2OZUA

Crystal structure of human myst histone acetyltransferase 3 in complex with acetylcoenzyme a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
253
Chain Sequence
RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQSIKKLSKLTGICPQDITSTLHHLRMLIRREKLIQDHMAKLQLRPVDVDPECLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase MYST3
publication title The crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 253
sequence length 270
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ozuA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2ozuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ozuA02
4OIOF 1D5VA 2L3DA 4RAZA 1T0FA 2ACJA 3IRRA 1IRFA 3R1KA 2R7DA 4F6AA 1ZRCA 4P55A 4P9FA 2D2WA 2JPCA 4A5MA 1HSJA 3TO6A 4TV7A 1S3JA 2XIGA 4LD5A 3HRTA 4L18B 2CG4A 2PLYA 4UA3A 2QQ9A 3V8IA 4R9MA 4YG2F 1U6GA 2A3SA 1N71A 1WKMA 2O6GE 2OZUA 2HWVA 3S6KA 3VODA 1QGPA 4M73A 3K9UA 5J6XA 4MI4A 3NE7A 3GEZA 3W6KB 2QQAA 3J80K 5L3CA 3T0YA 1LNWA 4MBUA 1IB1E 1LDDA 4BHBA 3TOBA 5D5WB 4Q5SF 4L0YB 4AVPA 2NYXA 1FZPB 2YU3A 1G3YA 1T39A 3V7CA 2VZZA 4HX4A 4KVOE 2IPQX 4MNUA 5TRDA 3VFZA 1W7PA 3FM5A 1TLHB 4G7ZF 3SHPA 3G3SA 2EK5A 2G3TA 1BM9A 1JE8A 3DR6A 2FS5A 4R79A 3LA3A 1IN6A 1MJ9A 3BROA 1K6OA 3PGPA 3KLNA 2M1BA 3K1NA 4NXYA 4MEXF 1B1BA 3TOAA 2K86A 3SXYA 2CQKA 5CVJA 3TT2A 1IRGA 2IA0A 2NNNA 1YTYA 2DBBA 3S2WA 5F64A 2OD5A 2YSRA 1BI1A 2CY2A 1YVOA 2B3UA 1XSXA 3BY6A 1RI7A 3C3WA 2ZJ2A 2XROA 1I1GA 1J2XA 1RO5A 3E0KA 3E5XA 3HSRA 2P0WA 1GXQA 4FD6A 1XE4A 3E6BA 5HLIA 3QAHA 2P6GA 2RC4A 1O57A 1B9MA 2O61A 2J8NA 5IB0A 3R95A 2MLGA 1IIDA 3ZMZA 5HS7A 3M9AA 3QRFF 5LRRA 1M4DA 1AWCA 2DPUA 2GXGA 1OPCA 2KIMA 3DNSA 4KIFA 4CYDA 3IKVA 1ZRFA 3IGRA 2DAOA 3GFJA 3KZZA 3LA7A 2OZGA 2LNBA 1BC7C 3JAMZ 4R8HA 2R98A 3E3VA 1MZBA 3ZP5A 5F46A 1I6XA 4KMUX 2ZXJA 1OYWA 2DT5A 1TNSA 2Y48A 4LLNA 3FNCA 1S29A 3FHZA 3BLNA 3TQNA 5KK1A 4O5VA 2FBHA 2F5FA 3HHGA 3T9YA 2F5EA 4RGSA 2OB0A 4XNHC 2VXZA 1PP8F 1FYKA 1LEAA 1BJAA 3WTXC 2FCKA 3KFWX 4CAXA 3KP5A 1U78A 1ON2A 3KEQA 1QSMA 4ZBGA 4HZFA 4OADA 4A6DA 2J5PA 1ZG5A 2O28A 4XPLA 2Y0MA 1KGSA 2EUIA 5H84A 5DD8A 2XGXA 4F0YA 5CJ9A 2XASA 2HEOA 3W6JB 2RNJA 2FL4A 1FC3A 3O2PE 1FP1D 4G94A 2W25A 4WXDA 5E8IA 1MDMA 1KUYA 2VBQA 3GWZA 1IW7F 3T8TA 4XLPF 1H9TA 4KOUA 3WTSC 2OQRA 1YW7A 3WGIA 3F23A 5FFXA 4R1HA 1W7PB 3R96A 4DQ2A 3G3ZA 1ODDA 3WE2A 5FVJA 1J0RA 3W6XA 1R1TA 3R6SA 1ON1A 2NAZA 4I0AA 1Q1HA 3OOPA 3R61A 1V3FA 4Y49B 5CYVA 1IZ1A 2PJPA 1XGMA 4EMSA 3LFKA 2ADUA 5LRSA 2NNYA 3L09A 1QQIA 1MK4A 3RKYA 3RDIA 3MFKA 4PV6A 4UHTA 4OMYA 4EV0A 2G0BA 5E1ZB 1M4GA 5EBVA 1YYVA 1RXTA 1SD5A 1PUAA 3QOPA 2RV8A 2V1XA 5D8KB 1MJAA 2P5VA 4I09A 2GA2A 4FD4A 3F3XA 2K7LA 3FM3A 2P8TA 5CVVA 4HNXB 5HVQC 4N9HA 1Q2YA 4IXAA 1IN7A 4ZH4F 1KU2A 2VN2A 3P9IA 1WSUA 2HQRA 3LQRA 5CVIA 1NHAA 3K0LA 4I98B 3D8PA 2YPRA 3JVNA 4UXNA 1ZREA 3BP8A 3FMQA 2XV4S 3M1EA 3HUGA 2W84A 1YS7A 3CUQA 1YX0A 4WX9A 3KLOA 3WTTC 3RIRA 2X0LA 1KYZA 3WTYC 1BOAA 2ZCWA 3SFZA 4S05A 4HNWB 3UY5A 3HHHA 1MD0A 4AIJA 3G73A 6PAXA 1K78A 3S6HA 3MWMA 3DQVC 1OR7A 4X5KA 1SQHA 3CDHA 4UWIA 4YGOA 2LDUA 2R1IA 1ZLKA 2DQLA 1U5TC 3PFIA 3HTSB 1I5ZA 3ML6A 4LGWA 2VBYA 3GFMA 4ZZDA 2RVCA 2Q4VA 2MA3A 2ZBKA 1GHEA 3KP4A 2GWRA 3CJNA 4KN7X 2J5OA 2GE3A 2PI0A 4HAMA 1I12A 4DNCA 2HZTA 2L01A 2PR8A 5AIQA 3LWFA 2F5IA 3BJ7A 5EC4A 1XDSA 3FMRA 1HSTA 2HOEA 2JRTA 3CO6C 1XN7A 4NQWA 4CAWA 3WTVC 4CHUA 1LEBA 4O6JA 3LSTA 3VWEA 1V0CA 4A12A 3DDDA 4KOXA 4PSXA 1WK4A 3I71A 4ESFA 4MQ9F 2F2EA 2EV0A 5EEHA 3GVAA 1MKMA 4QC6A 3MQ0A 2COMA 4BNCA 3IRQA 4R57A 1A04A 4K30A 3GO5A 1P2FA 3R0JA 4GXOA 1YK3A 2HR3A 3L00A 3DEUA 2BEOA 2STWA 1EH8A 4OMZA 1D8KA 3V7RA 2DI3A 4R3LA 4KOVA 4XPDC 1H9GA 1BI0A 2B5GA 2XVCA 4NB5A 3L9FA 2A4NA 1ZH5A 1ZN2A 2MBFA 3ZN0A 1TW3A 1HW1A 2A07F 4Z2YA 4MY3A 1DDNA 3TFYA 3COAC 2IA2A 3PQJA 5HH1A 1ZLJA 3SXNA 3MGDA 5GCNA 3GXOA 5HMNA 2M5WA 2REEA 1P6RA 2DLLA 3EYIA 5CLSA 4KT5C 3CUOA 5J8FA 4HYEA 2WWYA 3O3KA 2PG4A 2GIVA 1UB9A 2VODA 1JHHA 5J8CA 4EM1A 2A61A 3GX4X 2W57A 3EUHA 4N0BA 2IL4A 3F8BA 3F6OA 3TO9A 5FO5A 4CO8A 1I21A 3CUQB 3GYAA 2GQQA 2BBYA 2OQGA 3QPHA 2KJBA 1B9NA 1JGSA 1YFHA 4R87A 5FD5A 3EY5A 1K78B 4A0ZA 4JD6A 4ZYGA 4Q4ZF 3OV8A 1BIBA 2Z11A 2OH1A 4YFKF 3SZTA 3MCZA 4HQEA 4KOSA 1UFHA 1SFUA 2HKXA 2JZYA 1OYIA 1J5YA 2P6SA 4K2EA 1IXCA 2OZHA 5L3DA 1YW9A 2VQYA 5FLXZ 3RI4A 5DEQA 4EM0B 2L02A 2XAHA 3T1BA 4WXHA 3L2CA 1C0WA 3I5UA 5LHGA 2D1HA 2E7WA 3D3SA 5HDNA 3N7ZA 2OA4A 3HRUA 3TDZC 3GKRA 2P7CB 4YRHA 2YR2A 2P5KA 2FEZA 5IT9Z 4HA8A 3CXQA 3D2PA 1QSRA 4CRYB 2FSWA 1SFEA 1UHMA 1IAWA 3R4KA 3FB3A 2EFQA 4Q47A 2K27A 1TW2A 2ZNZA 3NEUA 4LLLA 5CVUA 3W91A 2RKHA 4RGUA 2MLKA 3JUWA 1Z05A 5F1RA 2QYOA 4KUAA 1S7KA 2ETHA 2B5GB 3WTWC 3WGHA 3WODF 4UV8A 2FT0A 4HBLA 2PMUA 3I54A 4XSXF 4G9YA 1O3SA 5L3EA 2Z99A 5KTDA 4ZYDA 1FBSA 3QPTA 4GYIA 1OKRA 2VXKA 1CGPA 4BHPA 4HF1A 5C82A 3GW2A 5ERIA 2HYFA 3C7JA 5KTCA 1REPC 2EA4A 1K79A 1QSOA 1OMIA 2P6EA 1LB2A 5DUKA 1U3EM 1Z6TA 1DUXC 4M72A 4KDPA 4AG9A 2A6HF 3LQQA 1R00A 5D6EA 4N9IA 2CSOA 4U0VA 5A2QZ 4BYYA 2P6FA 3P2HA 2BEIA 3F72A 1XSVA 2V9VA 2VT3A 4IPAA 2REFA 4F7ZA 2PN6A 1ZARA 1VKCA 1XEBA 2K5TA 1UCRA 3WTZA 3EO4A 2DQRA 4QBJA 3JTGA 4I0BA 5ICFA 2LF7A 2OU2A 1Y0UA 4FX0A 3WU0A 5F6FA 4I01A 5E20A 4NCZA 2FU4A 4UNOA 2FXFA 1YQAA 4FX4A 3NQOA 1R57A 1TTYA 3JTHA 3S6GA 2XKOA 3E6MA 4RB2C 2ZKZA 3DF8A 2UXXA 2DK5A 2EB7A 1BBYA 5ICEA 4LB5A 5JFRA 3JAMK 4KIGA 5LEKA 4H6UA 3LAJA 3GYHX 4KN4X 1IXSB 2C6YA 2HQYA 1RNLA 4CGZA 5ICGA 1KUXA 3KEOA 1I27A 2V6CA 3DSBA 3KKWA 2MC3A 1FX7A 4L5JA 3HOSA 2CWEA 4WF2A 1HBXG 1HXDA 1CJWA 5ILSA 1QO0D 3WR7A 1F9NA 3IWZA 1BIAA 1T98A 4IRGA 1YG2A 4S04A 1XGOA 4LB6B 3S6FA 3D2MA 1HKSA 5DWMA 5JR3A 4L9JA 1XGSA 3FX3A 2JEVA 5HLGA 2XUBA 3ECOA 1R7JA 3ZPLA 4FHTA 4ZZLA 2A69F 2GXBA 4PGHA 4EVIA 3ERED 1NMTA 4AB7A 4ESBA 5C88A 4PGGA 4E8OA 2FMYA 2HFHA 5F49A 4H89A 4M3SA 3L7WA 2JDCA 1XCVA 4YFXF 2NS0A 2QIRA 4M71A 3ZN1A 3EC4A 3GFIA 3I53A 3NRVA 2VI7A 4ETSA 3F8MA 1J7KA 1CF7B 3VOEA 1Q2CA 1P4WA 4GYGA 1IN8A 2H94A 2WV0A 1R58A 4A2UA 4IHTA 2H27A 1Y9WA 4RB1A 3D5LA 3T90A 2L4AA 5JHUA 1S3ZA 1G6NA 1ZAOA 3DPLC 4XSZF 3E6CC 3FXTA 5JQ4A 5HS8A 3H4QA 1U6MA 2JDDA 2XAQA 2DO7A 3B02A 2H6BA 3TO7A 1FYMA 4PK2A 1ZG3A 1TQIA 4U7BA 4KOYA 3CXSA 1NE9A 5K1YA 4PSWA 2CNMA 2DXQA 4KOTA 4KUMA 1SAXA 4HQMA 3J81Z 4B5OA 2ZW4A 3Q9SA 4H0EA 1T2KA 3RYRA 5IT3A 3LA2A 3W6SA 4RS8A 2Z3YA 4HLXA 4GO1A 1J9IA 1D8JA 2LF8A 1YREA 2ARHA 2OBPA 1W5TA 3RKWA 2G3AA 3TKYA 4OU0A 1XB4A 2ESHA 4E2AA 1FOKA 4PCQA 1U5TB 2WPWA 1FBUA 5LGNA 1J4JA 2PFBA 2HTJA 4L8AA 3WE3A 2D1VA 4CS0B 2QZ8A 5ILUA 3ZZIA 4MHDA 4UWJA 1Y7RA 1KU9A 1SD4A 4IF4A 2JT1A 4ON0A 5FGMA 3E6DA 4ASNA 2Q44A 4KVME 2P4WA 3B8GA 5HLHA 1RIOH 5D5VB 3Q5FA 2FXAA 3K69A 5BPDA 3GFLA 4Y13A 2I79A 2KIUA 2O3FA 3I0TA 1GXPA 4KORA 4OLLA 1USSA 5BOXA 1O7FA 3ZMTA 5D5UB 1Z6RA 1YLFA 1Z9CA 2BL1A 3KP2A 1FT9A 4M85A 3HTUA 1XMTA 2MH2A 2XKPA 3CTAA 4P96A 1IN5A 2MD5A 2GZWA 4QVTA 3EFAA 5KTAA 2EJRA 4PDKA 5L3GA 2BSWA 5LBQA 3KP3A 2A6EF 3BJ6A 4MY0A 3I4PA 4KIBA 2LKPA 1P4AA 3REOA 4HX8A 2DPDA 2M8EA 5DYMA 4IVNA 2HUZA 1J59A 5K5RA 3VWDA 3EXNA 3E5UA 1FLIA 2YX7A 1G3SA 1E2XA 2KIFA 4XRFA 5L3BA 1TQMA 5LGUA 3CO7C 3LODA 4KLWA 1L3LA 2ZMEB 1IYKA 1KQ0A 4BAYA 3U9GA 3P9CA 2FBIA 3BJOA 2Q04A 1G3TA 3TE4A 4MGRA 4HF0A 2Z10A 1B6BA 1MGTA 3ZMVA 4I02A 3VB2A 4AD9A 3F5BA 4Y15A 1FWZA 1VTNC 4KICA 4L9NA 1USTA 1Z4EA 2HYGD 1BO4A 2M87A 2QWWA 2X4HA 3ABTA 3H3UA 3RTRA 2ZFWA 2OAZA 1KU7A 3M7GA 1IN4A 2MH9A 2Q7BA 4MTDA 2UZKA 4AIKA 4M74A 4MQVA 1HKQA 5FLXK 3BZ6A 4HV5A 4EGYA 2Q8KA 2R7FA 1QSNA 2Q4YA 2L54A 3R9GA 2HKOA 2IA1A 5IX3A 1FY7A 3K1PA 2D4PA 3V8KA 5IT9K 3HRSA 1AOYA 1F1ZA 1PUEE 2WC2A 1YIOA 2ISYA 1XIXA 3P7NA 1ZHFA 5LEJA 2C27A 3FF5A 1B4AA 4IRHA 2E1NA 1LDKB 1XMAA 2PQ8A 1S7AA 4FD7A 3AAFA 1W7PD 4KOWA 2IT0A 2BYVE 5L3FA 2G9WA 4WCGA 1XD7A 4AG7A 1YR0A 1FBQA 3PP9A 4MHGA 3RKXA 2PSWA 4LLGF 4RI1A 1WRJA 2QENA 3FYNA 2XAJA 5DDGA 1B87A 1PU9A 3FIXA 3ELKA 2G7HA 4QLCU 3MAJA 2DTRA 2F5CA 1SFXA 3I59A 4OINF 4OAEA 5I0CA 2QQBA 3ISPA 5HDKA 2EVNA 3T8RA 4JBAA 1TIQA 5IV0A 1O3QA 2ZO4A 2NRAC 4BHCA 4ENJA 3ABUA 1SD7A 2GAUA 2VZYA 1IF1A 1V4RA 2B4BA 3IL2A 1YO5C 5A2QK 4J3GA 2A5YB 2ZPAA 1XSDA 4I49A 1LJ9A 3E5QA 4NEXA 2R3SA 3DR8A 4KZTA 4KLVA 2FIAA 4KNYA 3JSOA 2FF4A 1SD6A 4OOIA 3ULQB 3BPVA 5HOOA 3MZYA 1NSLA 4LX9A 1R5GA 4FT8A 4EM2A 4ZYHA 1ZRDA 3F0AA 1XDUA 3QP5A 4P5OA 4KYWA 3R60A 1BI2A 3FXQA 2ISZA 2VBZA 3M8EA 1B6AA 5LHIA 4CRZB 4YFJA 4CAVA 1KYWA 2PR1A 1KZFA 2PMHA 3P2FA 1HKTA 1S7LA 1QPMA 3CUQC 2IW5A 3FXUA 4G6QA 1FSEA 4L5IA 2B4DA 3DV8A 4RGRA 1K7AA 1S60A 5DCMA 2VBXA 1EV7A 1O7LA 4MTEA 5DUIA 3J7AO 4U9ZA 4L9VA 1CF7A 4CICA 5ISVA 2AS5F 2XHKA 4GS4A 5CVRA 4IUSA 5E1XA 2QBYA 2ZW6A 1ZG1A 1S8NA 2FE7A 2JLMA 1GVJA 3KE2A 2O8XA 5BPIA 5BS6A 4L89A 5H6RA 4CDGA 3TDUC 2PDOA 1RZ4A 4LG0A 1P4XA 3E97A 2HGCA 2DFIA 1QSTA 1W4MA 3BPXA 5E18F 4JJXA 1UHWA 3WTUC 5JVTA 5E8GA 3FZVA 3PZJA 1FPQA 2O03A 4B5PA 1WQ2A 3KCCA 3KP7A 1STZA 4HLYA 3V8JA 5K5OA 4ESJA 4QUSA 3N97A 3GZ6A 1LDJA 1MJBA 3C18A 2KJCA 4HDUA 3IWGA 3MEXA 5F48A 4D0PA 4LK0F 1WWZA 2QMLA 2CYYA 4EJOA 2K02A 3TTHA 1R5HA 1DP7P 2EFOA 3KP6A 3I59B 4YFNF 1GHCA 3JW4A 2PBIA 4A0YA 2B58A 3CXPA 2B3VA 5CNPA 5E96A 3LD2A 4JWPA 4MJ8A 2VEZA 1EH7A 1D3YA 4XLNF 1Z9UA 3DP7A 3I58A 3T5XA 3WG9A 4IRIA 3ZJ0A 4E70A 4WWCA 4OIRF 3HIFA 2VC1A 1Z1DA 1U5TA 2RGVA 4XNHB 1J75A 5ILVA 1IXRC 1R1VA 4A6EA 3R9FA 1BC8C 2EWNA 1SMTA 2XRNA 3R0AA 1YW8A 4LFUA 4OIQF 2F5DA 1VHSA 2G7UA 2ATRA 3IWFA 2H5MA 4CXFA 3F8FA 2EFWA 1H0MA 1ON0A 1Z4RA 4U9YA 2VONA 4RB3C 4YIFA 4KA4A 2E1CA 3IC7A 3U2RA 3ZQ7A 4RGXA 1I1SA 4KVXA 4ORFA 2EV6A 1KA8A 3GF2A 3QB8A 4G7HF 3J81K 4BXUA 2M45A 1ZGAA 3HOTA 1B59A 2WTEA 1YLEA 2B4DB 3J80Z 2W85A 4U7DA 1LVAA 5DCMB 3F22A 3RYOA 4WXCA 3Q9VA 2VOPA 3DKWA 1HQCA 3F21A 2V1DA 3V7SA 4HX7A 4M9SA 4XBFA 2QBYB 5K5QA 2X7BA 3KZYA 1M4IA 1S6LA 2IJLA 3WU1B 4EJUA 4M9XA 1QZYA 4FD5A 5DCFA 2FNAA 3C26A 4O3MA 4AWXB 4GGGA 2LSOA 2FRHA 4LG0B 4G6DA 4UVBA 2JTVA 1OZPA 2ZXVA 3F6VA 4Q48A 4MEYF 3G8WA 1R22A 3R9EA 1Z91A 5HS9A 4B5PB 1KQ8A 5E17F 1LQ1A 2M30A 2AJ6A 4HOBA 1HW2A 4GCVA 4U0WA 3FBUA 1PDNC 3FXRA 2VE8A 4HNYB 2CW0F 4EQQA 3K9TA 3DFGA 1BI3A 4BH9A 1XGNA 3V8LA 1FP2A 3KETA 1QBJA 2ZMEA 3HRMA 2W24A 3RJPA 3LAPA 2RN7A 2PC1A 4PK3A 1JHFA 2L4MA 2XAFA 1RUOA 4HV6A 1T6SA 2ZNYA 3DPTA 1P92A 3FWEA 4JXRA 2UWMA 2Y75A 2Q2EA 2QVOA 4LJZF 4BMHA 3F8NA 4A5NA 5HDGA 2RDPA 5LHHA 1L0OC 4XPKA 1ZGJA 2AXLA 5FFZA 4A0XA 2V1UA 4EVYA 2IP2A 4KUBA 2UXNA 3EQLF 4HW0A 4KFCA 2HS5A 2CNSA 3RPQA 2VC0A 3GZ5A 4ZYEA 1PP7U 5E1WA 2XAGA 1FSHA 2CNTA 2VBWA 2DK8A 1S7OA 2IVMA 2DW4A 4BQAA 3VEPA 3RPUA 4I7HA 4RS2A 2STTA 1Z7UA 1FYLA 2ELHA 1WI9A 4UUVA 2B0LA 3IHUA 1TQPA 1XMKA 4E0AA 4ENKA 2I00A 4UVCA 1F5TA 3PQKA 3FRMA 4XPDB 1T38A 2R7HA 2FQ3A 3SXOA 3DXJF 5AONA 3GY9A 2FOKA 3EDPA 3HYIA 1YGHA 2H09A 3N4MA 3EETA 3P9KA 3ROUA 4UVAA 2Z33A 2FA5A 2GANA 4AVCA 2RQPA 4L0ZB 1R1UA 1FNNA 1K4JA 2P7VB 2BUEA 4JXQA 1QNTA 4CZZA 4Y49C 2QM3A 4HF2A 5DV5A 1IYLA 1L0CA 3WGGA 2FE3A 4YIIA 1ONVA 1IICA 2J8MA 1U2WA 3I3GA 4R3KA 1WWXA 1DPUA 4LUAA 3ZMUA 3K1MA 2P5LC 4HDVA 4H6ZA 1E17A 4IF5A 1IUYA 2K4JA 4UBRA 4ENMA 4G7OF 4AVBA 5H20A 2QUFA 3C1DA 1MDMB 1KU3A 3M8FA 4M6XA 1M44A 4NF1A 1DPRA 4L9TA 5JPHA 4EJVA 4I2OA 3BDDA 4U88A 2EA2A 1OYYA 5LLQA 3SHFA 1BOBA 1S7NA 1QZZA 4M6YA 3GUDA 2CGPA 1W5SA 4EJWA 2PEXA 2Z9OA 1UFMA 1O3TA 2PRBA 2FSRA 2HQNA 3ZMSA 5AIPA 5ICCA 2ZW7A 2P6TA 3BJ8A 2HV2A 1SMYF 1XCBA 5D5XB 2BE5F 5FD6A 5DD4A 1XF8A 2ZW5A 2Q0YA 5KVRA 3MZHA 4IJAA 2BGCA 1R36A 4AIHA 1KUVA 4JQFA 5ED4A 4NHJA 2Q0OA 5DWNA 1TNTA 3ZMDA 3F8KA 2J8RA 1P4NA 2HDCA 2QECA 5H6QA 3JSPA 3TCVA 2Z0ZA 4M9ZA 1O3RA 4B09A 3QU3A 5JI6A 4JLYA 4IHSA 3K2ZA 3V4GA 3ECHA 2HTSA 2K4BA 1G3WA 3TGNA 4KMFA 5EEGA 3I64A 3SQNA 3BWGA 1Q2DA 4AVAA 2NMTA 4B8XA 1YS6A 5BMZA 4PZJA 3D0SA 2GA1A 5FB2A 2EV5A 4WK8F 2VE9A 1LRZA 4LMYA 5BQTA 1U8RA 1RUNA 4OIPF 2FIWA 5D8LB 2IRFG 4P9UA 2D4OA 3CLOA 4RAYA 2TDXA 3EYYA 3I9SA 3QP6A 3IKTA 1HW5A 3SZPA 2WPXA 1M1DA 5D4RA 1ZYRF 1BN5A 4G8XA 4II9A 4ONUA 2BV6A 4QWQA 2OZ6A 3QU6A 4Y17A 2KKOA 3FMSA 2D45A 2VOOA 1JXSA 4RB0A 2FMLA 3HSFA 5LGTA 2CFXA 2JSCA 3B73A 4EJTA 2DU9A 2O0YA 3F8CA 5D6FA 1Y9KA 1TBXA 3BJAA 3BOQA 1F4KA 3O6BB 1S5KA 5H86A 3H3ZA 3OWCA 1G4DA 2V79A 2CO5A 4UV9A 1I1DA 3RYPA 4HKFA 3HSEA 3GLXA 2KCWA 1R23A 1ULYA 4QB9A 3H92A 1EH6A 1P0HA 2EFPA 1YVKA 2JPBA 4LK1F 5TJJA 2VT2A 4JK1X 1KQ9A 4U5YA 2FNPA 2E7XA 2ESNA 2KRFA 2R8VA 2YX4A 2EFNA 4ENNA 1X3UA 2AE6A 2QLZA 1S7FA 2Z5UA 5F47A 5D4SA 4U0YA 2A68F 1CM0A 4NSQA 2H6CA 3U1DA 2FBKA 4EGZA
chains in the Genus database with same CATH superfamily
4OIOF 3FEEA 1D5VA 4Y3OA 5EJCA 2RB7A 1PVEA 3RQIA 1IOFA 4FWUA 4FCYA 2L3DA 5EG0A 1T8IA 3D5RC 4RAZA 1R4MB 4F92B 4GI3C 2V1NA 1T0FA 2KLOA 2ACJA 3D67A 2X52A 3IRRA 3K6GA 1IRFA 5J3LA 3R1KA 2R7DA 5IP9J 4F6AA 1ZRCA 3N05A 3CXLA 1P9GA 4P55A 4P9FA 2D2WA 2JPCA 4A5MA 1HSJA 5TGTA 4X1EA 3TO6A 4TV7A 3VYTB 1S3JA 2E36A 1SGDI 1WGTA 2V1CA 2M4KA 2M5XA 2XIGA 4LD5A 3HRTA 4L18B 1EJ9A 1BLLE 5GPAA 2EPFA 2CG4A 4TWEA 3CCSI 3H5ZA 2PLYA 4UA3A 2QQ9A 1Z2IA 2L7KA 3V8IA 4IKFA 4Y33A 2VIXA 5GAEJ 1U6GA 3MN2A 4YG2F 2A3SA 4PXBA 4R9MA 1N71A 1WKMA 3VYUB 3RCOA 2O6GE 2OZUA 2HWVA 3H8GA 1CHOI 1ZGWA 3S6KA 3VODA 3BTJA 3KZWA 4WWVA 1QGPA 4M73A 3OSGA 2BOAA 3K9UA 5J6XA 4MI4A 2R5YA 1W36D 2YNDA 3NE7A 3GEZA 3W6KB 4QSHA 2QQAA 3DGVA 4UCPA 3UNGC 4IQ4A 4MXUA 4M3BA 3OYJA 3J80K 4RLFA 5L3CA 3BR6A 3H0GJ 1MMDA 3T0YA 1KBFA 1LNWA 2QYVA 1RKTA 4MBUA 1IB1E 1LDDA 4BHBA 3TOBA 1B72B 3RBUA 3DKXA 1Y1VJ 5D5WB 4Q5SF 2O9LA 2IAIA 4B6ZA 4L0YB 4AVPA 1YQEA 2NYXA 2CFOA 1VFCA 4MFJA 2XRLA 1FZPB 2YU3A 2PJRA 1G3YA 5IP7J 1T39A 2SGEI 4OC3A 3MN8A 3VH9A 5F09A 3NARA 3V7CA 2VZZA 3ZQLA 4A3FJ 2WZNA 4HX4A 1FTTA 1SGEI 4KVOE 1ULKA 2UZ3A 2JA7J 3CCUI 3DBHB 2L7XA 1RETA 3PJRA 2IPQX 2K9QA 2K9SA 3SZGA 4MNUA 5TRDA 1JGGA 3VFZA 4FKDA 1W7PA 3FM5A 4XLHA 4NC6A 1U9NA 5M5WJ 2PJ8A 1TLHB 3F9KA 4G7ZF 3SHPA 3G3SA 1S72I 2EK5A 2JW6A 2HC9A 2CWFA 1HA8A 2G3TA 1BM9A 2QQ0A 1Z8WA 2DJNA 1JE8A 3CCEI 1X4OA 2HDDA 2FS5A 3DR6A 4R79A 2CWGA 2R7UA 2BVLA 2HVQA 3LA3A 1IN6A 1U8BA 1R0RI 1MJ9A 1MBHA 2DT6A 2H1KA 3BROA 1Z0XA 1QVUA 2DIPA 1K6OA 3PGPA 3KLNA 2M1BA 3K1NA 1K7UA 2ZEEA 4NXYA 2VASA 1JUMA 4NC7A 2R0QC 4MEXF 3CF5F 1B1BA 2DOFA 2K86A 3TOAA 3FBNB 2EO8A 3SXYA 5EGOB 2CQKA 5B1BH 2W82A 5CVJA 3TT2A 3GTGJ 2DN0A 1JTXA 1IRGA 2PVWA 4DJLA 2IA0A 3OIPA 1OCZH 2NNNA 2UV1A 1YTYA 2QVPA 3NH4A 1ETKA 2DBBA 3S2WA 5F64A 2OD5A 2YSRA 1BI1A 1YHQI 4KISA 1U5KA 1Z3XA 1BR4A 2CY2A 1YVOA 2B3UA 4C2ZA 1E0EA 1XSXA 3BY6A 1RI7A 3C3WA 4IAVA 2ZJ2A 2XROA 1I1GA 5G21A 1J2XA 1RO5A 3R5BA 4R7MA 4A31A 2L7MP 1ELLP 3E0KA 5HNFA 1ZTRA 4XICA 1QU3A 1FIPA 2P0WA 3E5XA 3HSRA 3I4NJ 4MLOA 4LOCA 1GXQA 4FD6A 1XE4A 3E6BA 5HLIA 3QAHA 4CSWA 2P6GA 5LRKA 2RC4A 1O57A 1B9MA 2O61A 2AFOA 2J8NA 2Z3MA 3RSNA 5IB0A 3R95A 4PUSA 2MLGA 1IIDA 3ZMZA 1BPMA 5HS7A 3M9AA 2KMPA 2BY0A 2N1AB 3QRFF 1X4SA 5LRRA 1M4DA 4MFPA 1AWCA 4CCMA 1KBEA 5EEAA 2DPUA 3VSKA 1HEVA 1AKHA 2CV2A 2GXGA 3T8WA 1OPCA 2ZENA 5K8OA 1I3AA 1TBRR 2KIMA 3LMSA 3DNSA 4KIFA 4CYDA 3IKVA 1ZRFA 2DF5A 3KGQA 3KR4A 2ZOGA 1Y0NA 2Z1DA 5EG0B 4BDYA 2DAOA 2X1CA 3GFJA 3KZZA 2L8EA 3IGRA 3LA7A 3OYDA 1CP7A 2LNBA 2VL8A 2OZGA 5K8MA 3DBLB 2M34A 1BJZA 2JA6J 1ULMA 1BC7C 3SI1A 3UGIA 3JAMZ 1V5FA 4R8HA 2K5CA 2R98A 4M6VA 4IX7A 1AMPA 3E3VA 2F4OB 1MZBA 5CCLA 4FE4A 1VQMI 1LE8A 4GRIA 3ZP5A 3W2WA 5F46A 1NSAA 1BR1A 4C2MJ 2GU2A 3PB6X 3DWLE 1F36A 1I6XA 4KMUX 3AG1H 3TMOA 2ZXJA 2ZJRF 1OYWA 2DT5A 3JRCA 3B2YA 1TNSA 2Y48A 4LLNA 2DA4A 3FNCA 4P4IA 1S29A 3FHZA 3BLNA 1TKJA 3TQNA 1HLVA 5KK1A 1BMOA 4O5VA 2FBHA 2HXIA 4C2TA 2F5FA 3HHGA 4IL6C 1HDLA 2V53A 4D1QA 3T9YA 2F5EA 4RGSA 2DYRH 2OB0A 1MH4A 4X3RA 4XNHC 3KYDB 2VXZA 1PP8F 2LOOA 1FYKA 1LEAA 2MYSA 2AFMA 2ID6A 3EUAA 3JRIA 4KSIA 3FXLA 1BJAA 3WTXC 3VDXA 2R5YB 2FCKA 4UFWA 3RNZA 3KFWX 5KCMA 3IWEA 4CAXA 2NVQJ 1BUSA 3KP5A 1TBOA 2ZEHA 1U78A 1ON2A 3KEQA 1QSMA 5FKKA 4ZBGA 4HZFA 3KYCB 2MG4A 4OADA 3TBIA 1NG6A 4A6DA 2O5RA 2J5PA 1ZG5A 2O28A 3OL4A 4XPLA 2Y0MA 1KGSA 3S14J 2EUIA 5H84A 5DD8A 2XGXA 4F0YA 4NGTA 5LYDA 5CJ9A 4UXHA 2XASA 2HEOA 3W6JB 2RNJA 4CYNA 2FL4A 1FC3A 3O2PE 1FP1D 3H5AA 2W25A 4G94A 4WXDA 4A69C 5E8IA 1MDMA 2PJRB 2NS7A 1KUYA 2J87A 2VBQA 3GWZA 1IW7F 1TOTA 5GP9A 2JQ7A 2A05A 4C3HJ 3OYCA 2YNEA 2V9KA 1FT7A 3T8TA 4XLPF 3B3VA 3QOEA 1H9TA 4KOUA 2L0KA 4P1WA 2R4GA 3WTSC 2OQRA 4KJZA 5JVGF 3SEQA 1YW7A 3WGIA 3F23A 5FFXA 3JRUA 4R1HA 1W7PB 3R96A 2VLAA 3S9MA 4A3JJ 4DQ2A 3B3WA 3G3ZA 1ODDA 3HLPA 2WAFA 3WE2A 5FVJA 3VATA 5THWA 4DOZA 2CWHA 1J0RA 3BG7A 1R1TA 3W6XA 3R6SA 2KFDA 4UXIA 2JZMA 1ON1A 2NAZA 3SEZA 5I4MA 4YU9A 5E3MA 1ETWA 1JI8A 2UVOA 4I0AA 3LSKA 1Q1HA 3OOPA 3R61A 2L9NA 2CS3A 1E3OC 1TIHA 1V3FA 1TBNA 4Y49B 1UELB 4M6HA 5CYVA 1IZ1A 4JYKA 1QVTA 3JRFA 2PJPA 4BEHA 3OYNA 1SVOA 2X48A 2E5RA 1XGMA 2N8GA 3R5AA 4HGUA 4EMSA 3LFKA 1WKXA 2ADUA 5LRSA 2NNYA 3L09A 1Y8QB 5G1ZA 3B6AA 1QQIA 3U21A 1MK4A 2DFFA 3RKYA 3RDIA 3MFKA 1TF8A 2CXAA 3IU2A 3QAYA 1CG2A 4PV6A 4RN7A 4UHTA 3CZXA 3H35A 3CJQB 4EV0A 4OMYA 2R7ZJ 4TNUA 2YNCA 2G0BA 4MRIA 5E1ZB 2R7RA 1M4GA 3QTLD 5EBVA 1YYVA 3DTEA 1RXTA 1SD5A 3JRGA 1PUAA 3QOPA 2RV8A 2V1XA 5D8KB 4HEA2 2VL1A 2R7QA 1YI2I 4ZTJA 1MJAA 2P5VA 4I09A 2GA2A 4FD4A 3F3XA 2VQHA 2WAQA 1PCEA 2K7LA 2OPTA 3I4MJ 3FM3A 3FF3A 2M7BA 2P8TA 1IGBA 2PJ1A 5CVVA 3C2HA 4HNXB 5HVQC 4H4KC 4N9HA 4IXAA 2GKTI 1IN7A 2ELJA 1Q2YA 1WH5A 2W48A 5CQGA 4ZH4F 1N77A 2BOLA 1KU2A 2VN2A 4UEZA 3P9IA 1WSUA 2HQRA 3LQRA 5HNHA 5AG5A 5CVIA 3OIOA 1NHAA 2IBDA 3K0LA 1JT6A 4I98B 3D8PA 2YPRA 1NK3P 4UXNA 3JVNA 4MHYA 1ZREA 3HXLA 3GTLJ 3BP8A 1AKHB 3FMQA 2XV4S 2DJIA 3M1EA 2H1LA 3HUGA 1G2HA 2L7ZA 1W4RA 2W84A 1SGQI 1YS7A 3OXLA 4E7HA 3LSRA 2DOEA 4ITVA 2MFZA 3CUQA 2GLFA 2KHMA 4ZYAA 2RNGA 4FISA 1YX0A 4WX9A 4F8ZA 3KLOA 3WTTC 3FXMA 2XPVA 3M1CA 3CDLA 3RIRA 4NBQA 2XDVA 2X0LA 1F43A 1KYZA 3WTYC 1BOAA 2ZCWA 3SFZA 4S05A 4B44A 3FVLA 4HNWB 3UY5A 3HHHA 1LE8B 1MD0A 1JKQC 4AIJA 3G73A 2E1MB 1K78A 6PAXA 3S6HA 2QSFX 2VKHA 4A3IJ 1IC8A 1ETOA 3MWMA 4ZYQA 1VZ0A 3DQVC 1OR7A 3SJMA 4X5KA 1E3HA 1TWGJ 2AO9A 1SQHA 3BI1A 3CDHA 1YU6C 4UWIA 3PNVA 2LDUA 1LFPA 4P6YA 4YGOA 2R1IA 1ZLKA 4F9UA 4Z65A 1WPKA 2DQLA 1U5TC 3PFIA 3HTSB 1PPFI 1I5ZA 3KQXA 3ML6A 4LGWA 4V2FA 1FTZA 2BXZA 2VBYA 3GFMA 4ZZDA 2NU2I 4PQAA 2WGCA 2RVCA 2Q4VA 2VJJA 4H2KA 2MA3A 2ZBKA 1GHEA 4CGLA 3KP4A 2GWRA 2HPIA 2ZOFA 3CJNA 1OCOH 4KN7X 3PSFA 1VQ9I 2M2EA 2J5OA 2GE3A 3PNTA 3IJ3A 2PI0A 4HAMA 3KYLA 4DNCA 2X51A 1I12A 1Z8XA 2HZTA 2L01A 3L2QA 1PUFA 5AIQA 3LWFA 2PR8A 2F5IA 3HH2C 3BJ7A 5EC4A 1SGRI 2PJ6A 4E7SA 1XDSA 3FMRA 2EZLA 1HSTA 2HOEA 2JRTA 5JLWA 3CO6C 1XX6A 3BR3A 3CCRI 1WZ2A 2Z3KA 1D1BA 1XN7A 4ZGYB 2ABZA 4NQWA 3BCBA 3FXOA 3WTVC 1M4LA 4CAWA 4CHUA 1LEBA 1N75A 3G1MA 4O6JA 3LSTA 3VWEA 1V0CA 4A12A 2X1DA 4PSXA 2ZEFA 3DDDA 4KOXA 5J40A 1WK4A 3I71A 1WJCA 4ESFA 4MQ9F 1Y1BA 2F2EA 2EV0A 5EEHA 3BCAA 3GVAA 1MKMA 4QC6A 3MQ0A 2COMA 2FD5A 4BNCA 3W6VA 3IRQA 4R57A 4IK2A 3CMAI 1A04A 4RAGA 4K30A 1KONA 3GO5A 1CGJI 5HXDA 1P2FA 4ABZA 3CMMA 3R0JA 2E2JJ 1R5ID 4GXOA 1YK3A 5J1QA 4IHWA 2HR3A 1Y0YA 4YIRX 3L00A 2IGNA 7CPAA 3DEUA 2BEOA 2STWA 1EH8A 2O53A 2BHYA 3L2VA 1GYTA 2ZJPF 4OMZA 1D8KA 3V7RA 1MMSA 1MSEC 1PTQA 4M6GA 2DI3A 4R3LA 4KOVA 4XPDC 1H9GA 1BI0A 2B5GA 2XVCA 2XSDC 4NB5A 2DPTA 2Z3OA 1P7JA 1UJ8A 3L9FA 3H8EA 2A4NA 3IP4B 1ZH5A 1ZN2A 4Y7NJ 2MBFA 4RM2A 3CF2A 4BACA 3S1QJ 1TWHJ 1TW3A 3ZN0A 1WGCA 1HW1A 3SI2A 2A07F 4Z2YA 4MY3A 1DGRM 1DDNA 3CD6I 3MKLA 2PJ5A 3COAC 2KMOA 2IA2A 2EILH 3PQJA 3BI0A 3TFYA 5KAIC 4DYQA 5HH1A 1ZLJA 3SXNA 3OS1A 2NVYJ 3MGDA 5GCNA 2OTLI 4CUGA 2E2HJ 2LLKA 3GXOA 5HMNA 2M5WA 2REEA 1P6RA 4R76A 4UIAA 2DLLA 3EYIA 5CLSA 3OYIA 4KT5C 5KHDA 1N78A 2HOTA 3N5FA 3J7YJ 3BZKA 3CUOA 5J8FA 4A37A 4HYEA 5BNGA 2WWYA 2BCOA 3O3KA 2PG4A 1UZCA 1UB9A 2GIVA 3OIQA 1X2MA 2VODA 1JHHA 5J8CA 4EM1A 2A61A 3GX4X 2W57A 3EUHA 4N0BA 3CCJI 4A32A 1ETXA 5LYIA 2IL4A 2LMDA 3F8BA 1MNMC 2SGDI 4OC1A 1H89C 3QWPA 1OQYA 3F6OA 3TO9A 2CF4A 1X58A 5FO5A 4CO8A 3OS2A 1FOXA 1I21A 3CUQB 3GYAA 2ZMEC 1WH7A 1ZKGA 2JMWA 2GQQA 1OMUA 1RC9A 4LIVA 2BBYA 2OQGA 3Q0UA 1JKPC 2KMRA 3QPHA 5IOYA 2KJBA 1VQ6I 1LR8A 2ERWA 1B9NA 1JGSA 1YFHA 2CIJA 4R87A 4F91B 2CU7A 1Y8FA 4UFXA 5FD5A 1VDDA 3EY5A 2E1OA 1K78B 4OVOA 4A0ZA 4JD6A 1VQLI 2WUUA 4ZYGA 4Q4ZF 3OV8A 1BIBA 4UB8C 2Z11A 2OH1A 3EUKL 4YFKF 2WAQN 3DBRB 3BXMA 3SZTA 3HPGA 3MCZA 1JJ6C 4UCMA 3RAMA 2VKEA 4HQEA 4KOSA 1UFHA 2R5ZA 3H9GA 1SFUA 4J19A 1IJWC 2HKXA 2W0TA 2JZYA 1VQOI 2E73A 3S15J 1OYIA 1J5YA 2P6SA 2F7VA 4K2EA 5FKMA 1CT0I 3UEJA 1IXCA 4ZJZA 2OZHA 5L3DA 4BE0A 1A35A 1YW9A 5K8PA 3LOCA 2VQYA 5FLXZ 3RI4A 2XEFA 5DEQA 4E1PA 2DMNA 4EM0B 2L02A 2XAHA 1W3SA 3T1BA 1YOVB 4WXHA 2K3FA 4E7LA 3L2CA 1C0WA 3I5UA 5LHGA 2D1HA 2E7WA 3D3SA 5EMIA 5HDNA 5CPRB 4UEEA 1HPTA 1X10A 1Y1WJ 3N7ZA 1D5YA 2OA4A 2M4GA 4IQJA 2KZVA 3DTKA 2P81A 1RRJA 3HRUA 1OCRH 3QQAA 3TDZC 3VWBA 3GKRA 4FTHA 2P7CB 2W00A 4YRHA 2DOAA 2YR2A 3LNQA 2P5KA 2FEZA 4NQWB 1TURA 1YLOA 1ZG7A 3U1KA 2OOTA 3OYMA 2ORWA 3OY9A 2CJJA 1Q1VA 2LY2A 5IT9Z 4D9JA 5LRJA 4HA8A 3CXQA 3OYKA 3D2PA 1QSRA 3G1OA 2OV7A 3V38A 1RR7A 4CRYB 1SEUA 1WJFA 1QPIA 1D0ZA 2FSWA 1Q7LA 2V8DA 3HOUJ 3FHNA 4B12A 1SFEA 1UHMA 1IAWA 3CCYA 3R4KA 4CCOA 2WYRA 3FB3A 2C6PA 4Z6YA 3C2BA 2EFQA 4Q47A 1W0UA 3OVOA 5EZHA 2K27A 1TW2A 2ZNZA 1KMAA 3NEUA 2AFXA 3TC8A 4LLLA 4MCQA 2CUFA 4G12A 5CVUA 2ZEMA 1CP6A 3W91A 2RKHA 4RGUA 3MKYB 1IUFA 2MLKA 3ERMA 1JQGA 2LREA 3S1MJ 4MO7A 3JUWA 1Z05A 2YGWA 5F1RA 1RESA 2JK3A 4NFRA 2QYOA 2FNFX 1XRYA 4KUAA 2KL4A 2CQXA 1S7KA 4A93J 2ETHA 2B5GB 3WTWC 3WGHA 4J01A 3WODF 4UV8A 2FT0A 2JWTA 4HBLA 2PMUA 3I54A 4XSXF 1OMTA 1MMNA 2X6OA 4G9YA 1O3SA 2O8KA 1TP4A 5L3EA 2B0UC 2WADA 2Z99A 1IOIA 4PXEA 4BL0B 3DLLF 2M0CA 5KTDA 5J1YA 4ZYDA 1JUPA 2A6TA 4IZZA 1FBSA 4A3CJ 1PTRA 1SVLA 2FJ1A 1JWQA 1T08B 1OCCH 1U9OA 2DFEA 3P5JA 3QPTA 3DLJA 4GYIA 3OYGA 4P4BA 1OKRA 5DS9A 3VARA 2VXKA 1CGPA 3K10A 4BHPA 2XC7A 4HF1A 3PO3J 3H5NA 3GW2A 5C82A 2X9DA 5ERIA 2HYFA 3C7JA 3E0JB 1ACIA 5KTCA 1OR7C 2EA4A 1K79A 4W1UA 1REPC 1OYVI 1QSOA 1OMIA 2W1OA 2P6EA 1UG2A 1LB2A 3B3TA 5DUKA 1U3EM 1Z6TA 1DUXC 5EX3A 4M72A 4KDPA 4JP0A 2HXOA 4AG9A 3SI0A 4G1PA 3OS0A 2A6HF 3LQQA 1OLTA 4FASD 1VNDA 1LCPA 1R00A 1G59A 5D6EA 4AYBA 4N9IA 2CSOA 1Q9BA 4U0VA 3SJGA 3GOXA 3WU2C 4QIWN 5A2QZ 4BYYA 1YRNA 2P6FA 4B13A 3P2HA 3NAUA 2LB7A 3RZDJ 2OCEA 1MMAA 3F72A 2BEIA 4F0XA 1XSVA 2V9VA 2VT3A 3KIOA 4IPAA 1YJNI 4UIBA 2REFA 4F7ZA 4P4JA 2PN6A 1P7IA 1ZARA 4F9VA 1A6IA 3TP0A 1VKCA 1XEBA 2K5TA 1GV2A 3B3CA 4A39A 2RQQA 2VJ4A 1UCRA 2XPUA 1GDTA 3H0DA 3WTZA 1Z5RA 3EO4A 2E35A 3HKZA 4ZTFA 3S3NA 2CV1A 2DQRA 3HOYJ 1ULNA 3LWUA 4QBJA 3JTGA 3A2KA 2HVRA 2BY1A 4I0BA 5ICFA 1I3QJ 2LF7A 4YEJA 2OU2A 4HNVA 2A20A 1Y0UA 4FX0A 3ABKH 3WU0A 3K70C 3BR5A 3PFOA 2R5ZB 4NGNA 5F6FA 3HG9A 4I01A 5E20A 3SDGA 4NCZA 4XN0A 5E79C 2FU4A 4UNOA 2FXFA 1X1CA 1HCRA 1YQAA 3A4CA 4FX4A 3NQOA 1R57A 1TTYA 1YITI 1HDUA 3CP2A 1XA6A 3JTHA 3RZAA 3S6GA 2XKOA 1UVGA 3E6MA 4N4OB 4XR6A 1R79A 3HBLA 4RB2C 2ZKZA 2M8GX 5DAEA 1LANA 3DF8A 2UXXA 5FLMJ 2CTBA 4ZX9A 2DK5A 2EB7A 3BR2A 1BBYA 4UB6C 5ICEA 2KP6A 3BG5A 4LB5A 3TW6A 5JFRA 3JAMK 4KIGA 5LEKA 2AFWA 3LAJA 1LPQA 4H6UA 2VXDA 3RPUD 2WV1A 2V8GA 5FUYA 2VKVA 2DTZA 2Y30A 3GYHX 2PIYA 4C3JJ 4KN4X 2MGQA 1IXSB 2ZXHA 3BLYA 2EWBA 4A95A 2C6YA 2HQYA 1RNLA 4CGZA 5ICGA 2EK8A 1KUXA 3KEOA 1I27A 2V6CA 3DSBA 2XGCA 3KKWA 2MC3A 4V19K 1FX7A 2EK9A 1Y56A 4L5JA 5IYCJ 3HOSA 1CE3A 2JRMA 4IEJA 2CWEA 2GIZA 4WF2A 1HBXG 1HXDA 3K4NA 2PJ3A 1CJWA 5ILSA 3BG3A 1QO0D 1F9NA 1X3WB 1BIAA 3IWZA 1DU0A 1GLNA 4HSTA 3DTIA 4PXCA 1T98A 3CCQI 4IRGA 1YG2A 4S04A 1XGOA 4LB6B 2QPOA 3S6FA 3D2MA 2GLJA 1HKSA 3S16J 4UUTA 2LYCA 3DKYA 1NTCA 1X1DA 1YW4A 5JR3A 5DWMA 4L9JA 2PJAA 2EZIA 2JA1A 3OR1C 4C7HA 5JHFA 5F08A 3HOVJ 1XGSA 3Q0VA 1UVFA 1QZEA 3HC7A 3FX3A 2JEVA 5HVGA 5HLGA 2XUBA 4OAZA 3ECOA 1R7JA 3WC5A 3PIPF 3KX2A 3ZPLA 2OR4A 1FJLA 2V8HA 4FHTA 4ZZLA 2A69F 2GOXB 1IGNA 1YIJI 2GXBA 5DS0A 3SJFA 3FK6A 4PGHA 5JM6A 4EVIA 3ERED 1NMTA 4AB7A 3HL2A 5GAGJ 4ESBA 3D1NI 5C88A 3K7AJ 4PGGA 4E8OA 2FMYA 4UF4A 2HFHA 5FJ8J 5F49A 3G71I 4H89A 4M3SA 3L7WA 1FOWA 2JDCA 3SFIA 3CJTB 1Z7LA 1PJRA 1VQKI 1XCVA 4YFXF 1CX8A 2ZEDA 2NS0A 3I9V2 2QIRA 1S7EA 4DIQA 4M71A 1K6YA 3ZN1A 3JRAA 1FAQA 1TT5B 2ZSIB 2IS6A 1R3NA 3EC4A 3I53A 3GFIA 2XF6A 3NRVA 4C30A 4D7NA 3RU0A 4CAFA 2VI7A 1WGXA 4ETSA 3F8MA 3LSMA 5E3LA 4AVZA 5E3RA 1J7KA 1LKXA 2CH0A 1CF7B 3VOEA 1A6QA 2O7OA 2QEXI 2HOSA 1Q2CA 5K8NA 1P4WA 3V7ZA 3BTIA 5HODA 4GYGA 5B3SH 3FISA 2B7EA 1IN8A 2H94A 2WV0A 1R58A 4A2UA 1WJBA 1K4SA 2R93J 5FKOA 4IHTA 1SC7A 2H27A 1Y9WA 4RB1A 3D5LA 3T90A 4JJXA 3MZ8A 4NNJA 3FKIJ 2YS9A 4E7ZA 4OIDA 4BXFA 4A3BJ 5LD2C 1X4PA 2C6CA 1YRNB 1LR9A 2L4AA 5JHUA 2GVIA 1A2ZA 1LAMA 3S3OA 1S3ZA 1CT4I 1G6NA 1ZAOA 3DPLC 4XSZF 1N13A 3E6CC 1Y0RA 2Q51A 3FXTA 3ZRGA 4MCRA 5K7FA 5JQ4A 3ZQCA 5HS8A 3H4QA 3K70D 2BXYA 2DXIA 3OYEA 1U6MA 2ID3A 1EE3P 2JDDA 3HUVA 2XAQA 2Y0SN 3KR5A 2DO7A 4UCNA 3BG9A 3S17J 3B02A 2H6BA 3TO7A 1UWYA 3CJRB 3NE8A 1FYMA 4PK2A 3JREA 3IWWA 1ZG3A 4HSRA 2JYYA 1TQIA 4U7BA 4KOYA 3HGGA 3CXSA 2DA2A 1CBXA 1OFCX 5EZGA 4ZI6A 1S9HA 2RAEA 2GREA 3IIBA 1NE9A 1AA7A 5K1YA 3JRBA 2JEWA 4PSWA 4OIWA 2CNMA 2DXQA 3G6EI 3OL3A 2B8TA 2IXSA 4KOTA 4KUMA 1SAXA 1HDPA 4HQMA 4YELA 3BTCA 1JT0A 2QKMB 1ZLHA 3J81Z 1TWCJ 2OC6A 3UOEA 2ZW4A 5LRGA 4B5OA 3Q9SA 4AU7A 5F0FA 4H0EA 1T2KA 1YX3A 4AYBN 4HRIA 3AL0B 1QA6A 3OOUA 3OYBA 3RYRA 5CKTA 7WGAA 1T33A 5IT3A 3LA2A 3W6SA 1XMXA 4RS8A 3K4JA 2ELKA 2Z3YA 1WHUA 3NWSA 2HYJA 4HLXA 4GO1A 1J9IA 1D8JA 2N52A 2CUEA 1WJAA 2LF8A 1F2OA 1YREA 1HDQA 1AUGA 2ARHA 2OBPA 3E1SA 1W5TA 3RKWA 4B3AA 2BVMA 2G3AA 2G9DA 3TKYA 4OU0A 1XB4A 2ESHA 2PJ0A 2HQ5A 3GTMJ 4E2AA 3J7ZI 1FOKA 4PCQA 1U5TB 2WPWA 1FBUA 3I1UA 5LGNA 3HKZN 1LR7A 2M7AA 1J4JA 2V7FA 1TT0A 2PFBA 4XKWA 2HTJA 1YW6A 4L8AA 4CA0A 3WE3A 2Z3NA 2D1VA 3LSJA 4CS0B 3NA6A 2QZ8A 3NFZA 2CW7A 1VHEA 5KNLA 2OD1A 5ILUA 1UHAA 3UEYA 4MHDA 1T0FC 4UWJA 3ZZIA 1Y7EA 5AG7A 1Y7RA 3CCVI 4IOCF 2R92J 1KU9A 4B6DA 1SD4A 3BQYA 3D7FA 2ROWA 1R71A 1LOKA 2PJCA 3OYLA 4IF4A 2JT1A 4XKVA 2V1CC 1MH3A 1V55H 4ON0A 5FGMA 4PFOA 3E6DA 3WT4A 3HB9A 4ASNA 1Z3YA 1P9ZA 2Q44A 4KVME 4NGSA 2P4WA 1ERDA 1NK2P 1JKRC 3FKJA 3SYTA 5EX0A 5D8NA 2L9RA 2LP0A 1LVKA 1NH3A 3B8GA 2CJSC 4P45A 5HLHA 1RIOH 5D5VB 2NVXJ 3Q5FA 3ZOBA 3CDIA 4Y52J 2FXAA 3PFEA 5A27A 3DEWA 4OWRB 2EIMH 3K69A 5BPDA 4A24A 3A0HC 2D5VA 4BJTA 3I56I 3GFLA 3ZXSA 4ZDOA 4Y13A 2I79A 5D29A 5F27A 2KIUA 2O3FA 3I0TA 3L2RA 3VE5A 1GXPA 4KORA 3ASNH 3CMEI 4A3LJ 2I8DA 3IC1A 4OLLA 1USSA 3JRDA 5BOXA 1O7FA 3ZMTA 4MIMA 5D5UB 1Z6RA 4UEFA 4A94A 1YLFA 2PJ7A 3ZQFA 1Z9CA 2BL1A 3S1NJ 2JA2A 3KP2A 1WJDA 1Z8TA 1FT9A 1TKFA 4B47A 4M85A 4NJQA 1OISA 3HTUA 1R43A 1IY6A 4IHMA 1XMTA 2MH2A 2XKPA 1WFXA 3CTAA 1IN5A 4P96A 2MD5A 1XX5A 2GZWA 3CC7I 4QVTA 3D66A 3EFAA 3KPHA 4GDFA 3FXJA 4BUPA 4ZY1A 1JTYA 5KTAA 4FE7A 3ZQGA 2EJRA 4PDKA 4NGQA 5L3GA 2HNHA 5LBQA 2BSWA 2DA7A 2GLOA 4GFBA 3KP3A 1W0TA 2A6EF 5C4JJ 2WB1A 2OTJI 3BJ6A 4MY0A 3I4PA 5CQEA 4KIBA 2EQRA 2V4JC 3CCMI 1K83J 2LKPA 1P4AA 1LFUP 2LD5A 2DT7B 3K2AA 1Y6IA 1Y8RB 2MSYA 4XLAA 3REOA 2XEIA 4HX8A 5EDNA 2DPDA 1ZR4A 2KRCA 3HPHA 4LIUA 4CYQA 2M8EA 3ZCOA 4ZC3A 5DYMA 1M1EB 2IS1A 4IVNA 2HUZA 4D5CA 1WVRA 1J59A 4NGMA 3KY9A 5K5RA 4U87A 5DM7F 3VWDA 2FQ4A 3EXNA 3B7IA 3UR3C 3K4LA 3E5UA 2K9MA 4LITA 2YX7A 4RM3A 1FLIA 1G3SA 4CCKA 3PIOF 2H8RA 2WBMA 3RO0A 2PJ2A 4P4FA 1E2XA 1IU8A 2KIFA 1GUUA 4XRFA 4A33A 2BZTA 3PB7X 4C68A 3AG2H 1FYBA 1I6HJ 2VQCA 1UMQA 5L3BA 2JSPA 1TQMA 3BG6A 5LGUA 3CO7C 2PJBA 2NVUB 3LODA 1L3LA 4KLWA 1RPWA 3O8HA 4KSAA 2Z2SB 2ZMEB 1IYKA 4P10A 4HPSA 1KQ0A 4BAYA 2MD0A 4BQQA 3U9GA 2HOAA 3P9CA 1MMGA 2FBIA 1XC5A 3BJOA 2Q04A 4PJNA 1G3TA 3TX8A 3TE4A 4BY1J 3QWLA 2XEJA 3R5DA 3FECA 4QTRA 3GTKJ 4MGRA 4HF0A 2Z10A 3OXGA 1B6BA 4M3DA 5LYLA 1MGTA 3ZMVA 4I02A 3VB2A 2VQLA 4AD9A 3F5BA 1BR2A 3KHXA 4B4CA 4XNFA 2ZXWH 4Y15A 1FWZA 2RREA 3QYFA 2AHQA 1VTNC 4KICA 2GM4A 4L9NA 4AIDA 4NJRA 4A2ZA 1OBRA 2LY9A 1USTA 1X2NA 1Z4EA 2HYGD 2OJED 2M87A 2QWWA 1BO4A 4EFDA 2ZEPA 2W7NA 3ABTA 2X4HA 3H3UA 4ZDPA 4XRSG 3BQZA 2SGPI 5FRMA 3UGLA 4XOPA 3A03A 3RTRA 2ZFWA 4MFLA 1A5JA 2OAZA 1KU7A 3M7GA 1IN4A 2MH9A 4OC4A 2Q7BA 1OCTC 4MTDA 2UZKA 4AIKA 2QSHX 4M74A 1CGII 4MQVA 2QJ8A 1HKQA 5FLXK 1X3ZB 4BDZA 2JBJA 3BZ6A 2VI6A 4R8FA 4HV5A 4F93B 1Y39A 3FMCA 5GTIC 5FROA 2Q8KA 4EGYA 1SGPI 1Z67A 2E1MC 2M3AA 2QSGX 2R7FA 1Z2LA 1QSNA 3LMMA 2YU9J 2Q4YA 3DU5A 1WJEA 3VYRB 2L54A 5IY5H 2CUJA 3JRHA 3R9GA 2F5VA 1VQ4I 1XS9A 4NDLA 4OC2A 3CLQA 2HKOA 2CQ7A 2AFZA 2OUMA 2ZC2A 4CGPA 2POKA 2IA1A 5IX3A 1FY7A 2KIQA 3K1PA 4XLEA 1IY5A 2D4PA 2C1CA 3V8KA 3SJEA 5IT9K 2YUSA 3HRSA 4BBSJ 3M8JA 1AOYA 3IAM2 3K4MA 4A38A 3H3VK 1F1ZA 3OYAA 5HI7A 1PUEE 3V42A 2WC2A 2KQRA 5F04A 1QHGA 4JYWA 1YIOA 2ISYA 1IY7A 1XIXA 3P7NA 2ZB9A 1ZHFA 1ARMA 5LEJA 2C27A 1OJLA 3R5CA 3GB0A 4Q36A 1DE4C 2V26A 3FF5A 4XORA 1B4AA 4IRHA 1J09A 2E1NA 2IS4A 1LDKB 1XMAA 3KI9A 2PQ8A 1R49A 1S7AA 4FD7A 3BR0A 4IHVA 2LRDA 3RQ4A 3AAFA 1HJAI 4XM3A 3FSYA 1W7PD 3KQZA 4KOWA 2IT0A 4XIDA 2BYVE 1F2PA 2KMQA 5L3FA 2G9WA 2DA6A 3ZQHA 2G0EA 4WCGA 1XD7A 3JR9A 4A3MJ 4AG7A 1YR0A 1XFOA 1PJUA 4BBRJ 3MMYB 2HDWA 1FBQA 3PP9A 4MHGA 2ICWG 5IYBJ 3D4UA 3RKXA 2PSWA 4LLGF 3IFEA 4RI1A 1WRJA 4A3KJ 2QENA 3FYNA 2XAJA 5DDGA 1H88C 1NUBA 1B87A 2NS8A 3K4BA 2JXDA 1PU9A 3FIXA 3ELKA 3UKGA 2JVGA 2F48A 1X1AA 2G7HA 3IAS2 1FARA 1DGWY 4QLCU 3MAJA 2DTRA 3H1CA 1BAVA 2F5CA 4MFKA 2DYSH 3WC7A 1NG7A 1VHOA 1SFXA 3I59A 3H9QA 4D5FA 4OINF 3S3MA 4OAEA 1ETQA 4X8IA 5I0CA 2QQBA 3ISPA 2DDBA 5HDKA 2CV0A 2Z3PA 2EVNA 3GLJA 3D5SC 2LR8A 3BC8A 1W1WE 3T8RA 4JBAA 1I39A 3ZQQA 1TIQA 2RFHA 2Q7SA 5HLTA 3BR1A 5IV0A 1O3QA 3KASA 1R9TJ 2ZO4A 4JOMA 1ETYA 3WG7H 4BHCA 2NRAC 2LUYA 4ENJA 3ABUA 3F0CA 1SD7A 2GAUA 2VZYA 2ZELA 1IF1A 1V4RA 2B4BA 3IL2A 1YO5C 5A2QK 3GIUA 4J3GA 2QF7A 3ISXA 2A5YB 5FUVA 4R3KA 2YNCC 2ZPAA 1A31A 4L5EA 1DS3I 1XSDA 5GADJ 3OMYA 3PEIA 4I49A 1LJ9A 3BJIA 3E5QA 4NEXA 1AN1I 3BT9A 2R3SA 3DR8A 3CP8A 3TL4X 4KLVA 4KZTA 2FIAA 2L7FP 3JSOA 4KNYA 2FF4A 1SD6A 2WB1N 4L9MA 4OOIA 1HC8A 3ULQB 2M9HA 1SGNI 2E5NA 3BPVA 5HOOA 2I5UA 1IW4A 2MW8A 1R6RA 4DUKA 3KL9A 3MZYA 4BKXA 2OF7A 1NSLA 4FQGA 3PB9X 4LX9A 2GOMA 1R5GA 4FT8A 4EM2A 4ZYHA 2EINH 4BS9A 1ZRDA 1Y1CA 1Z77A 1XDUA 3QP5A 3F0AA 4P5OA 4KYWA 2K3PA 3R60A 1BI2A 2BUSA 1CPXA 3FXQA 1B8IA 2ISZA 3ISZA 4ZY0A 4W9YA 2VBZA 3M8EA 4F55A 1PCAA 1B6AA 5LHIA 2X85A 4XN3A 3JTKA 4CRZB 4CAVA 1KYWA 2PR1A 4YFJA 2UUZA 1VI0A 1KZFA 1F57A 1ZO0A 5KAFC 3BHXA 2PMHA 4MFDA 2ANPA 4NGPA 2KDOA 2F6CA 3S32A 1HKTA 2DA1A 3P2FA 4CGMA 4CGNA 1S7LA 3MRUA 1QPMA 2A5WA 3CUQC 2IW5A 4WJBA 3FXUA 3KHZA 2K40A 2Y0SA 1FSEA 4G6QA 1M8BA 1RR8C 3M07A 4L5IA 2AQFA 4B3XA 2B4DA 4Q38A 3DV8A 4ONWA 4RGRA 1K7AA 3FIWA 1S60A 5DCMA 2VBXA 1EV7A 4XMYA 1O7LA 3MKWB 2VQGA 4MTEA 4KT6A 5DUIA 4CAEA 3ZGKA 3J7AO 2LFBA 4ANJA 3GZNB 4U9ZA 2E60A 3E59A 2HPMA 2LKXA 1XBTA 1IV6A 3UFFA 1XBUA 1V54H 4L9VA 2FVGA 1YX5A 1CF7A 3IU1A 4CICA 5ISVA 3S2DJ 2AS5F 2R7VA 2XHKA 1E3PA 4GS4A 1AHDP 5CVRA 1UUCA 1D1AA 4IUSA 3KZIC 4AXVA 4XK4A 2Z16A 5E1XA 2ZXIA 2QBYA 1ZG1A 2ZW6A 1S8NA 1JUSA 2VB6A 3FXKA 2FE7A 3FDYA 2JLMA 4BQNA 3FK7A 4BXXJ 1A36A 3A0BC 1GVJA 1RKWA 3KE2A 3WC6A 2O8XA 2H8WA 2PMZA 5BPIA 5BS6A 2X1EA 1SAUA 3A02A 4E6KG 2R7XA 1FEXA 4L89A 5H6RA 4MCPA 1LUJB 4CDGA 3PUFA 5IB9A 1RTQA 2F4IA 3TDUC 1XMBA 1DU6A 2PDOA 1RZ4A 4BJ5C 4S0HB 1ZK8A 3OWTA 4LG0A 2LVSA 1P4XA 3E97A 4MFEA 4JX4A 5G20A 4JX6A 2HGCA 3IH2A 2M0MA 2DFIA 5FKLA 1QSTA 1W4MA 3BPXA 3ESWB 5E18F 4C9YA 2CTCA 4G6TB 2PRQA 1UHWA 3WTUC 3CPXA 5JVTA 5E8GA 2F4MB 3JCUC 4XONA 3S8PA 3FZVA 2LEOA 2WVJA 1FPQA 2IMOA 3PZJA 2O03A 4P4DA 1S5LC 4B5PA 4C2UA 1WCMJ 1WQ2A 4BE1A 3KCCA 3KP7A 2DODA 3BTLA 5C3EJ 2ME0A 4PXDA 1ORKA 1CT2I 1STZA 4II2A 4HLYA 3V8JA 5K5OA 2N17A 4ESJA 4QUSA 3N97A 3GZ6A 4OC5A 1LDJA 1MJBA 9ANTA 5E3NA 1RFHA 2PJ9A 3PB8X 5JH9A 2IS2A 6CPAA 3C18A 2BY3A 2KJCA 2GXAA 1X19A 2LKSA 3SEKC 4HDUA 1K61A 2JBKA 2JUCA 1WJ5A 1YSJA 3IWGA 2EBIA 3I55I 1YTPA 3HDDA 3G2BA 3MEXA 2EH3A 1K4TA 1QQ9A 3GTOJ 3K4KA 4D0PA 5F48A 3HGYA 4LK0F 2HZDA 4EATA 3FSXA 1WWZA 2QMLA 4MHZA 2MC4A 2CYYA 4EJOA 2K02A 1TKHA 4BINA 3TTHA 1ETVA 1R5HA 4DW6A 1DP7P 4MFQA 2DKVA 3H5RA 2EFOA 3KP6A 3I59B 4YFNF 1GHCA 3JW4A 2PBIA 4A0YA 5FUXA 2B58A 4DGWB 3CXPA 2HVSA 2B3VA 3WABA 1ZLIA 1ZG9A 5CNPA 5E96A 4EWTA 3LD2A 2KRHA 2V9PA 4JWPA 4MJ8A 2VEZA 1WI3A 1EH7A 4LQ6A 1UAAA 1DTDA 1D3YA 4XLNF 1Z9UA 2FX0A 3DP7A 3I58A 2DFHA 5IPAA 3T5XA 3FEDA 1FOYA 5GPCA 5B5EC 3WG9A 1YE9A 2BW3B 4II3A 3I3LA 4IRIA 4E70A 4BGDA 3ZJ0A 4B11A 4WWCA 4O23A 4OIRF 5J4VA 4RUHA 3HIFA 3QPSA 2VC1A 4E7JA 2IGOA 3CT9A 1Z1DA 3GCMA 1U5TA 3M3YJ 2RGVA 2XB0X 4DBRA 4XNHB 1J75A 3OR2C 3GUXA 1TL8A 1UHSA 1IXRC 1R1VA 5ILVA 5K7ZA 3OYHA 4A6EA 1JKOC 3NWTA 1BC8C 3R9FA 2EWNA 3QPLA 3H8FA 1K7VA 2GFQA 2EZHA 3E7LA 4M3GA 1P9QC 2KDZA 4BU2A 5CPAA 1DP3A 1SMTA 3TP3A 4PJLA 5JHWC 1MSFC 3DCFA 2XRNA 3R0AA 4J00A 1YW8A 4LFUA 4OIQF 1VQ5I 2F5DA 1VHSA 2G7UA 2ATRA 3QYEA 2ODDA 3IWFA 2H5MA 2XRCA 1ZG8A 4I99C 4OC0A 1ARLA 4CXFA 1B8IB 2I10A 3F8FA 2EFWA 1H0MA 1ON0A 1Z4RA 4U9YA 2VONA 4ZX8A 4PK4A 4RB3C 4RDUA 3PUBA 4P4EA 3EUHC 3S9NA 3Q3SA 4FETA 3LACA 1W5CC 4YIFA 4KA4A 2E1CA 3VDPA 1X1PA 4DBQA 3IC7A 4OAYA 1EF4A 3U2RA 3O8GA 2XEGA 4HPQA 3ZQ7A 4RGXA 1I1SA 2L9SA 4KVXA 4ORFA 2Z3LA 2EV6A 2GKRI 1KA8A 3GF2A 3QB8A 4G7HF 1SFKA 3J81K 2OCCH 1BW6A 2KT0A 2YUUA 2ECCA 4BXUA 2M45A 1ZGAA 3HOTA 4GM5A 1B59A 4OP4A 2WTEA 3VPRA 1YLEA 2B4DB 3DEEA 2K9NA 3J80Z 4RA2A 5C4XJ 2W85A 2GKVA 4PJMA 4F52A 4U7DA 1LVAA 5DCMB 3F22A 2V77A 3RYOA 4WXCA 3LFUA 2XF5A 5IP6A 3A9LA 3Q9VA 3LSHA 2VOPA 1HF0A 1HQCA 3DKWA 3F21A 1FMVA 2J9RA 2RIJA 3HZJA 4M3EA 2V1DA 5J1UA 1GVDA 3V7SA 4DYRA 3CPAA 4HX7A 1V1HA 2Y31A 4M9SA 4XBFA 2XSJC 2BO9A 2PE3A 2QBYB 5K5QA 2X7BA 4E1RA 3KZYA 1M4IA 1S6LA 2IJLA 3WU1B 2ORVA 4EJUA 3AFHA 4M9XA 1QZYA 5FUWA 1YMEA 3PDNA 4FD5A 5DCFA 1TF9A 1TWAJ 4CH7A 2FNAA 3C26A 3L2UA 2LK2A 4Y4RA 5E3PA 1OCPA 1Z21A 2ECBA 4O3MA 4AWXB 5F0CA 4FAIA 2E34A 2LSOA 4GGGA 3S9LA 4ZY2A 4PFPA 2FRHA 4LG0B 5HQ8A 4NGRA 4E7IA 4G6DA 4UVBA 2JTVA 1OZPA 4YRVA 4SGBI 2LC2A 2ZXVA 2PX9A 3GTQJ 3F6VA 1R4NB 4Q48A 5GTHC 4MEYF 3G8WA 1R22A 2R7WA 3D68A 2WCYA 2PVVA 2JJ7A 3R9EA 2C6GA 1I50J 3HJEA 1Z91A 5HS9A 4B5PB 1MBKA 3CMYA 3D7HA 1X1BA 1VGYA 3MVPA 4AMLA 1KQ8A 1H8LA 5E17F 1LQ1A 2M30A 5LYFA 2AJ6A 2AFUA 3ASOH 2FUG2 4HOBA 3HOXJ 1HW2A 2XB5A 4GCVA 4U0WA 3FBUA 4DZPA 4I76A 3FXRA 1PDNC 3S1RJ 2VE8A 4HNYB 2CW0F 4EQQA 2Q43A 3BZCA 3K9TA 1TBQR 3DFGA 1KWMA 3H9JA 1BI3A 4BH9A 5GAHJ 1XGNA 3WR7A 3V8LA 2CQNA 2R7TA 1FP2A 3KETA 1QBJA 1U0JA 4ZDLA 2ZMEA 3HRMA 3L1PA 4CPAA 4A3GJ 2R7OA 2PMZN 2W24A 3RJPA 5IOZA 3NH8A 3LAPA 2RN7A 2LTPA 2PC1A 4CCNA 4PK3A 3DLAA 2Y9YA 5CBMA 5FKNA 1JHFA 2L4MA 3HOZJ 2QCOA 2XAFA 3PFYA 1RUOA 3UGDA 4HV6A 4XKCA 5A28A 1T6SA 2ZNYA 1T56A 3DU6A 2CW8A 3DPTA 1P92A 3FWEA 4W97A 1VQ8I 4JXRA 4X2TA 1LFWA 1TC3C 4RMNA 4HNTA 2UWMA 2YQPA 2Y75A 4A3DJ 2Q2EA 4Q7AA 2QVOA 3SDBA 2CQQA 4LJZF 2TRTA 2DMPA 2WA0A 3F8NA 4A5NA 4BMHA 2FOWA 1IG7A 2E71A 5LFAA 3CDXA 5HDGA 2GBYA 1VIXA 5AG4A 2KMUA 2RDPA 2X6WA 5LHHA 1L0OC 4LQGA 5TISC 4HG2A 4XPKA 1ZGJA 2AXLA 2LBFA 3FBIB 1DQUA 5HVFA 5FFZA 4A0XA 2AQEA 4DJAA 2V1UA 2NSMA 1QHHD 4YWYA 2IP2A 4EVYA 2NOJB 2ODFA 5EF6A 4KUBA 4K3NA 4HNUA 2MABA 4X0GA 2CRGA 2UXNA 3EQLF 4HW0A 5DM6F 1VF9A 2KISA 1M8CA 1CPSA 1ZELA 4KFCA 4B14A 2BHZA 2JA8J 2HS5A 2VPLA 2BY2A 4KITB 3IEHA 2XGEA 4M6IA 1BA5A 3AG4H 3RPQA 2CNSA 2SGFI 4PPZA 3LSGA 2VC0A 3RKQA 3GZ5A 4ZYEA 1PP7U 5E1WA 3D00A 2XAGA 2R7SA 1FSHA 9WGAA 4P44A 1X12A 2CNTA 2F8HA 5DTDA 2VBWA 1WTJA 2DK8A 1S7OA 2IVMA 3WHBA 2X6YA 2DW4A 4BQAA 4FBEA 5HVHA 1S20A 3VEPA 4IO9F 1HEEA 2K85A 3RPUA 4I7HA 4RS2A 2STTA 3PBBA 1Z7UA 3KEYA 1FYLA 2ELHA 1WI9A 4UUVA 4KSFA 2B0LA 3FJUA 4C2XA 4E7KA 1QRYA 3IH4A 4JX5A 1D0YA 3IHUA 5C44J 1V5EA 1ITYA 2QQDA 1TQPA 1XMKA 4JCVE 5BWAB 2ENZA 5E3QA 1EA3A 3L2WA 4E0AA 4ENKA 3VSLA 1POGA 4CGOA 2I00A 1XPXA 4UVCA 2V6EA 1IO2A 3CCLI 2DMQA 3H36A 4C3IJ 3CZ6A 1F5TA 5K7HA 3PQKA 3FRMA 4XPDB 1LFBA 1APLC 1ZQ3P 4CCLA 3M4OJ 1T38A 1XTAA 2QKLB 2Q4ZA 1MBEA 2R7HA 4IHYA 2FQ3A 4DZJA 3AL0C 4CYPA 3SXOA 1N25A 2HQAA 3A1YA 3QYBA 5M3MJ 1ZR2A 3DXJF 5AONA 3GY9A 2FOKA 3EDPA 3HYIA 1YGHA 3TJQA 2H09A 4UFVA 4CYCA 3TW7A 3N4MA 3EETA 3P9KA 2PIZA 3A01A 4AUXA 3W3CA 2SGQI 2Q1ZB 3CQZJ 1TWFJ 4I6ZA 3ROUA 2F3CI 1HDDC 4XLCA 4UVAA 2Z33A 2FA5A 2GANA 4AVCA 2NU1I 2RQPA 3MD2A 4L0ZB 1R1UA 4NC8A 1FNNA 1K4JA 2VPRA 2P7VB 5B66C 3DPUA 2PJ4A 4UUSA 4X6AJ 2BUEA 4JXQA 1QNTA 3PRTA 4CZZA 5F0HA 4Y49C 2QM3A 4HF2A 3QODA 1IDYA 5DV5A 1IYLA 1L0CA 1GT0C 3WGGA 2EIJH 4DYCA 3G1LA 2X6XA 3D7GA 2DCEA 2FE3A 1DS2I 1BPNA 4YIIA 1JJ8C 1ONVA 2OVOA 3VDUA 1IICA 2J8MA 2WY8Q 2XGDA 1U2WA 3I3GA 5B1AH 1WWXA 3W2VA 1DPUA 3IH3A 2XAUA 2EIKH 4F3QA 4LUAA 3ZMUA 3K1MA 2P5LC 2XF7A 1ELMP 4UXJA 4HDVA 4H6ZA 4MCSA 3PBEA 1E17A 2TCTA 2K9LA 2I3CA 4IF5A 1IUYA 3OL0A 1ENHA 2E5ZA 2VUMJ 2K4JA 2DPSA 4UBRA 4M3FA 1VQNI 3SJXA 5E3OA 4XRMA 4ENMA 4G7OF 4AVBA 3Q0WA 4C2YA 5H20A 2QUFA 3C1DA 1MDMB 1IRXA 1KU3A 3GMEA 2WY7Q 4EEFG 4OKOA 1TGSI 2JN6A 2Q2EB 3M8FA 4M6XA 1M44A 4NF1A 2NOGA 1DPRA 2L5QA 2VJ5A 4L9TA 5FLVA 1VQPI 1BW5A 1Z8LA 4MFZA 4EMEA 5JPHA 1KZHA 3FH4A 4EJVA 4I2OA 3BDDA 4IHXA 4U88A 3SGQI 2EA2A 2NU0I 1OYYA 3B6CA 5LLQA 1H0ZA 3SHFA 4BJ6C 1BOBA 4PJ0C 1S7NA 1QZZA 1UG0A 4M6YA 3LSIA 2LBFB 3GUDA 4BBHA 1XJOA 2B9SA 2CGPA 1XOVA 2ELIA 1MIJA 1W5SA 3PL8A 2NU4I 4EJWA 4XQFA 2PEXA 2Z9OA 3B4VC 2N71A 1K7TA 1O4XA 1UFMA 1O3TA 2QQ8A 2PRBA 4MPIA 2AFSA 2FSRA 1D1CA 2HQNA 3ZMSA 5AIPA 5ICCA 2ZW7A 2P6TA 4BY7J 3BJ8A 2ZSHB 5EYRA 1MT1A 3TEDA 2HV2A 5M5YJ 1SMYF 4PJJA 1XCBA 5D5XB 5J1RA 5FRNA 4CYOA 2BE5F 4BEHB 4RBOA 5JGFA 5FD6A 2E19A 2VKDA 5AG6A 5DD4A 4XKBA 3CESA 2QQCA 1XF8A 2ZW5A 4B1RA 2DA3A 3PNYA 2Q0YA 1VQ7I 1T95A 2IGMA 5KVRA 2Y2ZA 3MZHA 4IJAA 3S93A 2BGCA 1R36A 4AIHA 1KUVA 5ELYA 3PB4X 4JQFA 5ED4A 3GTJJ 4NHJA 2Q0OA 2JVHA 5DWNA 1MBFA 1TNTA 2DEAA 3ZMDA 3F8KA 2ME6A 2J8RA 1P4NA 3ABLH 2IQ6A 2ZFUA 2DMUA 2HDCA 2QECA 5H6QA 5JLXA 3JSPA 2KZGA 2LG4A 2Z0ZA 5G22A 4M9ZA 3TCVA 4V2GA 1O3RA 3NH5A 4B09A 3QU3A 5JI6A 1MNEA 4JLYA 2VJIA 4XRSA 2Y69H 3MKZA 3CC2I 4IHSA 3K2ZA 2HU9A 3V4GA 3ABMH 1X74A 3ECHA 2HTSA 2K4BA 1IRZA 3G4SI 3RZOJ 1G3WA 3TGNA 4MHNA 2HI3A 2DA5A 3HUGB 4BD9A 5H2FC 4KS9A 4KMFA 4XL9A 3C2GA 5EEGA 1AU7A 3I64A 3B35A 2VRWB 3K2KA 1MBJA 2O4HA 3SQNA 3BWGA 1FNOA 4CCJA 2NVTJ 1Q2DA 4AVAA 1CQTA 1V1IA 1HOMA 2NMTA 2CMPA 2DMTA 4B8XA 1YS6A 5BMZA 3IV5A 4R6TA 2LY1A 4PZJA 3D0SA 1Z7KB 4BE2A 4C7IA 4RLQA 2GA1A 3HOWJ 5F1JA 4UY8I 4CYCB 3PO2J 4MMOA 5FB2A 2EV5A 2L2OA 4WK8F 2VE9A 3A01B 2CUZA 4CZCA 1LRZA 5M3FJ 4LMYA 5BQTA 1U8RA 1RUNA 2ZJQF 4OIPF 2FIWA 4QPQA 3ZR8X 5D8LB 1B72A 2NU3I 2IRFG 2K9HA 2J9AA 5CCMA 2P6AC 4P9UA 4RAFA 3HEFA 3AG3H 5M5XJ 2ENNA 2D4OA 4JZ0A 2X3TA 3QNVA 3CLOA 1LAPA 2NYQA 1W36C 4UUSB 4RAYA 2WAEA 3ZQIA 1GV5A 2TDXA 3EYYA 1QMUA 3I9SA 3QP6A 4B10A 3IKTA 3D7DA 2BW3A 3E2IA 1HW5A 1FIAA 3X2QH 3SZPA 1PYVA 1D0XA 2WPXA 1M1DA 2XPWA 5J4YA 5D4RA 1ZYRF 5AGEA 1BN5A 1G8XA 4G8XA 1TZLA 4A3EJ 2Y9ZA 2BV6A 2EBJA 1NXUA 2WSAA 4ONUA 4II9A 2E2IJ 2B63J 4FUUA 4QWQA 2OZ6A 3QU6A 4Y17A 2KKOA 3FMSA 2D45A 2VOOA 4QPOA 3CC4I 1PUFB 1JXSA 1OVOA 3GTPJ 4RB0A 2FMLA 1IDZA 3HSFA 2QGUA 4WP4A 5LGTA 2JUGA 1PYTB 4B48A 2CFXA 2JSCA 1YJWI 3IUOA 3B73A 4EJTA 3OXFA 8CPAA 3OSFA 3J7AY 1IV8A 2DU9A 4A30A 3W2AA 2O0YA 4GXHA 3WHCA 3F8CA 2KPMA 1V5GA 4XOTA 5D6FA 1Y9KA 1TBXA 3BJAA 3HM5A 3BOQA 1F4KA 5IYDJ 3VYSB 5EGOA 2QQEA 2EZKA 4NUBA 1SANA 3O6BB 1MW7A 1S5KA 4OMEA 5H86A 4LG3A 3H3ZA 1CSOI 3PM1A 3ONQA 3OWCA 3S2HJ 2ARPF 4BQOA 1G4DA 2V79A 4IOAF 2LH9A 2CO5A 2DB6A 4UV9A 1I1DA 3IO1A 3FX6A 3MEKA 2QA4I 1MNDA 1TUSA 3RYPA 4E4HA 3K4CA 4HKFA 2JA5J 3HSEA 3GLXA 3OYFA 3FC3A 2KCWA 4AC0A 1XG1A 1R23A 1ULYA 2DDAA 2NXNB 3AKZA 2COBA 1AYEA 3SGBI 3H92A 1TXRA 2ZEOA 4QB9A 1EH6A 2IGKA 1P0HA 2EFPA 4AM3A 1YVKA 2JPBA 1MBGA 3PSIA 2VT2A 4JK1X 1SVMA 4LK1F 5TJJA 1KQ9A 3LSPA 4U5YA 1SFOJ 4DYOA 3LL7A 1YJ9I 3L2NA 2PCUA 4MHPA 3EPZA 2IEKA 4D7MA 2FNPA 2E7XA 2W4SA 4B43A 2KCXA 2ESNA 2KRFA 2R8VA 3GBGA 2YX4A 5J47A 1H8AC 2ZEGA 2HB6A 2AXTC 2EFNA 2L9VA 4N4NB 1BL0A 4ENNA 1SGYI 2V8VA 1EKEA 1X3UA 3B3SA 2AE6A 2QLZA 1FMWA 4XLFA 1S7FA 2Z5UA 3GLLA 5F47A 5D4SA 4U0YA 2A68F 1CM0A 4NSQA 2H6CA 3U1DA 2FBKA 4EGZA 2IJZA
chains in the Genus database with same CATH topology
4OIOF 1D5VA 2L3DA 4RAZA 1T0FA 2ACJA 3IRRA 1IRFA 3R1KA 2R7DA 4F6AA 1ZRCA 4P55A 4P9FA 2D2WA 2JPCA 4A5MA 1HSJA 3TO6A 4TV7A 1S3JA 2XIGA 4LD5A 3HRTA 4L18B 2CG4A 3H5ZA 2PLYA 4UA3A 2QQ9A 3V8IA 4R9MA 4YG2F 1U6GA 2A3SA 1N71A 1WKMA 2O6GE 2OZUA 2HWVA 3S6KA 3VODA 1QGPA 4M73A 3K9UA 5J6XA 4MI4A 2YNDA 3NE7A 3GEZA 3W6KB 4UCPA 2QQAA 3J80K 5L3CA 3T0YA 1LNWA 4MBUA 1IB1E 1LDDA 4BHBA 3TOBA 5D5WB 4Q5SF 4L0YB 4AVPA 2NYXA 4MFJA 1FZPB 2YU3A 1G3YA 1T39A 3V7CA 2VZZA 4HX4A 4KVOE 2IPQX 4MNUA 5TRDA 3VFZA 1W7PA 3FM5A 1TLHB 4G7ZF 3SHPA 4ZGYB 3G3SA 2EK5A 2G3TA 1BM9A 1JE8A 3DR6A 2FS5A 4R79A 3LA3A 1IN6A 1MJ9A 3BROA 1K6OA 3PGPA 3KLNA 2M1BA 3K1NA 4NXYA 4MEXF 1B1BA 3TOAA 2K86A 3SXYA 2CQKA 5CVJA 3TT2A 1IRGA 2IA0A 2NNNA 1YTYA 2DBBA 3S2WA 5F64A 2OD5A 2YSRA 1BI1A 2CY2A 4C2ZA 1YVOA 2B3UA 1XSXA 3BY6A 1RI7A 3C3WA 2ZJ2A 2XROA 1I1GA 5G21A 1J2XA 1RO5A 4A31A 3E0KA 3E5XA 3HSRA 2P0WA 1GXQA 4FD6A 1XE4A 3E6BA 5HLIA 3QAHA 2P6GA 2RC4A 1O57A 1B9MA 2O61A 2J8NA 2Z3MA 5IB0A 3R95A 2MLGA 1IIDA 3ZMZA 5HS7A 3M9AA 3QRFF 5LRRA 1M4DA 4MFPA 1AWCA 2DPUA 2GXGA 1OPCA 2KIMA 3DNSA 4KIFA 4CYDA 3IKVA 1ZRFA 3IGRA 2DAOA 3GFJA 3KZZA 3LA7A 2OZGA 2LNBA 1BC7C 3JAMZ 4R8HA 2R98A 3E3VA 1MZBA 3ZP5A 5F46A 1I6XA 4KMUX 2ZXJA 1OYWA 2DT5A 1TNSA 2Y48A 4LLNA 3FNCA 1S29A 3FHZA 3BLNA 3TQNA 5KK1A 4O5VA 2FBHA 2F5FA 3HHGA 3T9YA 2F5EA 4RGSA 2OB0A 4XNHC 2VXZA 1PP8F 1FYKA 1LEAA 1BJAA 3WTXC 2FCKA 4UFWA 3KFWX 3IWEA 4CAXA 3KP5A 1U78A 1ON2A 3KEQA 1QSMA 4ZBGA 4HZFA 4OADA 4A6DA 2J5PA 1ZG5A 2O28A 4XPLA 2Y0MA 1KGSA 2EUIA 5H84A 5DD8A