1OMU A;  1M8B A;  3E2I A;  2KMQ A;  5CCM A;  2DIP A;  2M5X A;  2JYY A;  2J9R A;  2ENZ A;  2OVO A;  1CGI I;  1M8C A;  1PCE A;  2VRW B;  1CHO I;  3UEY A;  1SGY I;  4JCV E;  3OXF A;  4GI3 C;  5DAE A;  2QQD A;  1HJA I;  1TIH A;  2JXD A;  3D00 A;  1LR9 A;  1XBT A;  1SGQ I;  2L8E A;  3PDN A;  1TOT A;  1UVF A;  2YQP A;  1R79 A;  2ORW A;  3GOX A;  2SGE I;  1RFH A;  2V1C C;  1TBQ R;  3VDU A;  4HGU A;  3SEK C;  1V1H A;  1CE3 A;  2NU2 I;  3B4V C;  1PPF I;  2UZ3 A;  1TGS I;  2GVI A;  2ROW A;  4OVO A;  3OL0 A;  1VDD A;  5HQ8 A;  1DS3 I;  1SGD I;  1PTR A;  4A24 A;  2BUS A;  3HH2 C;  3UGI A;  5CCL A;  2SGQ I;  1OMT A;  3FC3 A;  1KMA A;  2DB6 A;  5FUX A;  1MT1 A;  1KBF A;  2ENN A;  3KY9 A;  1CGJ I;  1XA6 A;  2F3C I;  3SGB I;  1TBO A;  2ARP F;  4SGB I;  2NU4 I;  2QQC A;  2E73 A;  5EX3 A;  2KMP A;  2ORV A;  2V1C A;  4E1R A;  5FUV A;  1TBR R;  2OD1 A;  1NUB A;  2KMO A;  3UFF A;  4B6D A;  1HPT A;  2K9H A;  5JHW C;  1Y1B A;  2GKT I;  1AN1 I;  2GKV A;  1CT4 I;  1LR7 A;  2KCX A;  2P6A C;  1X4S A;  2CJS C;  2QPO A;  1BMO A;  2JW6 A;  2WVJ A;  3TJQ A;  1YTP A;  3OXL A;  2L7X A;  1FYB A;  1IY6 A;  2J87 A;  1CSO I;  1SGE I;  2V53 A;  4UXJ A;  2JZM A;  3RU0 A;  3OVO A;  3UEJ A;  1IY5 A;  2ERW A;  2SGD I;  3OXG A;  4UXH A;  2YUU A;  3MEK A;  2GKR I;  1X74 A;  2LUY A;  1U5K A;  1W4R A;  3BJI A;  2WCY A;  3UGL A;  4UXI A;  1TBN A;  1IW4 A;  2QQE A;  3UGD A;  1CT2 I;  2SGP I;  2KMR A;  1DS2 I;  5FUY A;  1SGP I;  2SGF I;  1TUS A;  1SGR I;  2N1A B;  1FAQ A;  1UVG A;  2JA1 A;  1SGN I;  1Z7K B;  1R0R I;  1XX6 A;  1CT0 I;  4L9M A;  5HI7 A;  1TUR A;  2N52 A;  2LEO A;  1Y8F A;  3VE5 A;  5FUW A;  1OVO A;  3QWP A;  1H0Z A;  1PTQ A;  1HDL A;  1FAR A;  2E5R A;  1KBE A;  1LR8 A;  2FNF X;  2N71 A;  5EX0 A;  1BUS A;  2ODD A;  3E59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...