2OZUA

Crystal structure of human myst histone acetyltransferase 3 in complex with acetylcoenzyme a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
253
Chain Sequence
RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQSIKKLSKLTGICPQDITSTLHHLRMLIRREKLIQDHMAKLQLRPVDVDPECLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase MYST3
total genus 78
structure length 253
sequence length 270
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ozuA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2ozuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ozuA02
3KLNA 3REOA 3VFZA 4M9SA 5ISVA 4GYIA 2XHKA 1RZ4A 2DK8A 3SHFA 2FBIA 2O03A 2XAHA 1CF7A 3I5UA 1FSHA 5AIQA 4P5OA 2ZXVA 1MJAA 1FOKA 3WTWC 4UVBA 2IVMA 5E1WA 3TCVA 4KDPA 3S6GA 4HX7A 5CVUA 3DP7A 1W5SA 4LX9A 1TBXA 4LFUA 3ZMSA 4I7HA 4LMYA 4U9YA 3IRQA 2EV6A 3QPTA 2P7VB 3EYYA 3T9YA 4CAXA 2NMTA 3C7JA 2DQLA 2P4WA 3GF2A 1RUOA 2JDCA 2HR3A 2LF8A 2A3SA 4HQEA 3WTZA 4R3KA 4JK1X 2HDCA 1BI3A 3BLNA 1X3UA 2HQRA 1UFMA 1DDNA 2H09A 1FC3A 3JSPA 1QSOA 1PP8F 4NXYA 4AB7A 3EO4A 3R9GA 1IN5A 4G8XA 1BIAA 2PG4A 3KFWX 2CGPA 4YFXF 3GLXA 3HSFA 2CG4A 5ILSA 3FWEA 1T2KA 4A5MA 4BNCA 3FM5A 3EC4A 5CYVA 3DSBA 4RAYA 4KLVA 3WTTC 1IYLA 3SXYA 4YIFA 3WR7A 2JSCA 4A0YA 3WTYC 2EFWA 4A2UA 2LNBA 4UHTA 4M73A 1R22A 4U5YA 1N71A 2B58A 1C0WA 1WWZA 2FNAA 3O3KA 5LHGA 4H6UA 3VWEA 3TQNA 2ZJ2A 5ICGA 3L09A 5H84A 5TRDA 2ETHA 3TDZC 1SMYF 4LLGF 5IB0A 3PP9A 1YVKA 2XASA 1ON2A 2EWNA 2KIUA 5FGMA 3CUQB 2STTA 1U3EM 3K9UA 1IW7F 2B3VA 3R0AA 1XE4A 1XB4A 4UVCA 1B4AA 3DFGA 5D4SA 1LNWA 3ZP5A 3FMRA 5IX3A 3FMSA 1H9TA 3V8KA 4N0BA 4LB5A 4KVXA 1ZGAA 4O6JA 3RYOA 4NSQA 1LB2A 4UXNA 3P9IA 2GANA 2REFA 2DT5A 4E2AA 1J7KA 3T8TA 3P7NA 4OMZA 1CF7B 2FBHA 3EQLF 2VQYA 2WC2A 4ORFA 4Q5SF 2P6EA 4Y49B 4CXFA 3K1NA 5FD6A 3RIRA 1U8RA 3K2ZA 2HV2A 2V79A 5DWMA 1BM9A 1SFEA 4IF4A 2DTRA 4NHJA 3HRSA 4F6AA 1UB9A 2HKOA 2R7HA 1IYKA 1YX0A 1XGOA 1AWCA 3LWFA 3F72A 5AONA 2COMA 1R7JA 2IA2A 3HYIA 4FD6A 4HF1A 1REPC 3T1BA 2FIWA 1LRZA 1FYKA 4PGGA 4CAVA 2EFOA 3HRMA 5H6RA 2ZMEA 3BJOA 1HKSA 3CUQC 4Z2YA 3FXQA 2W24A 2VBWA 2B3UA 2CW0F 3TFYA 2ARHA 4LLLA 1J9IA 3ZMZA 3GZ5A 1R00A 1FYLA 2BYVE 2JTVA 4LD5A 1S3ZA 2VC1A 4FX0A 2ZCWA 2UWMA 1YVOA 1ZN2A 4M3SA 1SMTA 2Z99A 4XPKA 1ZRCA 2VBQA 2PLYA 3WGHA 4AG9A 4ENJA 3RI4A 3T5XA 5FLXZ 2P6FA 3QOPA 2FSRA 1HSJA 5ICEA 1VKCA 3S6KA 4O3MA 5LGTA 3F8KA 5HLIA 3TO7A 3R95A 4KORA 4R79A 2FA5A 3MFKA 2Y48A 2E1NA 5IT9K 5E8GA 2KJCA 3EDPA 4L9VA 3IRRA 2K4JA 1S7OA 4D0PA 2O8XA 1P4XA 3K0LA 4ZZLA 2NAZA 2P6GA 1SD5A 2QQBA 3CXPA 2D4OA 3FF5A 4N9IA 1QPMA 2DAOA 3B73A 3WGGA 3HSEA 5HDGA 5HH1A 2HYFA 2Q0YA 3SZPA 5BS6A 2AE6A 2RDPA 2NRAC 4U7DA 3KEQA 1MDMB 3T0YA 4HV5A 4WWCA 2A6HF 3MZHA 1J4JA 1Z7UA 4K2EA 2D4PA 2L3DA 4H0EA 2X4HA 1U5TC 3KZZA 2QM3A 3WU1B 5E1ZB 1HW5A 2IJLA 4WXCA 3SXNA 1W7PB 2ZPAA 1YFHA 4Y15A 3R61A 4JXRA 1SD4A 2QIRA 1Z91A 4YIIA 2EUIA 2ESHA 1Q2CA 4MNUA 5BPIA 1Y0UA 2J8NA 3DPLC 2IT0A 2P7CB 4IHTA 5D5XB 1AOYA 4M9ZA 4G7HF 3FX3A 5L3DA 2B4DB 4MEXF 3BJ8A 4H6ZA 3QPHA 1NSLA 2CWEA 1ON0A 1BN5A 2ZXJA 4PCQA 4KLWA 4RI1A 5DUKA 2PC1A 1Z6RA 2CFXA 3HTUA 1KYWA 2QWWA 2IA0A 1IN8A 2FU4A 5LLQA 3I0TA 4MY3A 2A5YB 1WRJA 3W6JB 1E17A 1O7LA 3BJ6A 1R1VA 3I64A 2HFHA 4MQVA 2ISYA 5KK1A 1J0RA 1ZARA 2YX7A 3K1MA 1SD7A 2LDUA 3HOTA 1BOBA 2XKPA 1KQ8A 1O57A 5E1XA 3IHUA 2G3TA 5HMNA 2R3SA 4YG2F 4MBUA 3HOSA 1HSTA 2VEZA 4XLPF 5JVTA 1F5TA 3JW4A 1FLIA 2YX4A 4E8OA 4RB1A 4GGGA 1MK4A 4A0ZA 2BBYA 1Z9UA 3B02A 4M6YA 2P8TA 2HGCA 2LF7A 3NQOA 1JE8A 4PSXA 4U0YA 1IN4A 5DCFA 1MJ9A 1XGNA 1KU9A 2VT2A 2ZW7A 4L9NA 2W57A 1WKMA 4EJVA 4JBAA 4CRYB 2Q4VA 2BL1A 2BEOA 1D8JA 2M45A 4A0XA 2LKPA 1TNSA 4TV7A 4CDGA 4ZBGA 2E1CA 2PN6A 1U6MA 2OD5A 4BHPA 3C3WA 1Y7RA 4IHSA 3RYPA 3M7GA 4U88A 5EC4A 4HBLA 2F5DA 2ACJA 3LD2A 4E70A 2Q0OA 4I0BA 1GXPA 3V7CA 5ICCA 3LQRA 2R7DA 1OYYA 3J81Z 4I49A 3TT2A 1O3TA 5FD5A 1FP2A 4KFCA 2EB7A 4B8XA 3EFAA 2UXXA 3RKYA 2PR8A 3ECHA 4XNHC 4B5PB 2A07F 5KTAA 2ZKZA 2QBYB 1K4JA 3EY5A 3P2FA 1P4WA 2F2EA 4G9YA 4FD5A 3IKVA 3B8GA 4A6EA 3F6OA 4AVAA 4EM2A 4B5OA 1YG2A 2KJBA 1EV7A 3ULQB 2RC4A 1XN7A 5F1RA 5C88A 4EQQA 2KIFA 3RYRA 2ZBKA 3J80K 5F49A 1ZG3A 2CO5A 1XIXA 1G3WA 2HEOA 2J8RA 1EH8A 3BZ6A 2C27A 2E7WA 2XGXA 4B5PA 1XEBA 2ZW5A 5DYMA 2GQQA 1P2FA 2Z3YA 3E5QA 3GY9A 1XSVA 1YLEA 4WX9A 1D8KA 3H4QA 5BOXA 4KIBA 3JAMK 4OU0A 5F46A 4DQ2A 3GX4X 3BWGA 1K6OA 2WPXA 1U2WA 3R4KA 3IC7A 3RPQA 4P9FA 5A2QZ 1GHEA 1FBQA 2A6EF 3JAMZ 4KA4A 4UBRA 1KU7A 1RNLA 4FD7A 2R8VA 1MZBA 4JXQA 3JVNA 1FX7A 3DPTA 2WPWA 4K30A 2HZTA 4OAEA 2PBIA 4R1HA 2PDOA 4EJTA 1LEBA 1LJ9A 4U9ZA 2RV8A 3Q9SA 1QO0D 4EJWA 4Q4ZF 1YTYA 1W5TA 2OZUA 2BEIA 2V1UA 1T38A 3CO7C 1BIBA 4BAYA 1F4KA 2PSWA 4ESJA 1G4DA 4IXAA 4RGSA 2VE9A 4CICA 2FQ3A 2Z5UA 3L2CA 4XBFA 1HKQA 2VZZA 3OV8A 2P5VA 4LG0B 1YIOA 3DR6A 2M87A 1I1DA 3NRVA 2Z0ZA 1S3JA 1W7PA 3GXOA 4QC6A 4I02A 2K4BA 4IF5A 1S6LA 1TIQA 5F64A 3NEUA 4KMFA 1JHFA 4B09A 2OZGA 2HUZA 2W85A 3RTRA 3KP6A 4RGXA 1OYWA 3NE7A 2Z11A 2Q8KA 1S60A 1Q1HA 3V8JA 4KYWA 1I1SA 3F0AA 3MEXA 1YS7A 1YW8A 3F8MA 1MD0A 3ZQ7A 3C26A 3F22A 4LB6B 2QECA 3HHGA 4HOBA 1IB1E 1NHAA 5TJJA 2ZO4A 2XVCA 2E7XA 1FZPB 4IUSA 1WI9A 3J80Z 4HNWB 1HKTA 4L18B 2XIGA 4G94A 1XCVA 2M5WA 2NYXA 4EGYA 1IXRC 1OMIA 4P9UA 1BBYA 4LK0F 5FFZA 4RB3C 5E20A 3UY5A 4A6DA 4BHCA 4BMHA 3PFIA 1O3QA 5ED4A 2DPDA 3QU6A 1M4DA 3F8NA 1J59A 1OZPA 3DEUA 4R3LA 2L4MA 3GWZA 4PZJA 4GXOA 3RDIA 4IRGA 3KKWA 2DFIA 2ISZA 1EH7A 1XD7A 3C18A 2JT1A 1GHCA 1XGSA 3R0JA 4HYEA 5LGNA 1QSTA 4LLNA 4I09A 1DPRA 2DU9A 1Z4RA 1K78B 3TKYA 3R60A 1H9GA 3TE4A 5FB2A 4M71A 5LRRA 4M85A 1YR0A 2BE5F 2CNMA 3ZPLA 4PDKA 1YREA 2VN2A 3K9TA 3N7ZA 2O61A 1XCBA 5LGUA 5FO5A 5GCNA 4NB5A 4IPAA 5DDGA 5IT3A 2EV0A 1OKRA 3J81K 3D2PA 5L3CA 2DPUA 3HRTA 5HDKA 2H27A 4KOXA 1W4MA 3GUDA 1F9NA 4ZZDA 5D8LB 3VODA 4M72A 5IV0A 2XRNA 1FP1D 4UNOA 3TDUC 2VXZA 2ESNA 2FL4A 2XUBA 1RXTA 4KIFA 3FMQA 4FT8A 4L8AA 3LSTA 3LAPA 2EFPA 1D5VA 1HW2A 3DKWA 1FPQA 3O6BB 1NMTA 1BC8C 2FIAA 4YFKF 2OAZA 5BPDA 3DR8A 1R1UA 2XAFA 1J2XA 3H3UA 1YYVA 4Y13A 3ZMUA 5E8IA 4PGHA 5K5QA 4A5NA 1IUYA 2XKOA 2PJPA 1Y9KA 4KNYA 1SFXA 1QSRA 4L9TA 2GXBA 1FYMA 1I5ZA 5CVIA 3CTAA 2EA4A 4L0ZB 5D6EA 3S6HA 1ZG1A 3JSOA 3E97A 3WU0A 4WXDA 4MEYF 2KCWA 2EV5A 4CYDA 2EVNA 4BYYA 4ESBA 3EYIA 2D45A 2AS5F 2OBPA 4HW0A 3ML6A 4WF2A 2ZNYA 2FNPA 1QNTA 3WE3A 4II9A 4G6DA 4KUMA 2JEVA 4YRHA 5DEQA 3GFJA 3JUWA 2FT0A 1YS6A 1V3FA 3Q5FA 1PP7U 1XMAA 2PI0A 1RUNA 4Q47A 5JR3A 3E6BA 1U5TA 1QGPA 5CVRA 1DUXC 2CY2A 2YU3A 2CNTA 2VT3A 3KCCA 1USTA 3ZZIA 4BQAA 2V6CA 1IRGA 4AVPA 4U0WA 2CQKA 2RGVA 3HRUA 3F23A 2NNYA 2REEA 1R57A 1V0CA 2Q2EA 3I3GA 5K5RA 2F5IA 3TO9A 3HUGA 3WTVC 3GO5A 4N9HA 2F5FA 4KN4X 1KA8A 3E5XA 4R8HA 3G73A 2IL4A 3EETA 3W6SA 1R5HA 5CVVA 1K7AA 1FNNA 3CUQA 3BDDA 3SFZA 4R87A 3ZMDA 1TTYA 5HLGA 2MBFA 3FYNA 2HS5A 4XPDC 2XAQA 2ELHA 2B4BA 1KZFA 2A61A 2O28A 4AVBA 4UUVA 3IGRA 4ENMA 3LA2A 5DD8A 5F6FA 1OYIA 4S05A 1I27A 2M8EA 3QP5A 4RB0A 4ESFA 3VWDA 4JQFA 4LJZF 2OU2A 1FBSA 1QSMA 4QBJA 3FHZA 1S7AA 1MKMA 5LEKA 3FBUA 5CVJA 1S7KA 1ZLJA 1RIOH 3PZJA 1B59A 1ODDA 2QQ9A 1OR7A 4YGOA 1B6AA 2L4AA 5H20A 4AD9A 3W6KB 2IRFG 4UV9A 4UA3A 3I54A 2BUEA 5FLXK 1KU3A 3BPXA 3E6DA 1P0HA 2GZWA 3LA7A 1IAWA 3U2RA 1SQHA 3V7RA 4JLYA 4GYGA 2RVCA 4CGZA 3JTHA 5FFXA 1ZH5A 5I0CA 3U9GA 4KIGA 1UFHA 1TLHB 2UZKA 1PDNC 1SFUA 1ZLKA 4GO1A 3V4GA 1G6NA 4HDUA 1T98A 1WSUA 4KUAA 3FZVA 2PQ8A 4OOIA 2ZNZA 5D5WB 1MDMA 2G7UA 1J75A 3KZYA 4L9JA 4LK1F 2DXQA 3LAJA 4JWPA 2KIMA 1M44A 4NCZA 3V8IA 1IIDA 2DO7A 4ASNA 5K1YA 2MLKA 3N4MA 2MH2A 2L02A 1ZRDA 5DWNA 2XAGA 2RN7A 2Y0MA 1LQ1A 3N97A 3T90A 4MQ9F 1U78A 2GAUA 2M30A 1U5TB 3FXRA 4CO8A 2IW5A 2NNNA 4P55A 4XSXF 2HQYA 5ILUA 3ABTA 5E17F 1BC7C 2YSRA 3I59B 2BV6A 3I71A 3SZTA 2GIVA 3HTSB 3QB8A 4OMYA 5JPHA 5J8CA 3ZJ0A 5LBQA 1WQ2A 3F8FA 3I59A 1D3YA 2FE3A 3BJAA 4ETSA 3K1PA 3K69A 1YK3A 3KEOA 4Q48A 1ZHFA 3HSRA 4E0AA 4BH9A 1F1ZA 1T6SA 2CSOA 4EV0A 3KP3A 2V1XA 2F5CA 5DCMB 2GWRA 3GZ6A 3DQVC 3R9FA 3JTGA 1LDDA 2RNJA 3ZN1A 3FXUA 2F5EA 5JFRA 5ICFA 3ZMTA 1Z1DA 1WWXA 2G7HA 3ERED 3L7WA 6PAXA 4XNHB 2VONA 4MGRA 2ZMEB 2JDDA 1PUAA 3FIXA 2Z10A 4HX8A 3DV8A 1IRFA 4HV6A 1KUYA 2FBKA 5HLHA 3VB2A 5C82A 2MLGA 2VBZA 2V1DA 5D8KB 4KUBA 5H86A 4IRHA 5KTDA 4KOYA 4KOVA 4JD6A 1JXSA 1IF1A 5L3BA 1Y9WA 2B5GA 1G3TA 3CDHA 4HNXB 1I12A 2J5PA 5CLSA 1TW3A 2O3FA 2KRFA 1QSNA 2J5OA 1B87A 1YW7A 2EK5A 4HZFA 1HQCA 2QLZA 2VOPA 4MHDA 2JPBA 3KLOA 1J5YA 1B6BA 2JRTA 5CNPA 1IICA 2Y75A 4EGZA 2VZYA 1IN6A 3IWFA 2P6SA 4XLNF 4HLYA 5HVQC 2HTJA 4I98B 1DPUA 2Z9OA 4PK2A 3MZYA 3MAJA 3WTXC 1NE9A 3PQJA 4YFNF 3KP2A 1KYZA 4KVME 2W25A 1LEAA 2W84A 1S7LA 1IN7A 1TNTA 4OIPF 1I21A 2MH9A 3DXJF 1K78A 1R1TA 4XRFA 1ZYRF 2OA4A 3FB3A 1QQIA 4F0YA 4MTDA 3M8EA 3S2WA 1Z9CA 3PQKA 2VODA 1TQPA 5HS9A 3ELKA 3GVAA 3KP4A 1YO5C 1G3SA 3OWCA 2VI7A 1S29A 4ZYGA 5DD4A 4ENKA 2ZFWA 3QP6A 3I53A 3DDDA 5F47A 1TW2A 3WG9A 1TQIA 4ENNA 2BGCA 1IZ1A 2L54A 1FT9A 2UXNA 2MA3A 3L9FA 4CHUA 3GYAA 5JQ4A 2Z33A 2VC0A 4FX4A 5E96A 4QWQA 4KOWA 2ATRA 4RS8A 1P4AA 1PUEE 3COAC 2J8MA 1L3LA 4A12A 3TOAA 3LODA 3SQNA 3T8RA 2H5MA 4Y49C 4XPLA 3CO6C 3FNCA 3WTSC 3F3XA 2I79A 2HWVA 2VBYA 1M1DA 5K5OA 1Z6TA 1RO5A 2IP2A 1CJWA 3ROUA 2FEZA 1XGMA 2VBXA 4HDVA 4L0YB 3IWZA 4I0AA 3BOQA 4RB2C 2TDXA 1ZG5A 3MQ0A 2XROA 2FOKA 4CS0B 1YLFA 3ABUA 2FXFA 2QMLA 4HQMA 3W6XA 2G9WA 2K86A 1W7PD 1MGTA 4J3GA 5AIPA 1S5KA 2C6YA 5L3GA 5KVRA 1HBXG 3BJ7A 1CM0A 4FHTA 3M9AA 4L5JA 4QLCU 3RKWA 2WWYA 3F8BA 3BPVA 2WV0A 5FVJA 3W91A 2QENA 4NF1A 4MI4A 2EJRA 1L0CA 1QBJA 5ERIA 5CJ9A 3WTUC 1EH6A 1FWZA 3TTHA 2OZHA 2M1BA 2EA2A 2HKXA 4WCGA 4I01A 1RI7A 4ZH4F 5EEGA 1BOAA 5EBVA 1P92A 4AVCA 1DP7P 4DNCA 3H92A 4UVAA 4IVNA 2K5TA 3VEPA 4GCVA 4KOTA 4PK3A 4I2OA 3CJNA 5D4RA 4HAMA 2PR1A 4ON0A 1VTNC 3ZN0A 3M8FA 3J7AO 4IJAA 1STZA 1H0MA 2NS0A 4JJXA 2FSWA 2QYOA 2PRBA 5JI6A 2OB0A 1B9MA 1FSEA 4MY0A 2FE7A 4S04A 3KP5A 1TQMA 5F48A 1LVAA 1QZYA 3D8PA 1GXQA 4EMSA 4BHBA 2MC3A 4AIKA 1R36A 2EFQA 1ZREA 3GW2A 5HOOA 2JZYA 1A04A 2I00A 1YGHA 3FXTA 3KP7A 4AIJA 2DBBA 1YQAA 3O2PE 2PFBA 2D1HA 1S7NA 2JPCA 2LSOA 1Q2YA 4HLXA 3MCZA 1XMKA 3E6CC 3G3ZA 2FS5A 3QU3A 1Z05A 5LRSA 5L3FA 3FRMA 4KVOE 4GS4A 4HKFA 3I58A 1O3RA 3IWGA 2CYYA 1WK4A 2A68F 3H3ZA 1M4IA 3DNSA 2DK5A 3PGPA 3OOPA 2GA1A 5LEJA 2GE3A 2AJ6A 4UWIA 4EM0B 3E3VA 4HF0A 1Z4EA 3D3SA 4G7ZF 2HOEA 1B1BA 4G7OF 3R9EA 4KOSA 3MGDA 2A69F 3CXQA 1JGSA 3GFLA 3WODF 2DI3A 1HXDA 4EJOA 3V8LA 4G6QA 4QB9A 4EVIA 2YPRA 4LGWA 1XMTA 1XDUA 2DLLA 4OIRF 3MWMA 1ON1A 1PU9A 3U1DA 5LHIA 4Y17A 3F8CA 2KKOA 3P9CA 2FMLA 3QAHA 4KMUX 5H6QA 3BP8A 1BJAA 3P2HA 2FRHA 3FM3A 1O7FA 2VXKA 2VOOA 4O5VA 3F6VA 3TO6A 3E6MA 2Q04A 1KQ9A 4EVYA 4M6XA 4UWJA 3I4PA 1L0OC 4L5IA 3HHHA 4HA8A 1FY7A 2IPQX 3R96A 4XSZF 4CZZA 5HS7A 3LA3A 1GVJA 3GFMA 3EUHA 4AG7A 5L3EA 2HYGD 1O3SA 3BROA 3ZMVA 1XDSA 2MD5A 3R6SA 4XPDB 3QRFF 2R98A 5D5UB 4EM1A 3L00A 4ZYDA 1BI1A 2QQAA 3I9SA 3AAFA 1S8NA 3R1KA 2Q4YA 4RAZA 4AIHA 2ZW6A 2Q7BA 3VOEA 1E2XA 2FCKA 2JLMA 4FD4A 1IXSB 2WTEA 5A2QK 2Q44A 4F7ZA 3EXNA 1OPCA 1ONVA 2FXAA 4HF2A 4BXUA 3BY6A 5JHUA 4KT5C 3DF8A 2V9VA 2HTSA 2RQPA 2XV4S 3CUOA 4H89A 2OQRA 3RKXA 1KQ0A 2K7LA 2VE8A 3ECOA 3V7SA 1SAXA 4OLLA 3CXSA 4WXHA 2BSWA 2P5KA 3F21A 2QUFA 2G3AA 1M4GA 2FMYA 1B9NA 2AXLA 1UCRA 3WGIA 5D5VB 1LDKB 3D0SA 2B4DA 4P96A 1MJBA 3TGNA 4LG0A 1JHHA 2DW4A 1R58A 3SHPA 5BMZA 4RGRA 1BI0A 1KU2A 1ZAOA 2CNSA 3HIFA 3GKRA 1XSDA 4RGUA 1BO4A 3LQQA 2XAJA 3CLOA 1Q2DA 4WK8F 2YR2A 2P5LC 4YFJA 5HDNA 2B5GB 4PV6A 1KGSA 3P9KA 4MHGA 3G3SA 1K79A 3Q9VA 1ZGJA 2X7BA 2P6TA 3KE2A 5LHHA 4QUSA 4UV8A 5DUIA 2R7FA 3M1EA 1XSXA 3RJPA 2OQGA 1QZZA 2PEXA 5HS8A 3D2MA 3IL2A 2ZW4A 3SXOA 1YW9A 1T39A 1T0FA 1I1GA 4ZYEA 2X0LA 2P0WA 4ONUA 4OIQF 5DV5A 3RPUA 3ISPA 1U6GA 3LFKA 4KZTA 2H94A 4KICA 2EFNA 5J6XA 4OINF 5D6FA 4EJUA 3E0KA 3F5BA 2K02A 2QZ8A 4PSWA 4RS2A 4KOUA 3E5UA 4R57A 4M9XA 2H6CA 2B0LA 1ZRFA 1IXCA 4L89A 2STWA 2RKHA 1ULYA 1P4NA 2O6GE 2HQNA 2K27A 4U7BA 3S6FA 4MTEA 3IKTA 1I6XA 2IA1A 3TOBA 2DQRA 2PMUA 4CRZB 1USSA 4KN7X 1BI2A 5E18F 5IT9Z 5KTCA 1R5GA 1UHWA 4AWXB 3KETA 3G8WA 2D1VA 1VHSA 2O0YA 4HNYB 2G0BA 2OZ6A 1V4RA 1P6RA 2QBYA 2H6BA 4LUAA 2PMHA 4NEXA 4X5KA 2GA2A 4QVTA 4ZYHA 1FBUA 4CAWA 1KUXA 3WE2A 2D2WA 1CGPA 5BQTA 1KUVA 4U0VA 4OIOF 1HW1A 1S7FA 2A4NA 3GFIA 5J8FA 5EEHA 4HX4A 4M74A 1R23A 3D5LA 2FF4A 4R9MA 4MJ8A 4IRIA 1XF8A 2GXGA 5DCMA 1UHMA 1LDJA 2QVOA 2L01A 5ILVA 1SD6A 4OADA 4NQWA 3C1DA 2OH1A 2R1IA 3GYHX 1G3YA 3GEZA 2ADUA
chains in the Genus database with same CATH superfamily
4MHZA 1XX6A 3S9NA 5D8NA 3FXLA 3KLNA 3OOUA 3REOA 3VFZA 3V7ZA 4NJRA 1OLTA 1BW5A 2N1AB 2BXZA 1HEEA 4M9SA 3K6GA 2M4KA 3A01A 3KEYA 5IOYA 3FKJA 4J01A 5ISVA 1M8BA 1ZO0A 4GYIA 2XHKA 1RZ4A 3ERMA 3L2NA 3IH2A 4F8ZA 2WSAA 2DK8A 3SHFA 4BGDA 2FBIA 2O03A 2XAHA 1CF7A 3FJUA 2FQ4A 2PJRB 2M7AA 1RKWA 3I5UA 5AIQA 1FSHA 4P5OA 3O8GA 1A2ZA 2O5RA 2ZXVA 1MJAA 3NAUA 2EZLA 2FJ1A 3BTIA 1FOKA 1Y6IA 3O8HA 3WTWC 4UVBA 4C7HA 2IVMA 3D5RC 1CPXA 1ETXA 4EATA 4CGNA 5E1WA 4IX7A 3TCVA 2JA6J 5HVGA 4KDPA 3S6GA 4HX7A 4M3BA 5CVUA 3DP7A 1CHOI 1ETOA 4UFVA 1W5SA 1HA8A 2N17A 4LX9A 1TBXA 4LFUA 3ZMSA 1UVGA 4I7HA 4LMYA 4U9YA 3IRQA 2EV6A 3QPTA 2P7VB 3EYYA 3T9YA 4CAXA 5FKMA 4PXBA 3DU6A 1FJLA 3ZRGA 1GVDA 4AU7A 2KZGA 4RLQA 1VHEA 2NMTA 4NGMA 3C7JA 2DQLA 2P4WA 4XQFA 5C44J 3GF2A 1RUOA 2JDCA 3HOVJ 1NUBA 2HR3A 5CCMA 1E3PA 2LF8A 2W82A 1X2MA 2D5VA 1M8CA 2A3SA 4HQEA 3UEYA 3WTZA 1FOYA 2O4HA 4A3EJ 1JUMA 4R3KA 4JK1X 3FXKA 1WJFA 2HDCA 1BI3A 3BLNA 4DJAA 4NGSA 1X3UA 2HQRA 2VJ4A 1UFMA 1W0UA 3VYSB 1DDNA 4B10A 4D9JA 2H09A 1FC3A 1VI0A 1KMAA 3JSPA 5TGTA 2WV1A 1QSOA 1PP8F 4NXYA 4OC0A 1I50J 4AB7A 2VXDA 1WGXA 1SEUA 3LL7A 4CYPA 3EO4A 4Y7NJ 3R9GA 1IN5A 4G8XA 1BIAA 1R5ID 2PG4A 3KFWX 2CGPA 1Z5RA 4JX5A 4YFXF 3GLXA 3GMEA 2GKTI 4CPAA 1HJAI 4DBRA 3TEDA 3HSFA 2FUG2 2CG4A 5ILSA 1RPWA 3FWEA 3S8PA 3DTKA 1T2KA 4A5MA 2R0QC 4BNCA 3GOXA 3FM5A 1GYTA 4OC5A 3EC4A 3TL4X 3JREA 5CYVA 5CQGA 4A3KJ 4RAYA 3DSBA 4KLVA 3WTTC 2LP0A 1IYLA 3SJFA 3SXYA 2M7BA 4YIFA 3WR7A 2JSCA 2XAUA 2F4IA 3K4JA 4NBQA 1VF9A 3B6CA 2O8KA 4LQ6A 4A0YA 3GBGA 2CV0A 5E3LA 3WTYC 4BL0B 1XC5A 2EFWA 2HQAA 2MG4A 4DGWB 3HL2A 3L2RA 2C6PA 5AG4A 1ETVA 2VKEA 3KZIC 2V7FA 4A2UA 2LNBA 4UHTA 2CJSC 1ETQA 4B4CA 1H8AC 4M73A 1R22A 2K3FA 2MGQA 5FKLA 4U5YA 1N71A 2POKA 4MFEA 2NS8A 1F2PA 2B58A 4OC1A 1C0WA 1WWZA 1UJ8A 3FIWA 2ZELA 3DKXA 1HDQA 3HB9A 2FNAA 3O3KA 4QTRA 3KPHA 1CQTA 1AN1I 2BVLA 3GCMA 4ZX8A 5LHGA 4H6UA 2PJAA 3VWEA 3TQNA 4CA0A 2ZJ2A 5ICGA 3WHCA 1T33A 3L09A 3G6EI 3DEWA 5TRDA 5H84A 2ETHA 5IYCJ 3TDZC 2V8VA 2NVTJ 1XX5A 2WY7Q 2HU9A 2H8WA 5B3SH 1SMYF 3PUFA 4LLGF 3OXFA 5IB0A 5CBMA 1X10A 5JM6A 1JT0A 3PP9A 4F91B 3D7FA 2GXAA 2X1EA 1YVKA 2XASA 2A5WA 4MXUA 4UCNA 2IS4A 1ON2A 4X2TA 2EWNA 2KIUA 4NNJA 3MN2A 5FGMA 3FMCA 2CQXA 2AFUA 2ANPA 3W2VA 3CUQB 3SGBI 4BKXA 2PJ0A 3HPHA 4LOCA 3LOCA 5JH9A 2STTA 3M3YJ 2OCEA 3QODA 4O23A 4MFKA 4RLFA 1U3EM 5E79C 3H1CA 3K9UA 4PXEA 5FKOA 1IW7F 2B3VA 2UV1A 2R7WA 5AG5A 3R0AA 7WGAA 1XB4A 1BUSA 1XE4A 4UVCA 2K40A 1B4AA 3H5NA 3DFGA 5D4SA 1LNWA 1HDLA 4C2TA 2Q2EB 4MLOA 1IG7A 4R7MA 3ZP5A 5E3PA 3FMRA 5IX3A 3FMSA 1H9TA 3QTLD 1TKHA 1JTXA 4N0BA 3V8KA 3K4BA 4UIBA 4BJ6C 5JLXA 4LB5A 2L7ZA 2YNDA 4KVXA 2WB1A 2NU4I 1ZGAA 2KP6A 4O6JA 3RYOA 4C68A 1VQ4I 4B11A 4NSQA 2QKMB 2AHQA 1LB2A 2K9QA 4WWVA 2XF5A 4UXNA 1IGNA 2E73A 3P9IA 2GANA 2PE3A 2REFA 3IU1A 2DT5A 2L8EA 1QHGA 2ORVA 1CT0I 2V9KA 4E2AA 1J7KA 3T8TA 3P7NA 3OIPA 4OMZA 1CF7B 2FBHA 4P45A 3EQLF 2VQYA 5E3QA 2WC2A 4FWUA 4ORFA 4Q5SF 2P6EA 1PYVA 4KISA 4Y49B 4CXFA 3A01B 3K1NA 5GPCA 5FD6A 3RIRA 4DW6A 3K2ZA 2AXTC 2V79A 4XLFA 3SJMA 1U8RA 2HV2A 2CUZA 1BM9A 1SFEA 4V2GA 4LG3A 4XN0A 4IF4A 3IC1A 5DWMA 2DTRA 4DYCA 2EZKA 4NHJA 2WA0A 3BI0A 2EWBA 3ZQHA 3HRSA 2DTZA 1RR8C 1MH3A 2B0UC 5G20A 4F6AA 1UB9A 2ID6A 4NQWB 2HKOA 4MFPA 2R7HA 2IGNA 4BE0A 4X0GA 3S1RJ 1CT4I 2LTPA 1LFBA 1IYKA 1YX0A 1XGOA 2DYRH 1AWCA 2V26A 3LWFA 3F72A 1U0JA 5AONA 1GT0C 1VQ5I 3QYFA 3TW7A 2ZXWH 1EE3P 3TP3A 1JT6A 1X3WB 3ZQIA 1IC8A 2LG4A 2COMA 3SDBA 5K7FA 1R7JA 2IA2A 3RQ4A 3HYIA 4FD6A 4HF1A 3TC8A 3CCJI 1REPC 3T1BA 2Y69H 1JKQC 1BPNA 3UOEA 1OCZH 1LRZA 2FIWA 1FYKA 4A38A 4PGGA 4CAVA 3GTGJ 2EFOA 3HRMA 2ZSHB 5H6RA 2ZMEA 4IAVA 3BJOA 2KT0A 4A95A 1HKSA 4OIWA 3CUQC 4Z2YA 1W1WE 3FXQA 2W24A 1K6YA 1NH3A 2VBWA 2B3UA 2FVGA 2CW0F 3J7ZI 2EH3A 1POGA 3B3WA 1TT5B 2HOAA 3H5ZA 3KIOA 3TFYA 1S5LC 1LE8A 3E1SA 4CGLA 2YQPA 2ARHA 3CCYA 4LLLA 1J9IA 1E3HA 3ZMZA 3GZ5A 4XKVA 1R00A 3MMYB 1FYLA 2BYVE 2JTVA 2L7MP 4OWRB 4LD5A 1LOKA 1S3ZA 2KIQA 2UZ3A 2VC1A 5J40A 4FX0A 2ZCWA 3PNVA 3D7DA 3L2UA 2UWMA 1YVOA 1ZN2A 4M3SA 1MMSA 1SMTA 1QRYA 2DMTA 2Z99A 3K4KA 1ZRCA 2VBQA 1MBJA 1XJOA 4XPKA 4FETA 5LRGA 3VWDA 5EMIA 4UB8C 4FCYA 3LSGA 2PLYA 3WGHA 3CCRI 4AG9A 2V4JC 4XOPA 4BBRJ 2OJED 4ENJA 5E3RA 5J1YA 3CPAA 5THWA 3RI4A 3JRHA 2PJ2A 3T5XA 3FK7A 5FLXZ 2JW6A 2SGDI 2P6FA 3QOPA 2QF7A 2LREA 3JRFA 2FSRA 1HSJA 4G1PA 2Z3MA 5ICEA 3OYDA 1VKCA 3S6KA 4OVOA 4O3MA 5LGTA 1WKXA 2ZMEC 3JTKA 2BY1A 3F8KA 2PJ9A 3ZQQA 5HLIA 5B1AH 3GZNB 3TO7A 4S0HB 1N78A 3R95A 3FXMA 1LFPA 3PUBA 4I99C 4KORA 4R79A 5LFAA 2ZEGA 2FA5A 3MFKA 2Y48A 2E1NA 3CF2A 2X6WA 5IT9K 3A2KA 1PTQA 2DKVA 1R4MB 5E8GA 2KJCA 1GLNA 3EDPA 3VDPA 5EX0A 4L9VA 3IRRA 2K4JA 2L9NA 4HEA2 3LWUA 1S7OA 2K9MA 4D0PA 2O8XA 1P4XA 3K0LA 1Z8TA 4ZZLA 7CPAA 2NAZA 2WYRA 2P6GA 1SD5A 4R76A 4QIWN 2QQBA 3CCEI 3CXPA 1K61A 2D4OA 3FF5A 4N9IA 3CJRB 1QPMA 3BZCA 3F0CA 2HVQA 3BC8A 3OYCA 1WJCA 2DAOA 3B73A 3WGGA 1V1HA 3HSEA 5HDGA 3W2AA 1YQEA 2BOLA 5HH1A 2HYFA 2Q0YA 3SZPA 5BS6A 2AE6A 2RDPA 1YW6A 2NRAC 4GXHA 4U7DA 3LSMA 2X1DA 3KEQA 1TL8A 1MDMB 3OYEA 2Q51A 3T0YA 2JMWA 1V5FA 4MPIA 4HV5A 4JX4A 2PIZA 4WWCA 5JLWA 4B1RA 3QYEA 3RSNA 5KNLA 2A6HF 3MZHA 4CYCB 1J4JA 3AG2H 1Z7UA 4K2EA 3M4OJ 2D4PA 2CMPA 4IHWA 3FX6A 2L3DA 4C9YA 4H0EA 2X4HA 3C2HA 2EZIA 5IPAA 5J47A 1U5TC 3KZZA 2QM3A 1IJWC 3I56I 2NU0I 4LQGA 3WU1B 4ONWA 1X1PA 3PSIA 5E1ZB 3A02A 1HW5A 4RUHA 1QMUA 2IJLA 1Y7EA 3G1LA 4PPZA 1V5EA 1SC7A 4WXCA 3SXNA 3V42A 1W7PB 1NK3P 2CTBA 1P9ZA 2ZPAA 1CE3A 2ELKA 4P4DA 1YFHA 4XN3A 4Y15A 3R61A 4JXRA 1SD4A 2QIRA 1Z91A 3PNYA 3QOEA 4YIIA 3TP0A 2EUIA 2ESHA 4NGRA 1Q2CA 4CZCA 4MNUA 3PNTA 5BPIA 1Y0UA 3S2HJ 2J8NA 3DPLC 2IT0A 2P7CB 1NSAA 4IHTA 5D5XB 4AUXA 3EPZA 2CXAA 1AOYA 4X8IA 4M9ZA 4IO9F 1BA5A 5FJ8J 3W2WA 4ZDOA 4XKWA 4G7HF 2JUGA 5EGOA 1OCTC 2XDVA 3FX3A 5L3DA 2B4DB 4MEXF 3BJ8A 4A2ZA 3PJRA 3QPHA 4H6ZA 1NSLA 2M0MA 1IUFA 2CWEA 1ON0A 3LSHA 2DA5A 1ZG8A 3OSGA 1X12A 3VWBA 1BN5A 3IU2A 2KZVA 2ZXJA 4PCQA 4ZX9A 4KLWA 3OWTA 1W0TA 2OR4A 4RI1A 5DUKA 2PC1A 1Z6RA 4XOTA 2CFXA 4B3XA 3OYIA 2AQFA 3SDGA 1YIJI 3WG7H 4HPSA 3HTUA 2DA3A 1KYWA 4P4JA 2QWWA 4M6GA 1F36A 3DBHB 2AQEA 2IA0A 1IN8A 2FU4A 2L7KA 5LLQA 2G9DA 2KMRA 2XEGA 3I0TA 3AFHA 2A5YB 4MY3A 3W6VA 3QAYA 1WRJA 2BOAA 3W6JB 1E17A 2E36A 2JA1A 4ABZA 1O7LA 3CLQA 2WADA 5C4XJ 3BJ6A 4OMEA 3E0JB 3D7HA 1R1VA 1LAPA 2F7VA 3I64A 4YU9A 2XEFA 2BY2A 2HFHA 2Y31A 2ZC2A 4MQVA 2ISYA 5KK1A 1J0RA 1ZARA 2YX7A 4AVZA 5F04A 3K1MA 3OS1A 1SD7A 2LDUA 2EIMH 3HOTA 1PYTB 1BOBA 3BG7A 4HRIA 3U21A 2XKPA 1KQ8A 2PJ5A 1Z7LA 1O57A 5E1XA 3IHUA 1XRYA 3NWSA 4D5CA 2E2IJ 2R3SA 4YG2F 3S2DJ 2G3TA 3IIBA 4MBUA 5HMNA 5FUYA 1TBOA 5DM6F 4ZDPA 3HOSA 1Q7LA 1EKEA 5IYBJ 2WAQA 3SZGA 1HSTA 4JZ0A 4XMYA 2VJ5A 3HUGB 2XEIA 2VEZA 2OUMA 1YMEA 4XLPF 2AFSA 2KDZA 3VARA 5JVTA 4NFRA 2DA1A 1DGWY 3HJEA 1F5TA 3ZR8X 3JCUC 3CDIA 3JW4A 5FRMA 1FLIA 1LR8A 1S20A 1H8LA 1ARMA 1G3YA 4E8OA 1MSEC 4RB1A 1Z3YA 1IV8A 4GGGA 1MK4A 1SFKA 2QGUA 1BR4A 4A0ZA 4UXIA 2DFEA 2IGMA 1OCCH 5I4MA 2BBYA 1Z9UA 3B02A 4M6YA 2P8TA 2HGCA 4PFOA 2LF7A 3NQOA 4PSXA 1JE8A 4U87A 4X1EA 3S16J 2RQQA 2X6XA 4BY7J 3GTQJ 4U0YA 1IN4A 2LEOA 2M9HA 4PUSA 5DCFA 1SGNI 1MJ9A 2WY8Q 1XGNA 1CBXA 1KU9A 3SI0A 2VT2A 1G8XA 2HNHA 2PJRA 4AC0A 1SGPI 2HB6A 4M6IA 1LFUP 4ZC3A 4IHYA 2YGWA 2ZW7A 3T8WA 2E71A 3AG4H 3ABLH 2IXSA 2W57A 4L9NA 4P4IA 3G1MA 1WKMA 2NSMA 3B2YA 2NOGA 2IJZA 1Z2IA 4PJJA 2DPTA 4EJVA 2A20A 2JEWA 4JBAA 2HC9A 3E59A 3BR0A 4CRYB 2Q4VA 4NGPA 2BL1A 2BEOA 1D8JA 2M45A 2NVYJ 4A0XA 3RNZA 2LKPA 1TNSA 3HKZN 4TV7A 4CDGA 4ZBGA 2KCXA 2E1CA 2OF7A 2PN6A 1U6MA 2OD5A 2WBMA 2BW3A 1YHQI 4BHPA 3C3WA 3GTOJ 3G1OA 1Y7RA 2K9NA 3IFEA 4IHSA 3RYPA 3H9GA 3M7GA 5K8MA 4U88A 4ANJA 5EC4A 4HBLA 1XMBA 2F5DA 4E4HA 1Z77A 4A94A 2O7OA 3DEEA 4BJTA 2ACJA 1MNDA 4JYKA 4E70A 2NOJB 3U1KA 2Q0OA 5FKKA 4I0BA 3MKYB 5M5WJ 4P4BA 2DEAA 1GXPA 3V7CA 3SYTA 5ICCA 3VPRA 3BR6A 2N52A 2CW7A 3LQRA 2R7DA 3QWLA 1OYYA 3J81Z 4H4KC 2C6CA 5HNFA 4I49A 2JJ7A 2L2OA 5KAFC 3A03A 1Q9BA 3FISA 3TT2A 2VL8A 3OS2A 1O3TA 5FD5A 1FP2A 2OV7A 4KFCA 3RZOJ 3LSIA 2EB7A 3IUOA 1AUGA 4B8XA 3EFAA 3OYLA 2UXXA 3RKYA 4NGNA 2PR8A 4F0YA 3ECHA 3DTIA 4XNHC 4B5PB 2A07F 2QVPA 2ZKZA 2QBYB 1MT1A 3LSKA 1K4JA 1A35A 4BS9A 3EY5A 1P4WA 3MD2A 1Z8WA 2F2EA 4G9YA 3I1UA 3P2FA 4FD5A 2KQRA 3HOYJ 3IKVA 3OL4A 3DLAA 3B8GA 2ME6A 1Z7KB 4A6EA 1AKHA 4A30A 4B12A 3F6OA 2PJ8A 2K85A 3GY9A 4EM2A 2LMDA 1JUPA 1YG2A 2ABZA 2QQ0A 4AVAA 4B5OA 2A05A 1W3SA 2KJBA 1EV7A 4MO7A 4NDLA 2NU3I 3ULQB 3ESWB 3QWPA 2RC4A 2H1LA 2QQ8A 2ORWA 5CPAA 3SJGA 4A32A 1XN7A 5F1RA 5C88A 4SGBI 2W00A 1Z8LA 2OOTA 4EQQA 2KIFA 3S93A 3OIQA 3RYRA 4DYQA 2ZBKA 3J80K 4P10A 5F49A 1T56A 1UMQA 1ZG3A 3KI9A 2VI6A 4N4OB 3M07A 1XIXA 5GP9A 1G3WA 2E35A 1E0EA 1U9OA 2HEOA 2J8RA 1ETWA 1EH8A 2E1OA 3BZ6A 2VRWB 2PJBA 2ZEEA 4QSHA 2C27A 2ZEPA 3IJ3A 4Y33A 1CX8A 1HF0A 2E7WA 2XGXA 1ZQ3P 5HI7A 4B5PA 1XEBA 2ZW5A 5DYMA 1M1EB 2GQQA 1P2FA 2Z3YA 3HC7A 3E5QA 3R5DA 1IOFA 1XSVA 3FH4A 1YLEA 4WX9A 1D8KA 5HNHA 2NS7A 2ENZA 4C3JJ 3H4QA 2Q4ZA 3D4UA 2OPTA 5E3MA 5BOXA 4KIBA 2VIXA 2E5NA 3FXOA 3JAMK 1T08B 3NWTA 4OU0A 4DQ2A 3OXGA 5F46A 3GX4X 2QEXI 3BWGA 2RIJA 1K6OA 2EO8A 2WPXA 5DTDA 1P9GA 1U2WA 1MMDA 3IC7A 3R4KA 2WAFA 3RPQA 1TXRA 5BWAB 3FBIB 3WT4A 4P9FA 1QPIA 5A2QZ 1NXUA 1FBQA 5FLMJ 1GHEA 4FAIA 2XPVA 5KTAA 2A6EF 1WVRA 3JAMZ 2WGCA 3LNQA 1NG7A 1EJ9A 5F0HA 1HDDC 1VQ8I 4HPQA 4KA4A 2WAEA 4UBRA 1KU7A 1RNLA 3I3LA 4FD7A 3QPSA 2R8VA 3F9KA 1QVUA 1MZBA 4JXQA 3JVNA 3GYHX 3B4VC 1VQ6I 2CIJA 1FX7A 3DPTA 2WPWA 4K30A 5LRKA 3ABMH 5KHDA 4B43A 2HZTA 1WJ5A 4OAEA 2BVMA 3FECA 2PBIA 2GOXB 4R1HA 2PDOA 3LD2A 4EJTA 1LEBA 4C2ZA 1LJ9A 4UFWA 4U9ZA 3BG3A 2Q1ZB 4WP4A 2RV8A 3Q9SA 1DE4C 2DJNA 3H8GA 2MFZA 4YRVA 3IV5A 1UVFA 3B3SA 3D7GA 1QO0D 4EJWA 1PVEA 4Q4ZF 2XSDC 1YTYA 1CPSA 3FSXA 1W5TA 2OZUA 5IP7J 1I3AA 4PJMA 2BEIA 1IO2A 3L2QA 2V1UA 4DUKA 1DQUA 3HOZJ 1T38A 1B8IB 3CO7C 2H8RA 1TWFJ 5GPAA 5EGOB 1BIBA 2EBJA 4C2XA 3ISZA 4BAYA 4QC6A 1F4KA 1ENHA 1UWYA 2PSWA 4ESJA 1G4DA 3H3VK 2GKRI 4IXAA 3LMSA 4A3IJ 4RGSA 2VE9A 1IY6A 2R92J 1QU3A 4FISA 4XRMA 2JN6A 4CICA 1H88C 1OBRA 5FRNA 2FQ3A 2Z5UA 2RFHA 3L2CA 1YJWI 4A93J 4XBFA 1HKQA 2DPSA 4UCPA 2ZJRF 4UY8I 3OV8A 2VZZA 2P5VA 1XA6A 4LG0B 2DA6A 1YIOA 3OL0A 3DR6A 2M87A 1B8IA 1AU7A 1I1DA 1OCRH 1A5JA 3NRVA 2Z0ZA 1S3JA 2KMUA 1W7PA 2LK2A 1MMNA 3GXOA 5EYRA 4I02A 2K4BA 3RU0A 1S6LA 3D68A 1TIQA 3FDYA 5F64A 4IF5A 4Q7AA 3SEKC 3NEUA 2F3CI 4KMFA 1JHFA 4B09A 2E2JJ 2OZGA 2HUZA 2ZOFA 3B6AA 2R7VA 2W85A 3RTRA 2IBDA 4UCMA 3K10A 1QVTA 1A31A 3KP6A 3ZGKA 5HODA 4RGXA 1OYWA 2LY9A 1QHHD 2AFWA 3OXLA 2HOTA 1WHUA 1CGII 2Y9ZA 2VQCA 4CYCA 3NE7A 2Z11A 2CUFA 3HKZA 1ZLHA 4P6YA 2LY2A 2Q8KA 2DMPA 4GI3C 2SGEI 3OS0A 1I3QJ 1S60A 1VQ7I 4J00A 1XOVA 2MYSA 4IZZA 1Q1HA 4P1WA 2JQ7A 3V8JA 3E2IA 3UR3C 4KYWA 4D1QA 1I1SA 3F0AA 3MEXA 3F8MA 2K9SA 1YS7A 1YW8A 1MD0A 2L7FP 2LVSA 4LB6B 3ZQ7A 3F22A 1W36D 4FTHA 3HHGA 2DXIA 2R5YA 1X74A 2GVIA 2QECA 4C30A 4HOBA 5EZHA 1APLC 4H2KA 2YU9J 3JRGA 4CYQA 3FXJA 5GAHJ 3CCSI 1IB1E 5KAIC 1NHAA 4FUUA 2EINH 5TJJA 1PUFB 1R79A 1BW6A 2V6EA 2ZO4A 2XVCA 3C2BA 2E7XA 2OVOA 3OR2C 3BXMA 1FZPB 4IUSA 3B3CA 1X1DA 1WI9A 2W7NA 3J80Z 1DS3I 4PJLA 2TCTA 4DBQA 1HKTA 4HNWB 4E7HA 1JKRC 4L18B 2XIGA 2HZDA 4G94A 2CQ7A 1XCVA 4HNTA 2M5WA 4IHXA 1LANA 1IW4A 2K9HA 4A39A 2NYXA 4EGYA 1IXRC 2QA4I 1DS2I 1OMIA 2ZJQF 1FAQA 2XGDA 3GLJA 4P9UA 1BBYA 4LK0F 4AXVA 2CV2A 1Z3XA 4RAGA 2VKVA 5F0FA 5FFZA 2PJ3A 2ERWA 4M3EA 4RB3C 3OYFA 5E20A 3TW6A 3UY5A 4A6DA 2XGEA 4BHCA 3UKGA 4NJQA 3PFIA 1O3QA 2NYQA 1AA7A 2HQ5A 4BMHA 3I4MJ 3VH9A 5LD2C 2GLFA 5ED4A 2JBKA 2DPDA 3QU6A 3ZXSA 1M4DA 1UUCA 3UGIA 3F8NA 1J59A 1LCPA 3AL0B 1OZPA 3QNVA 2HXOA 3DEUA 4R3LA 2L4MA 3G4SI 4M6HA 1YLOA 3GWZA 4PZJA 3OYKA 4GXOA 3RDIA 4IRGA 2A6TA 2HPIA 3KKWA 2DFIA 4UUTA 3KYCB 2ISZA 4C2UA 1EH7A 2K3PA 2LR8A 3OR1C 1XD7A 2I10A 3C18A 2JT1A 1GHCA 2ZENA 1XGSA 1DGRM 3R0JA 4HYEA 5LGNA 1VQMI 1QSTA 4IKFA 4LLNA 2KISA 4B48A 4Z65A 5A28A 4I09A 1LKXA 2X52A 1DPRA 2DU9A 1Z4RA 3Q3SA 1K78B 3HG9A 2IMOA 3IAM2 2PIYA 1YI2I 3TKYA 3R60A 1I39A 4AM3A 3K7AJ 1H9GA 4BD9A 3R5AA 3TE4A 5FB2A 4M71A 3GTKJ 5LRRA 1UZCA 3HLPA 2KRCA 4M85A 1YOVB 1YR0A 1W36C 2BE5F 3PB9X 2CNMA 4PDKA 3ZPLA 1YREA 1CP6A 2VN2A 3K9TA 2FX0A 3CESA 3N7ZA 2O61A 1XCBA 4B3AA 2E5RA 2X3TA 2PJ6A 3BTCA 1MBHA 2HYJA 5LGUA 5FO5A 5GCNA 4A3GJ 4NB5A 4IPAA 4CCNA 5J1RA 5DDGA 3GTLJ 1D5YA 5IT3A 2V77A 3M8JA 4PXDA 2LFBA 2EV0A 9WGAA 2YUUA 3UGDA 2L9VA 1KBEA 1OKRA 3J81K 3D2PA 2HPMA 3GTMJ 5L3CA 2DPUA 3KY9A 3HRTA 5HDKA 2H27A 2BW3B 3PSFA 1X1CA 4KOXA 1TWAJ 3OY9A 1BL0A 3VYRB 1W4MA 3GUDA 2MSYA 1F9NA 4DIQA 4ZZDA 5D8LB 2LLKA 3VODA 3KQZA 1S9HA 2QSGX 3K4MA 4M72A 1WZ2A 5IV0A 3PIPF 2XEJA 2XRNA 1FP1D 4UNOA 3TDUC 2JSPA 2VXZA 2ESNA 2FL4A 2ZFUA 4A3JJ 3NA6A 2XUBA 2B7EA 4XONA 4KIFA 3FMQA 1RXTA 1Z67A 3R5CA 4FT8A 1DU0A 3NH4A 1DTDA 2GOMA 3BQZA 4LIVA 1MIJA 3LSTA 4D7NA 1TUSA 3LAPA 1NTCA 1VGYA 4L8AA 2EFPA 1D5VA 3I4NJ 3S1NJ 4OKOA 4MCRA 2CU7A 1HW2A 4BJ5C 1JKPC 3DKWA 4ZI6A 3Q0VA 3RBUA 1FPQA 3O6BB 1NMTA 1BC8C 5FLVA 2FIAA 4YFKF 2QPOA 2GIZA 2OAZA 5BPDA 3OVOA 2X1CA 3PEIA 4ZY2A 3DR8A 1R1UA 2XAFA 4CCLA 1IY5A 1J2XA 2Z3NA 3QYBA 3H3UA 1YYVA 4Y13A 3ZMUA 4FBEA 4UUSA 3LSRA 4JP0A 4XM3A 5A27A 4N4NB 5E8IA 2JA8J 4PGHA 5K5QA 4TNUA 4F93B 4A5NA 5M5XJ 1MBKA 3G2BA 4CGOA 1IUYA 2SGFI 1VZ0A 2XKOA 1JI8A 2PJPA 1Y9KA 1WPKA 3ZQLA 2VL1A 4KNYA 1SFXA 1QSRA 2QKLB 4L9TA 2GXBA 2ENNA 1FYMA 4XIDA 2R7ZJ 1I5ZA 5CVIA 2DOAA 3CTAA 2EA4A 4L0ZB 3NH8A 3PB8X 3B3VA 5D6EA 4UXJA 3S6HA 1ZG1A 3JSOA 3E97A 1E3OC 1AYEA 4BBHA 4BQNA 3IAS2 3K4NA 3TJQA 1FMWA 3WU0A 4WXDA 3D66A 4MEYF 2KCWA 2EV5A 1YX5A 2Z3KA 4X3RA 4CYDA 1GV2A 1ZR4A 4NC8A 4F9VA 2EVNA 4BYYA 3GIUA 2Y9YA 4UF4A 2F6CA 2IAIA 4ESBA 3EYIA 3H9QA 3A0BC 2D45A 2AS5F 1RETA 2OBPA 4XNFA 2BO9A 4HW0A 1BMOA 3ML6A 5F1JA 3MKWB 2SGQI 1JGGA 4WF2A 5B1BH 2ZNYA 2FNPA 1QNTA 3LSJA 4DZJA 1LUJB 3HZJA 3WE3A 3LFUA 1OMUA 1XMXA 4II9A 4G6DA 4KUMA 2P6AC 4IK2A 3VDXA 4XICA 2JEVA 2B8TA 2CQNA 4YRHA 5ELYA 5DEQA 2VPLA 3GFJA 2DCEA 3JUWA 1SGQI 1QQ9A 1XTAA 1YS6A 1K4TA 2FT0A 1V3FA 1LFWA 4PK4A 2FD5A 3Q5FA 1PP7U 1XMAA 1RFHA 1FOXA 2UUZA 3S3NA 1UG0A 2IQ6A 2PI0A 4XLHA 1RUNA 4Q47A 5JR3A 1Q1VA 3E6BA 1U5TA 1QGPA 3PM1A 4JX6A 5CVRA 5KCMA 2WZNA 3WU2C 2RREA 1DUXC 2CY2A 2YU3A 2CNTA 3LSPA 2IGKA 4BINA 5FUXA 3UEJA 1PJUA 2VT3A 2F5VA 1USTA 3KCCA 4C3IJ 4BQAA 3ZZIA 1R0RI 2PMZA 2OC6A 2CS3A 2V6CA 4PJNA 4AVPA 3RKQA 2JA7J 1IRGA 1AMPA 2V9PA 3OYBA 2EZHA 3K2AA 4U0WA 1TC3C 3PBBA 4PQAA 2CQKA 2RGVA 3HRUA 3F23A 2NNYA 2REEA 5J4VA 3PIOF 1R57A 1V0CA 3B35A 2Q2EA 5CQEA 3E7LA 4UEEA 4Y52J 3I3GA 5K5RA 1CG2A 2F5IA 2QYVA 2JA2A 4DOZA 3TO9A 5AGEA 1BPMA 3HUGA 2QQDA 2MC4A 1ERDA 1WGCA 3WTVC 2NXNB 3GO5A 5IP9J 5JHWC 4N9HA 2F5FA 4KN4X 1KA8A 3E5XA 3HEFA 4R8HA 2HI3A 3G73A 3CCMI 2CRGA 1MH4A 2ECBA 3EETA 2IS2A 1R5HA 3KQXA 3W6SA 1PPFI 5CVVA 2Z1DA 1K7AA 1FNNA 3CUQA 3BDDA 2YS9A 3H9JA 2Q7SA 3SFZA 4R87A 4GFBA 3HBLA 3CMEI 3ZMDA 1TTYA 5HLGA 2HVSA 1MW7A 2DOFA 2HS5A 2MBFA 3FYNA 4XPDC 4MMOA 2XAQA 2ELHA 4CCMA 2B4BA 3N5FA 4CSWA 3ZQCA 1KZFA 1R71A 2A61A 2CQQA 1H89C 2O28A 4MCSA 3ZOBA 4AVBA 4Y4RA 3A9LA 2R7OA 1FMVA 2RB7A 4UUVA 3IGRA 4ENMA 4W1UA 2W1OA 3LA2A 1X1BA 3CMAI 3D1NI 1LR7A 5DD8A 5F6FA 5K8NA 1OYIA 4IEJA 4S05A 1I27A 3VE5A 2M8EA 1MBFA 2ZXIA 1D1AA 3QP5A 4RB0A 1X58A 4CCOA 4ESFA 1YJ9I 3QQAA 4W97A 1NK2P 1TGSI 4MFJA 3FKIJ 4JQFA 1VNDA 2Y30A 4MCQA 4KJZA 3BHXA 1T95A 4RN7A 3J7YJ 4LJZF 1ETYA 1ORKA 2OU2A 1FBSA 1TKFA 1QSMA 4QBJA 1D1CA 3AG3H 3FHZA 1S7AA 1MKMA 1SVMA 1FTTA 5LEKA 3FBUA 4MFZA 5LYLA 5CVJA 1S7KA 2QJ8A 1HEVA 1ZLJA 1RIOH 1ULNA 3S3MA 3PZJA 1B59A 3CF5F 1ODDA 2QQ9A 3S32A 1OR7A 3S15J 3QPLA 1B6AA 4YGOA 2L4AA 5H20A 2CW8A 3W6KB 4AD9A 4UV9A 2IRFG 2ROWA 4MHPA 3I54A 2BUEA 4UA3A 2DMQA 2DA4A 4YWYA 3SJXA 5JHFA 5FLXK 1KU3A 2LYCA 3BPXA 3E6DA 4XLAA 1P0HA 2AFZA 1TT0A 2GZWA 3LA7A 1IAWA 3U2RA 1SQHA 3K4LA 2IL4A 4NC6A 4XL9A 3V7RA 4JLYA 4GYGA 5DAEA 5F08A 4BXXJ 1RR7A 2RVCA 4CGZA 1ZKGA 3JTHA 5FFXA 2BHZA 1XS9A 1ZH5A 4E7IA 1TBNA 5I0CA 3M1CA 3U9GA 1IRZA 4OAYA 4KIGA 1V5GA 1UHSA 1TLHB 1R4NB 1Y0NA 2BY0A 3DWLE 2UZKA 1SFUA 1PDNC 1ZLKA 4II2A 4GO1A 4IQJA 1QA6A 3JRUA 3CP2A 3V4GA 2XGCA 5HVHA 1G6NA 2XB5A 4HDUA 3VSLA 1XBTA 3PB6X 3KHXA 2KRHA 1T98A 1WSUA 4KUAA 3WABA 3FZVA 2PQ8A 2DODA 4OOIA 4E7SA 2ZNZA 5D5WB 2ZSIB 2G7UA 4RAFA 4CUGA 1MDMA 3KZYA 1MMGA 4L9JA 1J75A 1B72A 3S9MA 4LK1F 2DXQA 5FUWA 1CT2I 3AKZA 1PCEA 3LAJA 2Q43A 4YEJA 1YX3A 5HVFA 3BG6A 4JWPA 4NGTA 2KIMA 4B14A 3JRBA 1M44A 4NCZA 1NG6A 3V8IA 1M4LA 3MRUA 3PO2J 1IIDA 2DO7A 3R5BA 3KHZA 4IOAF 4ASNA 5FKNA 4LIUA 5K1YA 1K7TA 2N71A 5F09A 3IH4A 4KSFA 2MLKA 3CDLA 1T8IA 3N4MA 2MH2A 1ZR2A 3PB7X 2L02A 1ZRDA 2L5QA 2XAGA 2RN7A 2Y0MA 1ZLIA 1LQ1A 5DWNA 3N97A 3T90A 3ONQA 3ABKH 2VQLA 3JR9A 4MQ9F 2AFMA 3WC6A 1U78A 2FOWA 2GAUA 1EF4A 4CCJA 2ELJA 1U5TB 2M30A 3FXRA 4CO8A 2IW5A 2NNNA 4P55A 4BDYA 2NU2I 4XSXF 4NGQA 4B44A 2HQYA 5ILUA 1FEXA 3ABTA 4ZGYB 2X9DA 3IH3A 2Z16A 5E17F 1BC7C 2YSRA 3I59B 4I76A 1G59A 2BV6A 4R8FA 1ZELA 2JYYA 4KS9A 3I71A 2DT6A 3SZTA 2GIVA 3PRTA 4Z6YA 3HTSB 3QB8A 4OMYA 3DGVA 5JPHA 2LB7A 1P9QC 5J8CA 3ZJ0A 3DTEA 5LBQA 1WQ2A 4ZYQA 3WC5A 3F8FA 3I59A 4JYWA 1D3YA 2FE3A 3BJAA 2XB0X 4ETSA 3K1PA 4B6DA 3K69A 1YK3A 5GAEJ 3PO3J 3KEOA 2DIPA 4M3FA 1ZHFA 4Q48A 3HSRA 4E0AA 4BH9A 1F1ZA 1LR9A 3W3CA 1T6SA 3CCUI 4I6ZA 1JTYA 3FK6A 2CSOA 1KBFA 5IB9A 3A4CA 4EV0A 3KP3A 5CPRB 2V1XA 3GEZA 1HDPA 1K7VA 1D0XA 2F5CA 2GWRA 5DCMB 3RQIA 3DQVC 2VQHA 4A69C 3GZ6A 4EFDA 3R9FA 3JTGA 3BJIA 2ARPF 1LDDA 2RNJA 2B9SA 2GBYA 3ZN1A 1SVLA 3FXUA 1GDTA 2F5EA 5JFRA 4XRSA 1SFOJ 5ICFA 2HOSA 3ZMTA 2LUYA 1Z1DA 1WWXA 3J7AY 3HXLA 2G7HA 3ERED 1FARA 3L7WA 2VLAA 2KMQA 6PAXA 1Y0RA 3OYHA 4AYBA 4W9YA 4XNHB 5HXDA 4Q36A 4L5EA 4MGRA 2LH9A 2VONA 4V19K 2ZMEB 2JDDA 2R7UA 1PUAA 3FIXA 2Z10A 2M8GX 3HGGA 4HX8A 1TF8A 3DV8A 3GTJJ 1FIAA 1Z8XA 3IO1A 3GUXA 4CH7A 4A3CJ 2E2HJ 1IRFA 4JOMA 1A36A 2AFXA 4HV6A 1KUYA 2KFDA 3ZCOA 4C7IA 1YTPA 3P5JA 4OAZA 2FBKA 5HLHA 3VB2A 6CPAA 1KZHA 1GV5A 5C82A 2MLGA 2VBZA 3RO0A 2V1DA 1ZGWA 2GFQA 4V2FA 5D8KB 3A0HC 3OSFA 1OYVI 2JZMA 4KUBA 5H86A 3DCFA 3KL9A 4IRHA 2E34A 5KTDA 2E5ZA 4KOYA 3EUHC 4KOVA 1Y8RB 1TBQR 4JD6A 4UIAA 1JXSA 4F92B 5L3BA 1IF1A 3RZAA 1Y9WA 2B5GA 4GRIA 1XBUA 1G3TA 3CDHA 4HNXB 1I12A 2DFFA 2J5PA 2BUSA 3UNGC 5CLSA 2FNFX 1TW3A 2I5UA 2O3FA 2KRFA 1QSNA 1TWHJ 2B63J 2J5OA 2WVJA 4A3BJ 1X4PA 5EDNA 2IEKA 5EX3A 1YW7A 1B87A 1U9NA 1V54H 2EK5A 4HZFA 3NFZA 4B6ZA 3WHBA 3L1PA 1Y8QB 3SI2A 1HQCA 2QLZA 3CJTB 2VOPA 2JPBA 3KLOA 4MHDA 1BR2A 1J5YA 2BZTA 1WH7A 3EUKL 2JRTA 3CC4I 1B6BA 1VHOA 5CNPA 1IICA 2R7SA 2HVRA 3RAMA 3EUAA 2Y75A 4HSRA 4DYRA 4EGZA 4OC3A 4PJ0C 2VZYA 3VYUB 1IN6A 3IWFA 2P6SA 2PMZN 4D7MA 4XLNF 3H5RA 4HLYA 5HVQC 2HTJA 4DZPA 3G71I 1K7UA 3C2GA 4I98B 2Z3PA 3SEQA 1DPUA 3V38A 3GB0A 4HGUA 2ZB9A 1JJ6C 2Z9OA 2IGOA 1Z2LA 4PK2A 3MZYA 2XC7A 2ECCA 1MNEA 3HOWJ 1TWCJ 1Y1BA 2RAEA 1YRNA 1LPQA 1X1AA 3MAJA 3WTXC 1RESA 3CP8A 4ZJZA 1NE9A 2EK8A 1ACIA 3PQJA 4EEFG 2JVHA 4YFNF 2C1CA 3HUVA 3KP2A 3D5SC 2LBFB 2DA7A 5C3EJ 1KYZA 4L9MA 4NUBA 1D1BA 4KVME 2O53A 3H35A 2OTLI 2KPMA 1OJLA 2OD1A 2W25A 1LEAA 1OFCX 2W84A 4J19A 1B72B 1S7LA 1YW4A 1IN7A 1N77A 1F57A 1TNTA 4OIPF 1I21A 2MH9A 3DXJF 3LMMA 3MVPA 1R1TA 4XRFA 1ZYRF 2OA4A 2LKXA 1QQIA 1K78A 1ELLP 2F8HA 1WGTA 3FB3A 1JWQA 4MTDA 3M8EA 3S2WA 1YU6C 5JVGF 2G0EA 5CCLA 1Z9CA 3PQKA 2GREA 2VODA 1TQPA 5HS9A 5M3MJ 3JRDA 2JK3A 3NE8A 4ZY0A 2R7RA 1Y1VJ 3GTPJ 5GADJ 2XPWA 4IQ4A 3ELKA 3GVAA 3K70C 2GKVA 1SGYI 5H2FC 5M3FJ 3KP4A 1YO5C 1SGDI 5FUVA 1G3SA 3CCQI 3ISXA 3OWCA 2VI7A 1S29A 4ZYGA 5DD4A 4KITB 4ENKA 2ZFWA 3QP6A 4BU2A 5AG6A 3CC2I 3I53A 3DDDA 1S7EA 1TW2A 3WG9A 1R49A 5F47A 2JRMA 2GLJA 3BLYA 1TQIA 3OYMA 4P4EA 1IZ1A 2BGCA 4ENNA 2L54A 1FT9A 2UXNA 2MA3A 3L9FA 4HNVA 2HDDA 4CHUA 3GYAA 3KGQA 3BR3A 5JQ4A 2Z33A 4BBSJ 4BEHB 2VC0A 4FX4A 5E96A 4QWQA 2CUJA 1LAMA 4KOWA 4A33A 2ATRA 4RS8A 1P4AA 2LY1A 1PUEE 4GM5A 4C3HJ 1JKOC 3CT9A 3COAC 2IS6A 3PFEA 3BZKA 3PL8A 5IP6A 2J8MA 2ZXHA 1L3LA 4A12A 2KDOA 3Q0WA 3TOAA 4P44A 3H0DA 2OCCH 3HGYA 3LODA 3SQNA 1PUFA 3T8RA 3BG9A 2VKDA 4CCKA 3FC3A 2H5MA 4Y49C 4XPLA 3CO6C 2VASA 5GTIC 3PDNA 3FNCA 3WTSC 3F3XA 1RTQA 2I79A 3DPUA 3CMMA 2PX9A 4HNUA 2HWVA 2KHMA 3Q0UA 1CP7A 2DMUA 3VDUA 2VBYA 2DYSH 1M1DA 1TOTA 5K5OA 3VSKA 1Z6TA 1RO5A 2IP2A 1OQYA 4F0XA 1UAAA 1CJWA 2JBJA 3FEEA 3CJQB 3ROUA 1ZG9A 2ZJPF 2FEZA 1XGMA 2VBXA 1TKJA 4QPOA 4HDVA 4L0YB 1TP4A 3IWZA 5EZGA 4I0AA 3BOQA 3LACA 4RB2C 1HLVA 2TDXA 4C2YA 1ZG5A 3MQ0A 2KMOA 2XROA 3OYJA 2FOKA 4CS0B 1FIPA 1YLFA 3ABUA 2FXFA 2QMLA 4BE2A 4HQMA 1JUSA 2X6OA 3W6XA 4QPQA 4XLEA 3TBIA 2G9WA 2K86A 2TRTA 1W7PD 4AYBN 1PCAA 1MGTA 4J3GA 5AIPA 1S5KA 2PRQA 2C6YA 5L3GA 5KVRA 1HBXG 1IDYA 4MHNA 3BJ7A 3D67A 5EG0A 1CM0A 4FHTA 1GUUA 3M9AA 4L5JA 2M2EA 1YSJA 2JXDA 4QLCU 3RKWA 2WWYA 3F8BA 3BPVA 2WV0A 5FVJA 2ZEDA 3HH2C 2WUUA 3W91A 4RA2A 5G22A 2QENA 1SGRI 2AFOA 4NF1A 1VQOI 4MI4A 1U5KA 3PB4X 1WH5A 2ELIA 3K4CA 1R6RA 3IEHA 2EJRA 4BACA 1L0CA 1QBJA 5ERIA 1IY7A 3S1MJ 4ITVA 4F3QA 1ZK8A 1VQKI 5CJ9A 3WTUC 1EH6A 3SEZA 1FWZA 2JUCA 3HDDA 2JVGA 1A6QA 3BTJA 3TTHA 2OZHA 2VJJA 2W48A 2M1BA 2EA2A 4BQOA 2DF5A 2HKXA 4WCGA 1ETKA 1VQPI 1N13A 4I01A 4BE1A 1Y0YA 1RI7A 2V8HA 4DYOA 1I6HJ 2PJ7A 4ZH4F 5EEGA 3K2KA 2I8DA 5K8OA 1BOAA 5EBVA 5LYFA 2ODDA 1P92A 3NARA 5E3NA 2R7TA 5GTHC 1DP7P 4AVCA 4OC2A 4DNCA 5AG7A 2QCOA 2DFHA 4C2MJ 4JCVE 3H92A 5J1UA 4UVAA 3FHNA 2DA2A 4IVNA 2K5TA 3VEPA 4GCVA 4KOTA 3SI1A 1WJBA 4P4FA 3UFFA 4PK3A 4I2OA 2WB1N 3CJNA 5D4RA 2ZEMA 4HAMA 2PR1A 4ON0A 1OMTA 2X48A 2PJ4A 1R43A 4FE7A 1VTNC 3ZN0A 3M8FA 3J7AO 3ZQFA 4E7JA 4IJAA 1STZA 3DBRB 2RNGA 4PFPA 1H0MA 2H1KA 1MMAA 1XG1A 4WJBA 2NS0A 4JJXA 1OCPA 2FSWA 2Y2ZA 2XF7A 2QYOA 2V53A 2PRBA 3DKYA 2J87A 4A3FJ 5JI6A 2OB0A 1B9MA 3VYTB 1VIXA 1FSEA 4MY0A 2FE7A 1QZEA 4S04A 1X2NA 3KP5A 1TQMA 3BQYA 4BQQA 4UUSB 2M3AA 5F48A 1YITI 2M34A 1LVAA 1QZYA 3D8PA 1GXQA 1T0FC 4EMSA 2J9RA 4BHBA 2MC3A 4AIKA 2JA5J 5G1ZA 4ZYAA 1AHDP 2R5ZB 1OR7C 1R36A 2EFQA 3AL0C 3IWEA 5LRJA 1ZREA 3HOUJ 3GW2A 5HOOA 2JZYA 1A04A 3L2WA 2DDBA 3BR2A 1X4SA 1YGHA 2I00A 3FXTA 4UEZA 3KP7A 4AIJA 2LOOA 2DBBA 3SFIA 1YQAA 3O2PE 3S3OA 4E7ZA 2LRDA 2PFBA 4CGPA 2D1HA 3RZDJ 3BCBA 1S7NA 2JPCA 2LSOA 4G12A 3RCOA 5J4YA 4E1RA 1Q2YA 2XF6A 3RPUD 3BTLA 2CTCA 4HLXA 3CDXA 2R7XA 3MCZA 3FBNB 1XMKA 3E6CC 3G3ZA 2FS5A 2VB6A 1SANA 2AO9A 4ZTJA 4A24A 3QU3A 1Z05A 4X6AJ 1FT7A 5GAGJ 3OYGA 5LRSA 1RKTA 2DT7B 5L3FA 3DLLF 3FRMA 4KVOE 1DP3A 3H0GJ 3K70D 4HSTA 4GS4A 3OL3A 4HKFA 4R6TA 3I58A 1O3RA 1CGJI 1TF9A 2CYYA 4ZTFA 1PTRA 3IWGA 1WK4A 2A68F 2K5CA 1MBGA 3H3ZA 1ITYA 1M4IA 4E6KG 3PBEA 1N75A 4RMNA 4F52A 3HPGA 3DNSA 3KR5A 4A3MJ 4BUPA 2DK5A 5IY5H 4IL6C 2V8DA 3PGPA 1YE9A 3OOPA 1MBEA 1F43A 2WCYA 2GA1A 5LEJA 2GE3A 2V8GA 1S72I 3OYAA 3S14J 3IWWA 2AJ6A 4D5FA 2VPRA 2X51A 4UWIA 4EM0B 2EIJH 3E3VA 4HF0A 1Z4EA 3CZXA 3D3SA 4IHVA 1W5CC 1IV6A 4G7ZF 2HOEA 2Z3LA 1B1BA 4G7OF 3R9EA 4KOSA 3MGDA 2A69F 3CXQA 4EWTA 1JGSA 3GFLA 3WODF 4FQGA 2DI3A 2V1CA 5LYDA 1HXDA 4UFXA 4EJOA 4AIDA 2ME0A 2E60A 3V8LA 4G6QA 3KYLA 1VDDA 4QB9A 4EVIA 2YPRA 4LGWA 1TBRR 1XDUA 1XMTA 2ZOGA 4UB6C 5DS9A 4F9UA 2C6GA 2DLLA 4OIRF 3MWMA 1ON1A 4NC7A 4A3DJ 4UEFA 1PU9A 3U1DA 5LHIA 4Y17A 3F8CA 2KKOA 3P9CA 2CWFA 2FMLA 4FKDA 1TZLA 1V1IA 4PXCA 3QAHA 4KMUX 5H6QA 4II3A 3BP8A 1FTZA 1BJAA 3NH5A 3P2HA 2FRHA 3FM3A 1O7FA 2VXKA 2ZEOA 3BT9A 1P7JA 2HDWA 4E7LA 4BY1J 2VOOA 4OC4A 4O5VA 2E19A 3F6VA 3N05A 5CKTA 3TO6A 2MD0A 3E6MA 2Q04A 1KQ9A 2R4GA 4EVYA 4M6XA 4UWJA 3I4PA 1L0OC 4L5IA 3HHHA 1IU8A 4HA8A 1FY7A 2IPQX 3R96A 3MKLA 2CWHA 4BEHA 4XSZF 3C26A 3FEDA 2K9LA 4MFDA 4CZZA 1BAVA 5HS7A 2VQGA 1JJ8C 1W4RA 5J3LA 3LA3A 1H0ZA 3GFMA 1GVJA 1WFXA 2EPFA 3OMYA 3EUHA 4AG7A 5L3EA 2HYGD 1O3SA 1UELB 3BROA 3ZMVA 1XDSA 2KMPA 2MD5A 2NVXJ 1TWGJ 3R6SA 2PJ1A 2CFOA 1IGBA 4XPDB 2XRLA 3QRFF 2GM4A 2R98A 1PJRA 5D5UB 3JRAA 5E3OA 4EM1A 2F48A 3I55I 3FF3A 2P81A 3L00A 4ZYDA 1BI1A 2QQAA 3BG5A 2J9AA 1P7IA 3I9SA 4F55A 3AAFA 1S8NA 2YNCA 2LKSA 4MHYA 4E7KA 3R1KA 3CXLA 2Q4YA 2LC2A 3HM5A 3CCLI 2COBA 2PVVA 4RAZA 4AIHA 3MZ8A 2PCUA 4CAEA 1V55H 5EJCA 2ZW6A 2Q7BA 3VOEA 1ULKA 1E2XA 2R5YB 2M4GA 2FCKA 2JLMA 5B66C 4E1PA 4FD4A 1IXSB 1Z0XA 2PJCA 2O9LA 2F4MB 2WTEA 4G6TB 5A2QK 2Q44A 3KASA 4XKBA 1X19A 5IOZA 4F7ZA 2NU1I 4CAFA 3JRCA 3EXNA 2JWTA 2ZEHA 1OPCA 1ONVA 2FXAA 1VQLI 4LITA 4AMLA 3H36A 3SJEA 4HF2A 5FROA 4BXUA 3BY6A 5JHUA 4KT5C 5K7HA 3DF8A 2V9VA 1SVOA 2YUSA 2DOEA 4MIMA 1N25A 2HTSA 2EK9A 2LBFA 1D0ZA 2RQPA 3I9V2 2XV4S 3CUOA 4M3GA 5K7ZA 4YELA 4H89A 2OQRA 3RKXA 2CF4A 1KQ0A 2K7LA 2VE8A 3ECOA 2E1MB 2CJJA 3V7SA 1YRNB 1HDUA 1SAXA 4OLLA 3CXSA 4OP4A 2CH0A 4WXHA 3H8EA 2BSWA 2P5KA 3F21A 3WC7A 2QUFA 5EEAA 2G3AA 1FOWA 4K3NA 1M4GA 2FMYA 1B9NA 2AXLA 4DJLA 4Q38A 3B7IA 1UCRA 2PVWA 3A1YA 3WGIA 1XFOA 3IP4B 1BR1A 1LDKB 2R7QA 3D0SA 5D5VB 1U8BA 3B3TA 2B4DA 4P96A 1IDZA 1MJBA 3KYDB 3TGNA 4LG0A 1IRXA 1JHHA 1Z21A 5F27A 2DW4A 3X2QH 1TIHA 1IOIA 4A31A 1X3ZB 1EA3A 2W4SA 1FYBA 1R58A 3SHPA 5BMZA 4RGRA 2DB6A 1BI0A 1KU2A 1ZAOA 5J1QA 4XK4A 2CNSA 3HIFA 3GKRA 1XSDA 5DS0A 4A3LJ 4RGUA 4FE4A 1DU6A 4RM3A 3D00A 1BO4A 1K83J 2QSFX 2V1NA 3BR5A 3LQQA 2XAJA 3CMYA 3CLOA 2XPUA 3S1QJ 1Q2DA 4WK8F 2YR2A 3KR4A 2P5LC 4YFJA 5HDNA 4ZDLA 2Z3OA 4IOCF 3ASOH 2B5GB 4PV6A 2I3CA 1KGSA 3P9KA 2HXIA 1AKHB 1ZTRA 4MHGA 2BY3A 5C4JJ 3G3SA 1K79A 3Q9VA 1ZGJA 3HOXJ 2LD5A 2VUMJ 2X7BA 3CD6I 2P6TA 3DBLB 1KWMA 4KSAA 1HPTA 3KE2A 4XLCA 1Y1WJ 2ZEFA 3TX8A 4CYNA 3TMOA 5LHHA 5F0CA 5JGFA 4QUSA 4UV8A 5DUIA 2R7FA 3M1EA 3OIOA 4XKCA 3S17J 1XSXA 3RJPA 1R9TJ 2OQGA 2Z2SB 4RM2A 1QZZA 2F4OB 1MSFC 1BLLE 2QQEA 2EIKH 2GU2A 2PEXA 3FVLA 5HS8A 3D2MA 4CYOA 3BI1A 3PFOA 2Y0SA 3IL2A 2M5XA 2ZW4A 3SXOA 1YW9A 1T39A 1T0FA 5DM7F 1I1GA 4ZYEA 2X0LA 2QSHX 2P0WA 4HG2A 1TURA 2QQCA 1ZG7A 2E1MC 5TISC 2IS1A 1HCRA 4ONUA 4OIQF 2DN0A 2DMNA 5DV5A 3RPUA 1VFCA 2L7XA 3CPXA 3ASNH 3ISPA 1U6GA 3LFKA 1ARLA 2H94A 1G2HA 4KZTA 1MNMC 1X4OA 5HQ8A 3OYNA 4KICA 2EFNA 5J6XA 2Y0SN 3PFYA 2ID3A 1J09A 2ICWG 2BHYA 5D6FA 4OINF 2L9SA 1VQ9I 3AG1H 1HC8A 4EJUA 3E0KA 2WAQN 3MKZA 3F5BA 2K02A 1BJZA 1OCOH 2QZ8A 5K8PA 4MRIA 4B47A 4PSWA 5M5YJ 1Y1CA 2NVUB 4RS2A 4KOUA 3E5UA 4R57A 3VATA 4M9XA 2H6CA 5D29A 4MFQA 3CCVI 1Y39A 1A6IA 2W0TA 2B0LA 3BR1A 1ZRFA 4CGMA 4XR6A 3SGQI 1IXCA 3GLLA 4FASD 4KSIA 4L89A 3MEKA 1WTJA 2RKHA 2STWA 2CWGA 4ZY1A 4EMEA 1ULYA 4M3DA 1P4NA 2CV1A 3ZQGA 1WJDA 2HQNA 2K27A 4Y3OA 2X85A 4U7BA 2O6GE 1CSOI 1ELMP 4MFLA 3S6FA 4A37A 4MTEA 3IKTA 3MN8A 1WCMJ 1I6XA 2IA1A 3TOBA 2DQRA 2PMUA 4CRZB 1USSA 3CQZJ 1D0YA 4KN7X 1BI2A 4GDFA 5E18F 5IT9Z 2MW8A 1YJNI 5KTCA 1R5GA 1UHWA 9ANTA 1WJAA 5BNGA 4AWXB 3KETA 1SGEI 1UFHA 1FNOA 3G8WA 2D1VA 3KX2A 1WI3A 3L2VA 2OTJI 1JQGA 1VHSA 3CZ6A 2ODFA 2O0YA 1RRJA 1HOMA 2DDAA 2R5ZA 2OZ6A 2G0BA 4HNYB 4MCPA 2X6YA 1F2OA 5LYIA 1V4RA 4BXFA 2BCOA 1P6RA 2QBYA 2H6BA 5HLTA 4LUAA 3DU5A 2L9RA 2PMHA 4KT6A 4YIRX 4NEXA 3DLJA 4X5KA 2GA2A 2EILH 5EG0B 1XPXA 4OIDA 4QVTA 1LE8B 4ZYHA 1FBUA 2L0KA 2EQRA 1ULMA 1KUXA 3UGLA 4CAWA 3WE2A 2D2WA 2NVQJ 2KLOA 1VQNI 1CGPA 2CUEA 5BQTA 1KUVA 4UXHA 3H8FA 4BDZA 2SGPI 4U0VA 4OIOF 1HW1A 1S7FA 2VJIA 2EBIA 4XORA 1Y56A 2YNCC 2A4NA 4XRSG 3CC7I 1SAUA 3GFIA 5J8FA 4TWEA 1KONA 3KZWA 1K4SA 4B13A 5EEHA 1R3NA 2DJIA 3FSYA 5EF6A 1O4XA 3S9LA 4HX4A 4RDUA 8CPAA 4M74A 1R23A 3D5LA 3BCAA 2FF4A 2KL4A 3JRIA 4IHMA 5G21A 4R9MA 4MJ8A 4IRIA 2M0CA 1XF8A 2R93J 2GXGA 2N8GA 5DCMA 2BXYA 2GLOA 2VKHA 2YNEA 1OVOA 1LVKA 4RBOA 5B5EC 2V1CC 1UHMA 1LDJA 1UG2A 2UVOA 1UHAA 2QVOA 1WJEA 2L01A 5ILVA 5IYDJ 2MABA 1SD6A 1OISA 2XSJC 1Y8FA 4OADA 4NQWA 3C1DA 2OH1A 2XRCA 1RC9A 4M6VA 2R1IA 2YX4A 3H5AA 2CO5A 2ADUA
chains in the Genus database with same CATH topology
3KLNA 3REOA 3VFZA 4M9SA 5ISVA 1ZO0A 4GYIA 2XHKA 1RZ4A 2WSAA 2DK8A 3SHFA 2FBIA 2O03A 2XAHA 1CF7A 3I5UA 1FSHA 5AIQA 4P5OA 2ZXVA 1MJAA 1FOKA 3WTWC 4UVBA 4C7HA 2IVMA 4CGNA 5E1WA 3TCVA 4KDPA 3S6GA 4HX7A 5CVUA 3DP7A 4UFVA 1W5SA 4LX9A 1TBXA 4LFUA 3ZMSA 4I7HA 4LMYA 4U9YA 3IRQA 2EV6A 3QPTA 2P7VB 3EYYA 3T9YA 4CAXA 2NMTA 3C7JA 2DQLA 2P4WA 3GF2A 1RUOA 2JDCA 2HR3A 2LF8A 2A3SA 4HQEA 3WTZA 4R3KA 4JK1X 2HDCA 1BI3A 3BLNA 1X3UA 2HQRA 1UFMA 4B10A 1DDNA 2H09A 1FC3A 3JSPA 1QSOA 1PP8F 4NXYA 4AB7A 4CYPA 3EO4A 3R9GA 1IN5A 4G8XA 1BIAA 2PG4A 3KFWX 2CGPA 4YFXF 3GLXA 3HSFA 2CG4A 5ILSA 3FWEA 1T2KA 4A5MA 4BNCA 3FM5A 3EC4A 5CYVA 3DSBA 4RAYA 4KLVA 3WTTC 1IYLA 3SXYA 4YIFA 3WR7A 2JSCA 4A0YA 3WTYC 2EFWA 5AG4A 4A2UA 2LNBA 4UHTA 4M73A 1R22A 4U5YA 1N71A 2B58A 1C0WA 1WWZA 2FNAA 3O3KA 5LHGA 4H6UA 3VWEA 3TQNA 2ZJ2A 5ICGA 3L09A 5H84A 5TRDA 2ETHA 3TDZC 1SMYF 4LLGF 5IB0A 3PP9A 1YVKA 2XASA 4UCNA 1ON2A 2EWNA 2KIUA 5FGMA 3CUQB 2STTA 4MFKA 1U3EM 3K9UA 5AG5A 1IW7F 2B3VA 3R0AA 1XE4A 1XB4A 4UVCA 1B4AA 3DFGA 5D4SA 1LNWA 3ZP5A 3FMRA 5IX3A 3FMSA 1H9TA 3V8KA 4N0BA 4LB5A 2YNDA 4KVXA 1ZGAA 4O6JA 3RYOA 4C68A 4B11A 4NSQA 1LB2A 4UXNA 3P9IA 2GANA 3IU1A 2REFA 2DT5A 4E2AA 1J7KA 3T8TA 3P7NA 4OMZA 1CF7B 2FBHA 3EQLF 2VQYA 2WC2A 4ORFA 4Q5SF 2P6EA 4Y49B 4CXFA 3K1NA 5FD6A 3RIRA 1U8RA 3K2ZA 2HV2A 2V79A 5DWMA 1BM9A 1SFEA 4IF4A 2DTRA 4NHJA 3HRSA 5G20A 4F6AA 1UB9A 2HKOA 4MFPA 2R7HA 1IYKA 1YX0A 1XGOA 1AWCA 3LWFA 3F72A 5AONA 2COMA 1R7JA 2IA2A 3HYIA 4FD6A 4HF1A 1REPC 3T1BA 2FIWA 1LRZA 1FYKA 4PGGA 4CAVA