2OZUA

Crystal structure of human myst histone acetyltransferase 3 in complex with acetylcoenzyme a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
253
Chain Sequence
RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQSIKKLSKLTGICPQDITSTLHHLRMLIRREKLIQDHMAKLQLRPVDVDPECLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase MYST3
total genus 78
structure length 253
sequence length 270
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ozuA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2ozuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ozuA02
2VN2A 1RO5A 5CLSA 1EV7A 2RKHA 1L0CA 3HHHA 2X4HA 4AVBA 4LD5A 1P4NA 4UUVA 3CXPA 4XRFA 3JW4A 4EM0B 2EV0A 3J81K 1YW9A 1E2XA 3F22A 3QPHA 3WODF 1XMAA 2CY2A 1I21A 4HDUA 5H84A 4G94A 3K0LA 4AVAA 3RJPA 4OIPF 2L02A 3ROUA 5HH1A 3BDDA 3T1BA 2G0BA 3DR8A 5LGUA 2DPUA 4NCZA 1U6MA 4HYEA 5L3BA 3IL2A 1K6OA 5IV0A 2EA2A 5EEHA 4M6YA 4UA3A 1KU7A 2XVCA 3UY5A 3VWEA 4DQ2A 3PFIA 2JDCA 4PSWA 5F47A 4AD9A 1FX7A 4BYYA 4LLNA 2QIRA 2KIFA 3DXJF 2Z33A 5F6FA 3DQVC 1IXRC 2BGCA 4U0YA 1LDDA 2MD5A 4KZTA 1TQIA 3VODA 3FMRA 5HS9A 2BSWA 3GX4X 4AG9A 2QENA 1M4GA 5E1ZB 3GYHX 4KLVA 1WRJA 2ETHA 1Q2CA 2A6HF 2LSOA 4AWXB 1ZG5A 1OYIA 5CVIA 2OZGA 4A6DA 2B58A 2GE3A 1AWCA 4OADA 2QWWA 2W85A 1KU9A 4HX4A 4EV0A 2Q44A 3JUWA 1XMKA 4HV6A 4CYDA 4YFJA 1K78A 4ZYHA 2A61A 3KETA 1ZGAA 1LDKB 2VBWA 2V1XA 1W7PD 1F5TA 1DUXC 2Y0MA 4FD6A 2DK5A 3J80Z 1XCVA 2FE7A 3IGRA 4ENJA 4G6QA 4NEXA 1IN5A 4A0XA 2V6CA 3FX3A 2HR3A 5HS8A 2VZZA 3RIRA 1R23A 1R58A 3HHGA 3ZMDA 1YX0A 4RB2C 2YR2A 4Z2YA 1FOKA 5FD6A 4F6AA 5E20A 2P7CB 4XNHB 2B0LA 2XV4S 3G3ZA 3GKRA 1T0FA 5LEKA 2W24A 5H6RA 2ISYA 1PU9A 2EFNA 1SD4A 3I71A 4BXUA 2K27A 2NNNA 4WCGA 3LAJA 3G3SA 4MY0A 4XSXF 3ZJ0A 1IXSB 1UB9A 3TQNA 4RGSA 2CW0F 4HW0A 4U7DA 1YYVA 2VE9A 1YLEA 1FSEA 1TQPA 1C0WA 3SHPA 2IPQX 4FT8A 4PGHA 3J81Z 5JR3A 4NXYA 2XUBA 1G3SA 2O8XA 4CAVA 4LGWA 4A5NA 2C6YA 1ON1A 4NHJA 3R0AA 1B4AA 1ZHFA 1WSUA 2KKOA 3RKWA 4HLYA 3HRMA 2RDPA 3F8KA 3WU1B 3L2CA 1T38A 1FSHA 3ABUA 2EV6A 4XBFA 2NRAC 5E96A 1XSXA 3Q9VA 4FHTA 1L3LA 1YS7A 2X7BA 1B6AA 3I64A 1T39A 4K2EA 1XDSA 3SXYA 2JPCA 4XPDC 2P4WA 4M73A 1CF7A 2XKPA 4IF5A 4UNOA 1RXTA 4ASNA 3HOSA 1REPC 1I6XA 4BH9A 4K30A 4AIJA 2ZW5A 5CVJA 2VI7A 5LEJA 3GEZA 1CJWA 1R1TA 3ECHA 4G8XA 3ULQB 4EJTA 3SXNA 2H94A 2PC1A 1J0RA 4FD5A 3M8EA 4LK1F 2YX4A 1P4WA 3WTUC 4WX9A 4BAYA 4KORA 2VXKA 4IVNA 4IRGA 3BJAA 3SHFA 1BC7C 1MZBA 2ESHA 3E5XA 3DEUA 2NAZA 3WTYC 1LB2A 3FIXA 2XHKA 3D2MA 1Y9WA 2AE6A 4R3LA 5ICEA 1U2WA 2EK5A 4XPLA 1O3QA 3KE2A 1S5KA 4KOTA 3FYNA 4OU0A 3H92A 1R7JA 1J7KA 2Z99A 2RQPA 5LGTA 2XAFA 4ETSA 5L3GA 1KUXA 4I09A 4P55A 2STWA 4AVPA 4LJZF 2Y75A 2JRTA 5ILUA 5BPDA 4QUSA 2ZXVA 2HTSA 1MGTA 4IHSA 2J8NA 4BHCA 1QBJA 1P4AA 1SQHA 1UHMA 4R87A 4LB5A 4NF1A 5AIQA 2F5CA 4A5MA 1YW7A 4HA8A 4KT5C 1ZG3A 4GCVA 1KA8A 1DPRA 2IA2A 2OBPA 1R00A 1LEAA 1YFHA 2D2WA 2Z0ZA 3GZ6A 4OMZA 4L9TA 1Z05A 4II9A 4CRYB 1FPQA 1GXPA 1VKCA 4EJWA 3S6GA 2C27A 2DK8A 3T9YA 2HWVA 5DEQA 3KP5A 1R1VA 3L9FA 2RNJA 4B8XA 2FNPA 1RUOA 3FXRA 1Z1DA 4YIIA 2R7HA 3TOBA 3FM5A 1UHWA 1P92A 2ZMEB 4A0ZA 1S3ZA 2ZW4A 4U0VA 2MA3A 3CUQC 3JTHA 2BUEA 2P6GA 2D4OA 3C7JA 3HRUA 2EVNA 5L3CA 5F48A 4Q5SF 1KUYA 3P9CA 4PK2A 3GW2A 1M44A 2OU2A 5D5UB 2GWRA 1IYKA 3E3VA 2HV2A 2TDXA 1ZREA 4Y49B 3WTZA 4B5PB 1OPCA 2CO5A 2RC4A 2IW5A 4L9JA 1HKSA 2XAHA 4NQWA 3TO7A 1MDMA 4CXFA 3CUOA 3FM3A 2ISZA 2OB0A 3JAMZ 4CHUA 1J4JA 2EFQA 3L00A 2FNAA 3T8TA 4UV8A 1SD5A 2QUFA 4U9ZA 2FE3A 2Z3YA 3TOAA 2GXGA 3LQQA 1HKTA 2NNYA 4KVOE 2F2EA 1TW3A 3FWEA 1Y7RA 4HZFA 3P7NA 3I4PA 4KVXA 3ZMTA 4MI4A 2PJPA 2R7FA 2O03A 3IKVA 4AG7A 1ZGJA 5LLQA 2H5MA 1IN6A 3K1MA 4KOUA 4PDKA 3MEXA 2EV5A 4O3MA 1IN4A 1YIOA 3E97A 1K7AA 3N97A 4KOXA 4GYIA 2J8RA 3NEUA 1XMTA 2KJBA 4ENKA 2K86A 2COMA 5DV5A 2WPXA 3LWFA 3WE3A 5KVRA 3RTRA 1YW8A 4H6ZA 2P6EA 3LQRA 3FHZA 4S04A 2AXLA 5FD5A 3LFKA 1S3JA 3P2FA 4Q4ZF 1EH8A 3R60A 3MWMA 4MQVA 4H0EA 1KZFA 3F8CA 1YR0A 3IWFA 3QRFF 3B02A 4HBLA 2CYYA 4N0BA 4M3SA 1RNLA 2J5OA 2FEZA 1LNWA 4EGYA 2PG4A 2R98A 1XGSA 3HRTA 6PAXA 3DPLC 3WG9A 5CNPA 1T98A 1JHFA 2CNMA 4B5PA 2XAGA 3D8PA 5D8KB 1RIOH 1SD6A 4FX0A 1DPUA 4L9VA 3I58A 4BQAA 1UCRA 3M7GA 1KU3A 5H6QA 2L4AA 4AIHA 5HDKA 3I59A 2OA4A 4JXRA 3KFWX 4P9UA 3SFZA 1S7OA 1XB4A 3T8RA 1XEBA 1WWXA 1V4RA 3EO4A 1Z9UA 3R96A 4I02A 3RYOA 4ONUA 5E18F 1WQ2A 1JE8A 4QVTA 1O7LA 5K5OA 3R9EA 1KUVA 4U5YA 2LKPA 2VBYA 1GHCA 3O6BB 1R5HA 4LG0A 2JT1A 3KP4A 3DSBA 1F4KA 2P7VB 2QQBA 1PUAA 2W57A 4EJVA 5F46A 3QB8A 2REEA 3GF2A 1OZPA 2P0WA 3HTUA 5ERIA 1CM0A 1IICA 1S7FA 2QM3A 1Q1HA 1G3WA 2DFIA 3I9SA 3R61A 2VEZA 4ESFA 2ADUA 1YK3A 3R9FA 3HYIA 1KU2A 1LEBA 3WTVC 3H3UA 1PDNC 3F8FA 1M1DA 4R8HA 1MJBA 4LLLA 3BP8A 1NE9A 4UXNA 2UXNA 4CICA 4HQEA 4BNCA 1XN7A 5E17F 2QECA 1D5VA 2XRNA 1OKRA 2EWNA 3Q9SA 4UWIA 3BJ7A 3IC7A 5GCNA 3CO7C 2E1CA 3CJNA 3ML6A 3KP6A 3RKYA 2FA5A 4EM1A 2L3DA 4Q48A 4UVBA 4CZZA 5HMNA 4M85A 3TFYA 5EBVA 4EJOA 2W25A 2MBFA 2A3SA 5J8CA 1ZRDA 3EXNA 4Y49C 1UFMA 4L5JA 3JAMK 5KTDA 2BEIA 3MZHA 1X3UA 1Q2YA 4PGGA 3KLOA 2P6FA 1USSA 3P2HA 3F0AA 2EFWA 3RYRA 4GXOA 1HBXG 3E6MA 3K9UA 1FWZA 2K02A 3GLXA 2YX7A 4ZBGA 1G4DA 1BOBA 4PCQA 3QU6A 2VC0A 3C26A 5DD8A 1HQCA 4P5OA 2CWEA 4XSZF 2HDCA 2PN6A 4KICA 4E8OA 2FRHA 4ZYGA 1JHHA 3ERED 4KOYA 2OZHA 5LRRA 4KOVA 3DKWA 2ZNZA 4F7ZA 2L54A 1SFEA 1E17A 3MFKA 2V9VA 1B87A 1ON0A 1W7PB 4R9MA 3S6FA 2ESNA 4GGGA 5FFZA 1I12A 3D5LA 4GS4A 4FD7A 3W6JB 4R79A 4YFKF 3W6XA 1RUNA 1XCBA 4UVCA 1PP7U 3GUDA 3ELKA 2FF4A 4G7HF 2P5LC 1Z4EA 2D4PA 3TGNA 3ABTA 3Q5FA 4AVCA 4Y15A 3FBUA 2ZJ2A 4A0YA 4CAXA 1W5TA 2IA1A 4CRZB 2KIMA 2LNBA 2KJCA 1HSTA 1T2KA 1IN8A 1RZ4A 2ZKZA 1R57A 2H09A 1G3YA 4AIKA 2PRBA 2FU4A 2E7WA 2YU3A 5LHHA 1K4JA 1LQ1A 2J5PA 2VE8A 1J59A 2DBBA 5JI6A 4BHBA 3DF8A 4ESJA 4X5KA 4F0YA 2W84A 1MJ9A 4KMUX 3FB3A 3QPTA 4CO8A 2G7HA 1K79A 1RI7A 2PR1A 1PUEE 1I1DA 3WGIA 5FLXZ 2JZYA 4KUMA 3GY9A 1HW2A 3CXQA 1TTYA 2B5GB 2JSCA 2QQAA 3F6VA 1BJAA 4WF2A 3EC4A 3V8KA 1P6RA 1AOYA 1D8JA 2OQRA 4Q47A 2YPRA 2M45A 2D1VA 3S6KA 1DDNA 4HV5A 1KQ8A 4RB1A 2EFPA 4ZZDA 2P5VA 1CF7B 3CLOA 3LAPA 2DXQA 4HNXB 2Z5UA 4RAZA 2M8EA 3WGGA 4YFXF 1QNTA 1BIAA 1S7AA 2DLLA 4M72A 2M5WA 3COAC 2ZXJA 4XLNF 4RGRA 2D45A 2WTEA 5D6FA 3EY5A 1KQ0A 2LF7A 1O7FA 1QZYA 4IPAA 3FNCA 5F1RA 5F64A 3OWCA 3V8LA 5LRSA 2AJ6A 5L3DA 1FZPB 3HSEA 1YVKA 2IRFG 1M4IA 2P5KA 2KIUA 5ICCA 5BPIA 3H3ZA 1D3YA 5ED4A 1U5TA 1ZLJA 2JEVA 4HLXA 1L0OC 1Z6RA 5FLXK 4M9XA 3K69A 3NRVA 1ZLKA 4G7OF 5JPHA 3PQKA 4M9SA 4J3GA 2F5EA 4MY3A 2HTJA 2Q4VA 4GO1A 4I01A 4OINF 1D8KA 5DCMA 1LDJA 2VOOA 1BN5A 5EC4A 3IRQA 2A69F 3IKTA 2CNTA 3HUGA 1ULYA 2V1DA 3D2PA 4Y17A 3PP9A 5HLGA 1XF8A 2GIVA 2ZFWA 1BO4A 4UHTA 1S29A 4G6DA 2GXBA 3F5BA 2XROA 2BYVE 1IRFA 1IRGA 2I00A 1ZG1A 5E1WA 1MD0A 4L8AA 4M6XA 3ZN1A 5LHGA 1ZN2A 1IAWA 3R9GA 3ZMUA 5JFRA 2GZWA 1SMYF 2VOPA 4KN7X 4FD4A 1SAXA 2A6EF 2XIGA 2IP2A 1BM9A 3K1NA 5HDGA 4JJXA 3RDIA 3J7AO 2ARHA 3MAJA 5J8FA 5D4RA 2PDOA 2RN7A 5D5WB 1USTA 2P6SA 3B8GA 1ZYRF 2IJLA 2VQYA 4RS2A 1S60A 2O3FA 5DUKA 4KIBA 2B4DB 3IRRA 3LSTA 2K4JA 2IL4A 2PI0A 3I59B 2ZCWA 1XGMA 1K78B 4KIFA 3VOEA 2ZO4A 2DO7A 3U1DA 1S7KA 4OLLA 2JTVA 4IUSA 2QYOA 4EVYA 2B4DA 1S6LA 4IF4A 3ZN0A 4U7BA 3HSFA 1IB1E 3LA7A 5HLHA 3EQLF 1FC3A 5FFXA 3R1KA 3I5UA 4PK3A 2HKOA 5IT3A 3IWGA 3BOQA 1J75A 3BLNA 1BBYA 2FCKA 1XGNA 5EEGA 5E8IA 2FS5A 4IJAA 3GZ5A 4MNUA 1U3EM 3CTAA 4KOWA 1ON2A 3BWGA 1W4MA 2DW4A 5ISVA 3D0SA 2F5IA 2RGVA 3E6CC 2L01A 2L4MA 4OMYA 3G8WA 1FNNA 4RB3C 4KN4X 3KLNA 4LFUA 3F3XA 2PMHA 2UWMA 2OZ6A 1R1UA 5DWNA 2ZNYA 2VODA 2P6TA 4N9IA 5FB2A 2OH1A 3LA3A 2R7DA 3FRMA 4HQMA 3CDHA 3LODA 3VEPA 3DR6A 4HNYB 1I5ZA 5KTCA 4IRHA 5K5RA 3L7WA 5CVUA 5HS7A 2LF8A 5FO5A 5CVVA 4UBRA 4JXQA 1MKMA 1LJ9A 3O2PE 5CYVA 1G3TA 4MGRA 3GFJA 4RI1A 2G3TA 3K9TA 4ZYDA 2REFA 2VONA 4ENNA 1IYLA 2BBYA 4I2OA 4MBUA 1QSNA 1YG2A 4MQ9F 4TV7A 1Z91A 3FMSA 1W7PA 2O61A 4WXHA 2I79A 4KOSA 5D8LB 2QLZA 2OD5A 1YQAA 2M1BA 3CUQA 2NYXA 2VT3A 5E1XA 3V7CA 2RVCA 1SMTA 3ZQ7A 5C82A 3FXTA 2XAQA 2GAUA 1G6NA 1CGPA 1OYWA 1WI9A 5ICFA 1Z7UA 3BZ6A 3BJ8A 1T6SA 3M8FA 3E5UA 4P9FA 5ICGA 2DU9A 5J6XA 3BPVA 4HAMA 1P2FA 1DP7P 3D3SA 1BI2A 3GFLA 5E8GA 3FZVA 3KCCA 3DP7A 2HUZA 5IB0A 1OYYA 1QQIA 4ON0A 2EA4A 3KP7A 2PFBA 4U0WA 2B3VA 2VXZA 3RPUA 3K1PA 2MLGA 1FLIA 3N7ZA 4RAYA 4YFNF 3CXSA 1YS6A 4XNHC 4EGZA 5IX3A 2F5DA 3EYYA 2EUIA 4KIGA 1YREA 5AONA 1ONVA 2DPDA 1XD7A 1WK4A 3BY6A 4RS8A 4O5VA 2XAJA 4JK1X 2G9WA 3E0KA 1ZARA 2BL1A 5K5QA 3QAHA 4JD6A 5K1YA 1R36A 1Y9KA 2EFOA 2GA2A 3GFMA 4OIRF 2V1UA 1V0CA 2MLKA 4LLGF 2D1HA 4E0AA 3WTSC 4LUAA 4KFCA 3T5XA 4EJUA 3MZYA 5KK1A 4QB9A 3QU3A 3KEOA 3SQNA 1FYKA 1S7LA 1IIDA 2HOEA 4R1HA 3GYAA 4PZJA 2GANA 4GYGA 1QO0D 1O57A 3CO6C 1BOAA 1IW7F 3M1EA 4RGXA 2FMYA 2O6GE 2FMLA 3F8MA 4LG0B 3SXOA 2CNSA 3TE4A 1B6BA 2WWYA 3LA2A 5H20A 2RV8A 1A04A 2DTRA 4MEXF 1QSOA 4P96A 2H6CA 2MH2A 4MJ8A 3S6HA 2UXXA 2Z10A 4U9YA 4S05A 4PSXA 2J8MA 5KTAA 3MCZA 2WPWA 2Q0OA 4E70A 3KP3A 2DT5A 1B9NA 3LD2A 4XPKA 5TJJA 2FBKA 5DCFA 1YLFA 1U5TC 1ZRCA 5BMZA 3RKXA 2PEXA 3ZZIA 4KUAA 3DNSA 5DUIA 3C1DA 3KZYA 4E2AA 1Q2DA 4MHDA 2FIAA 2NMTA 4LX9A 1I1SA 1NMTA 2H6BA 4WK8F 3TO6A 2HQNA 5HOOA 1WWZA 1NHAA 1B9MA 4L18B 3TDZC 2GQQA 1W5SA 5C88A 4UWJA 1NSLA 1M4DA 3O3KA 1U8RA 3VWDA 1LRZA 2JLMA 2CQKA 3V7RA 4QBJA 3ISPA 4KVME 3TCVA 1TQMA 4IXAA 3FF5A 2VZYA 2DAOA 4ESBA 1S7NA 1BIBA 1P4XA 3GFIA 3KZZA 1H9TA 4YGOA 2H27A 1XSVA 4KYWA 3U9GA 2HS5A 3L09A 2QQ9A 3OV8A 5ILVA 2QMLA 3EETA 4G9YA 3R95A 1KYZA 3V7SA 3BROA 4HOBA 2B4BA 4HF1A 4AB7A 2G3AA 1N71A 2QBYA 1F1ZA 3DPTA 3T90A 1F9NA 3EFAA 2PQ8A 2YSRA 1GVJA 3CUQB 4EQQA 2ZW7A 2Q4YA 1KQ9A 3HIFA 4JBAA 1MK4A 1TBXA 2HYFA 2HQRA 1H9GA 4A6EA 3EDPA 5F49A 1I1GA 4NSQA 4D0PA 4B09A 2PSWA 4I98B 4KUBA 4HKFA 5IT9Z 4KA4A 3ZPLA 3K2ZA 3P9KA 2A4NA 1XSDA 4OIOF 1GHEA 3ZP5A 3BPXA 2PR8A 4M71A 1EH7A 3QP6A 3JSOA 3HTSB 2B3UA 1IN7A 3ZMVA 4CS0B 3GO5A 3HRSA 1B59A 4OAEA 4FX4A 4UV9A 2P8TA 3E5QA 1SFUA 4I0AA 5BOXA 1OR7A 1FBSA 5AIPA 4MHGA 2VBXA 2A07F 3RPQA 3QP5A 1FBUA 1QZZA 2R3SA 2Z9OA 4OOIA 4BHPA 2A5YB 2ZW6A 1O3SA 4R3KA 2ATRA 4N9HA 5HLIA 2AS5F 1V3FA 1XDUA 4QC6A 1PP8F 1MJAA 3E6BA 4XLPF 3AAFA 4JQFA 1WKMA 4LMYA 4U88A 1MDMB 2MC3A 4JWPA 5LBQA 1VHSA 2IVMA 4LK0F 4UVAA 2ZBKA 5D5XB 1XGOA 3NQOA 4M9ZA 3F23A 3TTHA 1GXQA 3S2WA 3B73A 3TDUC 2BE5F 4RGUA 2XKOA 3V8JA 2X0LA 3JSPA 2CG4A 3QOPA 1VTNC 2A68F 2CFXA 4PV6A 2BV6A 3JVNA 2VC1A 1XIXA 1JGSA 2FT0A 3REOA 4XPDB 4B5OA 1TIQA 2K5TA 2IT0A 4QLCU 3HOTA 2HQYA 2NS0A 5D4SA 2FL4A 4L9NA 3F21A 4LB6B 3W6SA 2FSRA 3WTTC 3R4KA 1J5YA 3RYPA 2QVOA 1J9IA 4H6UA 3GWZA 1SFXA 5JVTA 4EVIA 4KMFA 4A2UA 2G7UA 3KP2A 1U78A 4YRHA 4HNWB 4YG2F 3M9AA 2VBQA 4JLYA 1KYWA 4ORFA 1J2XA 2VT2A 4MEYF 4YIFA 3C3WA 2FQ3A 1HSJA 4QWQA 1HW5A 3EUHA 2MH9A 5BS6A 1IF1A 2ZMEA 4CDGA 5TRDA 3MQ0A 3F6OA 4G7ZF 2Q7BA 4WWCA 2Q2EA 3FXUA 3WGHA 1FY7A 1FYMA 3WE2A 3WR7A 3SZPA 5LGNA 4O6JA 4L0YB 3GXOA 2DQLA 3IWZA 2KCWA 1QGPA 4Y13A 4ZH4F 3FXQA 2ACJA 2FXFA 2E7XA 4MTEA 2PBIA 1JXSA 3I3GA 3T0YA 2QZ8A 2JPBA 5JQ4A 1TNSA 1XE4A 2F5FA 5D5VB 4ENMA 4CAWA 5DWMA 1BI1A 3KEQA 3PGPA 4IHTA 1QSRA 4I0BA 2FIWA 1STZA 1S8NA 3PZJA 1FBQA 2OAZA 3C18A 1QSMA 2Q0YA 1U6GA 5H86A 4BMHA 5IT9K 5ILSA 1Z9CA 4MTDA 2HZTA 2JDDA 2DQRA 3HSRA 3TT2A 2WV0A 3PQJA 1TLHB 4HF0A 4WXCA 1YGHA 1O3RA 5FVJA 1ODDA 5L3EA 3F8NA 2STTA 2Q8KA 1FYLA 3P9IA 5JHUA 2CSOA 2HFHA 4EMSA 3ECOA 3F72A 3TO9A 2B5GA 2WC2A 5A2QK 5CVRA 3BJ6A 5D6EA 1Z6TA 5DDGA 1Z4RA 1H0MA 1BC8C 3N4MA 4I49A 2V79A 1IUYA 3WTWC 1HW1A 2OZUA 4M74A 5CJ9A 1QSTA 2FBHA 2HYGD 4L89A 2FSWA 2LDUA 5LHIA 3H4QA 3ZMZA 3FMQA 3GVAA 2IA0A 5L3FA 1ZH5A 4R57A 3KKWA 4HX8A 2FBIA 2UZKA 2QBYB 5HDNA 5I0CA 2O0YA 4IRIA 4L0ZB 1I27A 1KGSA 4L5IA 3V4GA 1ZRFA 2ZPAA 1TNTA 3I53A 4ZYEA 2EJRA 2BEOA 3EYIA 5FGMA 2XASA 3OOPA 5DYMA 1YVOA 3R6SA 1LVAA 3VFZA 3V8IA 5DCMB 2M87A 2ELHA 2R1IA 1HKQA 1IXCA 2PLYA 3E6DA 1IZ1A 2Q04A 4OIQF 1Y0UA 2R8VA 1BI0A 4KDPA 3SZTA 3MGDA 1YO5C 2EB7A 3WU0A 1OMIA 2Y48A 1EH6A 1B1BA 3U2RA 2K7LA 1HXDA 1R5GA 3NE7A 1R22A 3F8BA 2K4BA 1YTYA 4RB0A 3W6KB 5BQTA 1FP1D 3IHUA 3BJOA 4I7HA 5DD4A 3J80K 1O3TA 4HX7A 3DFGA 1SD7A 2DI3A 2KRFA 1BI3A 4WXDA 3DDDA 4DNCA 3W91A 2FOKA 3G73A 1QPMA 3I54A 3ZMSA 2XGXA 4ZZLA 3TKYA 4HF2A 2VBZA 4H89A 2M30A 3DV8A 4CGZA 2Z11A 2PMUA 4HDVA 3R0JA 2HEOA 3RI4A 2CGPA 5A2QZ 3VB2A 2GA1A 4EM2A 1UFHA 2HKXA 2O28A 2E1NA 2HGCA 3I0TA 1FP2A 1FT9A 4NB5A 3JTGA 1TW2A 2OQGA 1ZAOA 4KLWA 2FXAA 4A12A 3WTXC 5HVQC 1P0HA 4KNYA 1U5TB
chains in the Genus database with same CATH superfamily
3CCYA 2VN2A 1RO5A 2EILH 2JA2A 5CLSA 1EV7A 2RKHA 1L0CA 3HHHA 2X4HA 4AVBA 2E2JJ 4KSIA 3NAUA 9ANTA 4LD5A 1P4NA 1IO2A 3SI1A 4UUVA 2WBMA 4XRFA 3JW4A 4EM0B 5GPCA 3CXPA 5FUXA 2EV0A 3J81K 1YW9A 3FBNB 1E2XA 3F22A 3QPHA 2F6CA 2GLOA 4UFXA 5M5WJ 3WODF 2QSGX 2OCCH 3OYFA 1XMAA 2VI6A 2CY2A 1MNMC 1I21A 2CS3A 4HDUA 5H84A 4AM3A 1A31A 2DJNA 4G94A 3K0LA 1OYVI 2P6AC 4AVAA 3RJPA 4C2YA 3H35A 4OIPF 2L02A 3ROUA 1DP3A 1BUSA 5HH1A 4MHNA 1N75A 3BDDA 3MD2A 3T1BA 1PPFI 5EX0A 2G0BA 4B47A 3C2GA 2CQQA 5AG4A 3DR8A 5LGUA 5K7FA 2AFOA 2IMOA 2DPUA 2ZEGA 4NCZA 3H0GJ 1U6MA 4HYEA 5L3BA 3IL2A 2B8TA 4UCPA 4OIDA 1K6OA 2EBIA 2XB5A 1Q7LA 1YLOA 4P4JA 5IV0A 2EA2A 5LRJA 5EEHA 4M6YA 4UA3A 1KU7A 4C2UA 2XVCA 3HH2C 3UY5A 3VWEA 4DQ2A 1NH3A 3PFIA 4PSWA 2JDCA 3FSXA 5F47A 4AD9A 3BG3A 1EA3A 1FX7A 4BYYA 1X58A 2YNCC 4LLNA 2QIRA 1XC5A 1X4SA 2KIFA 3DXJF 2Z33A 4CYCB 4B13A 5F6FA 3DQVC 1TT5B 1IXRC 2BGCA 4U0YA 2KCXA 3IH4A 4FWUA 2QQ0A 2KZVA 3OYLA 1LDDA 2MD5A 4XLEA 1ZLHA 4A39A 4KZTA 3BG7A 2NU0I 1TQIA 3VODA 5HVHA 3FMRA 5HS9A 1MIJA 4XM3A 2XF6A 3GX4X 2BSWA 2Y9YA 4BJ5C 4AG9A 2QENA 2DKVA 4E1RA 1M4GA 1YW4A 5E1ZB 3GYHX 2DPTA 1MH4A 4KLVA 3TMOA 1FTZA 2MC4A 3AG3H 1WRJA 2ETHA 1Q2CA 2A6HF 2DA1A 1JKQC 1MNDA 2LSOA 3FEEA 4PK4A 4AWXB 2R4GA 5JHFA 1BL0A 1UUCA 1ZG5A 1LAPA 5B1BH 1OYIA 3ESWB 5CVIA 2L7FP 3GTJJ 2OZGA 5HVGA 4A6DA 2B58A 2GE3A 1AWCA 4OADA 4MFPA 1D0XA 2QWWA 2HYJA 2W85A 1KU9A 4HX4A 4IKFA 4EV0A 1OMTA 1JTXA 1AUGA 2IQ6A 2R7UA 2Q44A 3U1KA 3RO0A 3JUWA 1XMKA 4HV6A 4CYDA 4C7HA 1XJOA 3BG9A 3GLJA 4YFJA 3S14J 3W3CA 4P44A 1SGPI 1K78A 3H36A 1F36A 4ZYHA 2ECCA 2A61A 3KETA 1LDKB 1ZGAA 2VBWA 2V1XA 2DXIA 4TWEA 2NVQJ 1W7PD 2EIJH 1F5TA 2GBYA 2DDBA 1DUXC 2Z3MA 2Y0MA 3D67A 4FD6A 2CWFA 2DK5A 3J80Z 1XCVA 2FE7A 3IGRA 4OC2A 4ENJA 4G6QA 4NEXA 5HXDA 1TF9A 4PXCA 1IN5A 1OCOH 3KASA 2MSYA 5JLXA 2XGCA 4A0XA 3KI9A 2V6CA 3FX3A 5BNGA 2HR3A 5HS8A 4A3DJ 1QMUA 3RIRA 2VZZA 1R23A 3OSFA 4H4KC 1R58A 5GAHJ 2CQNA 3PDNA 4EEFG 3HHGA 1TWCJ 3ZMDA 3MZ8A 1YX0A 2KZGA 4RB2C 1XOVA 2LC2A 2YR2A 4Z2YA 1FOKA 5FD6A 2JA6J 4OC3A 4F6AA 5E20A 4BE2A 1CT2I 2P7CB 4XNHB 1TL8A 1Z5RA 1KONA 2WAQN 3G2BA 2B0LA 2MABA 2LVSA 2XV4S 3G3ZA 2BO9A 2HB6A 2ZXWH 3GKRA 1OCPA 1T0FA 5LEKA 2O8KA 2VQCA 2W24A 5H6RA 4GRIA 4D9JA 1IC8A 3GUXA 1LPQA 2ISYA 2WB1N 1PU9A 2EFNA 1SD4A 2WADA 3BR0A 3I71A 4BXUA 2K27A 2NNNA 1WJAA 4RM3A 4WCGA 3LAJA 2HXOA 2ROWA 3G3SA 4MY0A 4XSXF 3ZJ0A 3JTKA 3C2HA 1IXSB 2L7XA 1UB9A 4BKXA 3TQNA 1X10A 4RGSA 2CW0F 3E2IA 4HW0A 4U7DA 4YELA 1YYVA 2VE9A 3UFFA 4ZY2A 1YLEA 1FSEA 1TQPA 1H89C 3QQAA 1C0WA 1VQ7I 3SHPA 5HQ8A 2IPQX 3JRAA 4FT8A 4PGHA 5IPAA 3J81Z 4BACA 5JR3A 5AG7A 3OYMA 4NXYA 5DAEA 1ZGWA 3EUHC 1DS2I 2PJ1A 2RREA 2XUBA 1LAMA 1G3SA 2O8XA 4TNUA 3H8FA 1X1DA 2WA0A 1B72A 1TURA 4CAVA 4LGWA 4A5NA 1X1PA 4U87A 3CCMI 1ON1A 2C6YA 2OD1A 4NHJA 1GDTA 1D5YA 3R0AA 1B4AA 2Q43A 1ZHFA 1Y1WJ 4F9UA 1WSUA 2KKOA 3RKWA 4HSTA 4HLYA 3HRMA 2GKRI 2RDPA 3F8KA 3WU1B 4E7IA 3ERMA 1UG2A 4GI3C 3L2CA 1T38A 1CE3A 1JQGA 4PJNA 1FSHA 4MFEA 3ABUA 2EV6A 3VWBA 4XBFA 4BXFA 2NRAC 5E96A 4UUSB 2QSFX 2J9AA 4XMYA 2F4MB 1YW6A 1HCRA 4B6ZA 1XSXA 2XF7A 3Q9VA 5AG6A 1V5FA 2LBFA 2GLJA 3FMCA 5DS0A 3PUBA 3GTKJ 3KL9A 4FHTA 3I9V2 1L3LA 1YS7A 4QSHA 2X7BA 4P45A 1XX5A 1B6AA 3I64A 4BEHB 3S3OA 2JWTA 1T39A 1WKXA 4K2EA 2CV2A 1Z67A 1XDSA 1TXRA 3SXYA 2JPCA 3PFYA 2NVXJ 3J7YJ 2JA5J 4XPDC 3ASOH 1DU6A 2P4WA 1CGJI 2E36A 4M73A 1CF7A 2XKPA 2Q4ZA 2HDDA 2N71A 4IF5A 2OJED 4UNOA 1UELB 4XRMA 1RXTA 4ASNA 3HOSA 1WZ2A 1VQNI 5EJCA 3S32A 1REPC 1Z7KB 4JX5A 4CYOA 3PIOF 1I6XA 4BH9A 4K30A 2QEXI 5FLVA 4AIJA 2GKVA 1BR4A 4F92B 2MD0A 1ULKA 2ZW5A 5CVJA 1UHAA 1W36C 5LEJA 3GEZA 3S3NA 1R1TA 2W0TA 3OIPA 1CJWA 2DEAA 2VI7A 3ECHA 1X74A 4G8XA 2WSAA 3ULQB 4EJTA 1CGII 2BOAA 1W3SA 3SXNA 2H94A 1I6HJ 2PC1A 2EPFA 1J0RA 4FD5A 5F04A 3BR2A 3M8EA 4LK1F 2YX4A 4LG3A 1LE8A 1P4WA 4A3CJ 2ZJQF 2WB1A 3WTUC 4WX9A 4OVOA 4BAYA 2G9DA 2PJ5A 4UXIA 4BXXJ 4Y52J 5FRMA 2HQ5A 2KHMA 4KORA 2VXKA 4IVNA 4IRGA 2VJIA 4DJLA 1UJ8A 3BJAA 1X2NA 3MMYB 3SHFA 4BL0B 1M8BA 1BC7C 3FK7A 3KIOA 1MZBA 2H1LA 2B7EA 5B3SH 3O8GA 4NJRA 4FTHA 2ESHA 5HODA 1EE3P 3M3YJ 3E5XA 1ULNA 3DEUA 2FUG2 2NAZA 3K4BA 5J4YA 3HEFA 1SC7A 3VH9A 1ITYA 3WTYC 1LB2A 2Y0SA 4XQFA 2WZNA 3FIXA 2XHKA 3D2MA 4YIRX 1Y9WA 3LL7A 2AE6A 3PB9X 3SJEA 2E2IJ 3ZGKA 2ICWG 5M3FJ 4R3LA 5ICEA 4A38A 5IOYA 2VKEA 1U2WA 2EK5A 2HOAA 4XPLA 1O3QA 2Y69H 3I4MJ 3KE2A 1S5KA 4KOTA 4ANJA 4ZX8A 3FYNA 3B7IA 1WGXA 4OU0A 3HC7A 3H92A 5IYDJ 1K83J 1R7JA 3PSFA 1J7KA 2Z99A 2RQPA 3WHCA 5LGTA 3S2DJ 2XAFA 4ETSA 5L3GA 1UWYA 4IZZA 1ZTRA 4CCKA 2K40A 2CUJA 2GM4A 4D5CA 1KUXA 2ID3A 1V5GA 2QQDA 4I09A 1VDDA 1H8LA 3TC8A 4D1QA 1Y6IA 1VQKI 4P55A 3HOXJ 4AVPA 2STWA 1PCAA 2X51A 4LJZF 1MMSA 1BPNA 2BY2A 2Y75A 1PYVA 1BLLE 2JRTA 3X2QH 5ILUA 3MN2A 2Z3KA 3CT9A 3B2YA 2TRTA 5BPDA 4QUSA 2JK3A 2ZXVA 2HTSA 1MGTA 4IHSA 2J8NA 2M7AA 4BHCA 2GOMA 1P4AA 4Z6YA 1QBJA 1SQHA 1X12A 1UHMA 4UEZA 4R87A 3PL8A 4C3JJ 1ACIA 2Z1DA 3S2HJ 4LB5A 4NF1A 5AIQA 2F5CA 4A5MA 2DA2A 3FKIJ 1M8CA 1YW7A 4HA8A 4BGDA 2ZXIA 4KT5C 4B4CA 3OYHA 1ZG3A 3KR4A 4GCVA 1KA8A 1DPRA 2IA2A 2OBPA 1R00A 2FQ4A 1LEAA 3ZRGA 1YFHA 2Q51A 2D2WA 4X8IA 2FVGA 1YOVB 2DT6A 2Z0ZA 2QQEA 3ABMH 2KLOA 3GZ6A 4OMZA 4L9TA 1RKTA 1Z05A 4II9A 4CRYB 1FPQA 1GXPA 4AYBA 1VKCA 4UUSA 3Q3SA 4EJWA 4A3MJ 3S6GA 3H8GA 3E59A 2E5NA 2C27A 1U9OA 2DK8A 3FSYA 3SJFA 3T9YA 2HWVA 5DEQA 3KP5A 5E3LA 4A3KJ 1Z77A 1E3OC 1R1VA 1YX3A 3L9FA 3HKZN 2RNJA 3S93A 2DFHA 3MKWB 5EZGA 4B8XA 4KT6A 5FUVA 3CCEI 2FNPA 1RUOA 3FXRA 4MCQA 1Z1DA 4YIIA 4RM2A 1NG6A 5LD2C 2R7HA 2IGNA 3TOBA 1FIPA 3FM5A 5EMIA 1UHWA 1P92A 2ZMEB 4A0ZA 4BBSJ 1G2HA 1S3ZA 1UZCA 1IGBA 4U0VA 2MA3A 1XMXA 2ZW4A 3CUQC 1FTTA 3GOXA 2ZEDA 3K4CA 1ZO0A 3JTHA 2BUEA 2P6GA 3M4OJ 4BD9A 3Q0WA 2D4OA 3C7JA 3HRUA 3PO3J 1OBRA 2IAIA 2X6OA 5L3CA 3MVPA 3DPUA 4BDZA 2EVNA 3D4UA 3GIUA 5F48A 4Q5SF 1YRNA 1KUYA 3TW6A 2EZKA 3P9CA 1IRZA 4PK2A 2H1KA 3GW2A 1M44A 4NJQA 6CPAA 2OU2A 2DF5A 5D5UB 2GWRA 2Z3OA 1SGDI 3E3VA 1IYKA 1ETWA 2HV2A 2TDXA 1GLNA 3F9KA 3WTZA 1ZREA 4Y49B 1OPCA 3RZOJ 2CO5A 4B5PB 2RC4A 2DFEA 2IW5A 1ZQ3P 4L9JA 1XBUA 3FEDA 2OUMA 2F3CI 1IW4A 4BQOA 4HNUA 1I39A 4B48A 1HKSA 1Z2LA 1XFOA 1P9ZA 2XAHA 1MSFC 2K9SA 1VNDA 4NQWA 3TO7A 2M4KA 1MDMA 2ODDA 4CXFA 3CUOA 3H5AA 3FM3A 2ISZA 2OB0A 2E5ZA 3OWTA 3JAMZ 2C6PA 4CPAA 2R7RA 4CHUA 1ZR2A 1FNOA 2VB6A 3SI0A 1J4JA 1QZEA 5TGTA 1MBGA 2EFQA 3L00A 4E4HA 3RU0A 2FNAA 5GAGJ 3QNVA 2OC6A 5ELYA 4DOZA 1MBJA 4OMEA 3T8TA 4UV8A 2LP0A 3RKQA 1JJ6C 1SD5A 4ZDLA 3VYRB 3I56I 1ZG7A 2PJ4A 2QUFA 4G1PA 4U9ZA 5EG0A 3B3VA 1B8IA 2FE3A 2PJRA 4W9YA 2SGFI 2Z3YA 2NU4I 2IJZA 3TOAA 2GXGA 3LQQA 1HKTA 2E5RA 4ZY0A 2NNYA 4KVOE 4NNJA 4BJTA 2F2EA 1TW3A 3PB4X 2HNHA 2LB7A 3KEYA 3FWEA 1Y7RA 4R7MA 3BI0A 2N17A 4HZFA 3P7NA 2AHQA 3BG6A 1JTYA 3I4PA 4CCJA 4KVXA 3ZMTA 3LSJA 5CCLA 4MHYA 3D5RC 5EYRA 4MI4A 2PJPA 2IEKA 2R7FA 4RAGA 3FHNA 2O03A 4K3NA 3IKVA 4CCLA 4AG7A 3CF2A 1ZGJA 4IHMA 5LLQA 3PEIA 4R6TA 3HG9A 2H5MA 1BJZA 4OAZA 1XBTA 5GP9A 1IN6A 3K1MA 2SGPI 9WGAA 4PUSA 4KOUA 4RLFA 2E60A 4PDKA 3MEXA 4UB8C 3KQZA 2EV5A 4O3MA 3MRUA 1IN4A 4ZI6A 3FK6A 1YIOA 3E97A 4YRVA 1K7AA 1J09A 2F8HA 3N97A 4FE4A 4KOXA 4GYIA 4M3DA 1Y0RA 2J8RA 1MMNA 2OF7A 3NEUA 4B1RA 1D0YA 1IGNA 2AFXA 3B6CA 1XMTA 2KJBA 4ENKA 2K86A 3ZR8X 2COMA 5DV5A 2WPXA 1E3HA 3LWFA 2ZSIB 1Z8TA 2KPMA 3WE3A 2ORVA 2ORWA 5E3MA 4P4BA 5KVRA 4JX6A 1YW8A 3RTRA 3H0DA 1HPTA 3DEWA 5F09A 3N05A 5GADJ 1PCEA 3LQRA 2P6EA 4H6ZA 3FHZA 2WAFA 1F43A 4S04A 1AMPA 4RBOA 2JW6A 1YTPA 1U5KA 2AXLA 5FD5A 3LFKA 1ZLIA 2R7QA 1WFXA 1AU7A 1S3JA 3A03A 3P2FA 1AHDP 2HOTA 1SEUA 4M3GA 3PJRA 5FKKA 1YU6C 1TUSA 5K8MA 4Q4ZF 3I1UA 3PFOA 1EH8A 3R60A 2LG4A 3MWMA 4MQVA 4H0EA 1Y8QB 4KISA 1KZFA 3F8CA 1RETA 1PTRA 1YR0A 2HVRA 2JUCA 3I3LA 3IWFA 2CJSC 1APLC 3SYTA 1SGRI 4MHPA 2PJ8A 4C2MJ 3ABKH 3B02A 3QRFF 1TC3C 4HBLA 2CYYA 4N0BA 4QTRA 3M07A 1AKHB 2PJ9A 4M3SA 1RNLA 2J5OA 2DYSH 2FEZA 1LNWA 4EGYA 2PG4A 2R98A 1XGSA 2WAEA 3HRTA 6PAXA 1N78A 2C1CA 2J87A 2C6CA 3CZXA 1NK2P 3DPLC 2NOGA 3WG9A 5CNPA 2BXYA 1T98A 3OL0A 1JHFA 1FJLA 1ZG8A 5E79C 2X6XA 2XAGA 2CNMA 3D8PA 4MCSA 4B5PA 4PXEA 3WHBA 5D8KB 1RIOH 1SD6A 4FX0A 2W7NA 1YHQI 1DPUA 2XEJA 4L9VA 1WTJA 3PO2J 3A02A 3CF5F 3HL2A 3I58A 4BQAA 1UCRA 3CCRI 3M7GA 1KMAA 1LANA 1TBQR 1KU3A 4P4IA 2VJ4A 3DBLB 5H6QA 2VQGA 1W0UA 2R7XA 4UCNA 2L4AA 2JJ7A 3CZ6A 2PJBA 3RZDJ 4AIHA 1XPXA 5HDKA 3I59A 2OA4A 4D7MA 4JXRA 2EZHA 3CC4I 4CGPA 3KFWX 3O8HA 2JMWA 4P9UA 3SFZA 1S7OA 1XB4A 7WGAA 3T8RA 1UMQA 2CV0A 1WWXA 1XEBA 3L2NA 1V4RA 2X1DA 3EO4A 2VPRA 1Z9UA 4I02A 3R96A 2NVYJ 3RYOA 4ONUA 5E18F 3FBIB 4RMNA 4MFLA 3HOYJ 1WQ2A 3AKZA 4XIDA 2VXDA 1JE8A 4QVTA 3NWTA 1O7LA 5K5OA 4UB6C 3R9EA 4JP0A 1KUVA 4U5YA 2LKPA 2VBYA 2R5ZA 1GHCA 3O6BB 1R5HA 4EWTA 4LG0A 3VYTB 3IU2A 2JT1A 3HGYA 3KP4A 4ZYQA 2O9LA 1F4KA 2HPMA 2P7VB 2BZTA 1R49A 2QQBA 2NU2I 2YUUA 3DSBA 2EIMH 1PUAA 2W57A 4EJVA 2LD5A 2MFZA 3HOUJ 5F46A 2EH3A 3V42A 2K3PA 4D7NA 2REEA 3GF2A 1OZPA 3FXJA 2P0WA 5J40A 4AIDA 2IGKA 3HTUA 5ERIA 5B5EC 3VARA 4BBHA 1G8XA 1CM0A 1IICA 2Y2ZA 2LR8A 3OY9A 1S7FA 3DTIA 2QM3A 3BHXA 1Q1HA 1G3WA 2DFIA 4IHVA 3I9SA 1WI3A 5LYLA 3KYCB 3OL3A 3R61A 1X1BA 3JRCA 2VEZA 4ESFA 2ADUA 2N1AB 4OP4A 2CUZA 1HLVA 2X48A 2XGDA 1YK3A 1JKPC 1F2OA 3R9FA 3HYIA 1KU2A 2F4OB 1IV6A 1LEBA 2ZELA 3WTVC 3H3UA 1PDNC 3F8FA 1M1DA 4R8HA 1MJBA 3LSIA 4LLLA 1JKOC 3BP8A 1NE9A 4UXNA 2UXNA 4MCRA 2PMZN 3KPHA 3CC7I 4CICA 1HEEA 4RLQA 3FXLA 4CGOA 4HQEA 2DFFA 1XN7A 4BNCA 5E17F 3GTPJ 2QECA 3HPGA 1D5VA 3S9NA 1FOYA 1Z0XA 2XRNA 1OKRA 2EWNA 3Q9SA 1IDZA 1IY6A 1DTDA 4UWIA 3HOWJ 1Z3XA 5C3EJ 3BJ7A 5J1YA 3IC7A 2F48A 1PJUA 5GCNA 3CO7C 3CMEI 3CJNA 3LNQA 2E1CA 4FE7A 3NFZA 3ML6A 1NG7A 2ZC2A 3KP6A 3RKYA 4UIBA 2FA5A 4B43A 3IU1A 2E35A 2OTJI 4EM1A 1T0FC 3H9JA 4XR6A 1AYEA 1VQLI 2DT7B 2V1CC 2L3DA 4Q48A 2E73A 4UVBA 4CZZA 5HMNA 1GUUA 2M5XA 1VQ4I 4M85A 2LRDA 3ISXA 3TFYA 2EZIA 3LSKA 4CUGA 5EBVA 3B3CA 4EJOA 2W25A 1ETQA 1CPSA 2MBFA 4PQAA 3RSNA 1NSAA 2A3SA 4XLCA 2JUGA 5J8CA 1ZRDA 2V8VA 2R7WA 3DGVA 7CPAA 3EXNA 4Y49C 2ZENA 3E0JB 1UFMA 1FMWA 4L5JA 3OYGA 5THWA 3JAMK 3BLYA 4B10A 4CYCA 4FAIA 2Y0SN 4PJ0C 5GTIC 2NU1I 5KTDA 1YQEA 2BEIA 3MZHA 2CWGA 1X3UA 3DKXA 2X52A 1Q2YA 4PGGA 3KLOA 4A33A 2P6FA 2V7FA 1USSA 3P2HA 2W4SA 3F0AA 2EFWA 1HEVA 4EMEA 3IUOA 3RYRA 1PTQA 2QVPA 2IGMA 1LE8B 1ENHA 1UG0A 4GXOA 1FT7A 3RAMA 3NA6A 1HBXG 3E6MA 2QJ8A 1FWZA 2K02A 3K9UA 3GLXA 5LRKA 2YX7A 1MBHA 4ZBGA 1G4DA 1BOBA 2XAUA 1MH3A 2OV7A 3QU6A 4PCQA 4H2KA 3SDGA 2VC0A 4I6ZA 3NARA 3Q0VA 3C26A 1D1BA 3CMAI 1X4PA 5DD8A 2WGCA 2R5YB 4CAFA 1HQCA 1YRNB 1ETVA 4P5OA 4A3JJ 2LLKA 1Y8FA 3VYUB 2CWEA 4XSZF 2DOEA 4FBEA 1WH5A 2HDCA 3TP3A 4MHZA 2PN6A 4CCOA 4KICA 4Y7NJ 2FRHA 2N8GA 4E8OA 3ZQHA 1JHHA 4ZYGA 4IL6C 3ERED 4KOYA 1OCRH 2OZHA 4NGQA 5LRRA 2X6YA 3OXFA 4KOVA 4P10A 4A69C 1HDPA 3DKWA 2ZNZA 4DYOA 2CQ7A 3G1OA 3UR3C 4F7ZA 4XN3A 2L54A 2XEFA 4FETA 1SFEA 5AGEA 1E17A 3MFKA 2V9VA 3DBRB 1B87A 1W7PB 2LMDA 1ON0A 4R9MA 1CSOI 3S6FA 4FCYA 2ESNA 4GGGA 5FFZA 1TP4A 1I12A 3D5LA 1PYTB 4GS4A 4FD7A 5GAEJ 3W6JB 3AG1H 3OR1C 4R79A 2AFUA 3ZCOA 4YFKF 3OS0A 2HXIA 3PB7X 3W6XA 1RUNA 3KHXA 1V55H 1XCBA 3QYEA 1YJWI 2WY8Q 4UVCA 1PP7U 3GUDA 3AL0C 3ELKA 2FF4A 1T95A 2P5LC 4DZPA 4G7HF 1Z4EA 2D4PA 3RZAA 3FXOA 3HKZA 1JJ8C 3TGNA 3ABTA 3Q5FA 4AVCA 3ZQIA 4M6HA 4Y15A 3A0HC 5EF6A 1YSJA 5KHDA 4R76A 4N4OB 2ZJ2A 4A0YA 3FBUA 4CAXA 4ZDOA 1YJ9I 1W5TA 2IA1A 2VQHA 2XGEA 4CRZB 2KIMA 2LNBA 2KJCA 1A35A 3GLLA 1FAQA 1HSTA 2V1NA 3HZJA 1T2KA 4HEA2 3CD6I 1WGTA 1VIXA 1IN8A 4A37A 1PUFA 3VPRA 4AMLA 5FJ8J 4I99C 1RZ4A 3PB6X 2ZKZA 3KX2A 3VSLA 5J47A 1V54H 3D00A 1R57A 5I4MA 4IHWA 1P7JA 2H09A 1G3YA 1CQTA 2O4HA 4AIKA 2PRBA 2DMNA 2FNFX 5FKMA 2JA8J 5EX3A 4NGTA 4IX7A 2FU4A 2E7WA 2YU3A 5LHHA 5KAFC 5GTHC 5LFAA 1Y1CA 1K4JA 2DMPA 1LQ1A 3ZQFA 4BE1A 4C2XA 2WY7Q 2J5PA 2VE8A 1J59A 2VL1A 2DBBA 4C30A 5JI6A 3NH4A 4E7HA 4BHBA 4NDLA 3S8PA 1YI2I 1BAVA 3BR3A 3DF8A 4ESJA 4X5KA 2V6EA 4F0YA 2W84A 1V1IA 1MJ9A 2HU9A 2ZMEC 1G59A 2PVWA 2ECBA 4KMUX 3FB3A 4B14A 2CMPA 3S15J 2UVOA 3QPTA 4CO8A 2G7HA 4BUPA 1K79A 1RI7A 3GCMA 5JH9A 2YS9A 3AFHA 3SJGA 2ME6A 4M6VA 2PR1A 3DLLF 1PUEE 2H8WA 3PIPF 2YGWA 1I1DA 4YEJA 3WGIA 5FLXZ 2IS6A 2QPOA 1XMBA 2CW8A 2JZYA 4G12A 4KUMA 2XDVA 3GY9A 1OCZH 1HW2A 5F0CA 2NSMA 3CXQA 1TTYA 2B5GB 2JSCA 2QQAA 4MFKA 3F6VA 1BJAA 4WF2A 3EC4A 5CBMA 1Z21A 2E1OA 3V8KA 3UEYA 1PJRA 4C3HJ 4XK4A 2K9QA 4F8ZA 1P6RA 2LH9A 4F9VA 3D7FA 1FOWA 1AOYA 1D8JA 2OQRA 4Q47A 2YPRA 4L5EA 3S3MA 1R9TJ 1FYBA 1MMAA 2M45A 1WJBA 4II2A 1HDUA 4PJJA 1Z7LA 2D1VA 3S6KA 1DDNA 4HV5A 1HC8A 2VJJA 1POGA 5F27A 3GB0A 1KQ8A 1VHEA 2QKLB 2EFPA 4ZZDA 4RB1A 2P5VA 2PE3A 2QF7A 2X85A 2KMOA 5AG5A 2O5RA 1P7IA 1CF7B 2AFZA 1MNEA 2I10A 1AN1I 3CLOA 2DJIA 3LAPA 1TWHJ 2QKMB 2OR4A 2DXQA 3HOVJ 2IS1A 4HNXB 2Z5UA 4RAZA 2ABZA 1M4LA 3CCQI 2LK2A 3ZQQA 2AFSA 3LWUA 2M8EA 3WGGA 3OR2C 3ZXSA 1BA5A 4YFXF 3MKZA 1QNTA 1BIAA 1S7AA 3V7ZA 2DLLA 3T8WA 4M72A 2M5WA 3ABLH 3COAC 1IDYA 4XLAA 2ZXJA 4XLNF 2E1MB 3D7GA 1K6YA 4RGRA 1XA6A 2AFWA 3PSIA 1R0RI 2D45A 2WTEA 5D6FA 2NS8A 3M8JA 3EY5A 3B6AA 2AFMA 1BR2A 2LYCA 1TWFJ 2HVSA 5G20A 3S1RJ 4F55A 1KQ0A 3S1QJ 2LF7A 4NC8A 1LOKA 1O7FA 5BWAB 3FH4A 3HBLA 1QZYA 4IPAA 4M3FA 4E7JA 4IK2A 2Z2SB 2YQPA 3FNCA 5F1RA 5F1JA 5F64A 4NGNA 3LSRA 2V8GA 3OWCA 4R8FA 3V8LA 5LRSA 2AJ6A 3I55I 5L3DA 1FZPB 1DS3I 5IB9A 4OIWA 4HSRA 4JCVE 3HSEA 3PNTA 1YVKA 1BR1A 2IRFG 1M4IA 2P5KA 3A4CA 2KIUA 3UNGC 1ETKA 5ICCA 5BPIA 2JVHA 3BTJA 3UEJA 3H3ZA 1D3YA 5ED4A 5DM7F 1U5TA 2AO9A 3S9MA 2WV1A 3OXLA 1ZLJA 2EIKH 2HI3A 4HLXA 4C3IJ 2JEVA 3BJIA 1CG2A 1L0OC 4DGWB 1VHOA 4Y33A 1Z6RA 5FLXK 4M9XA 2SGDI 1FEXA 2AXTC 3BR5A 3K69A 3NRVA 1ZLKA 4G7OF 1RTQA 5JPHA 3OIQA 4SGBI 1H0ZA 4LOCA 2R0QC 2ODFA 1XRYA 3PQKA 3OYCA 3FXKA 4M9SA 1YMEA 2F5EA 4J3GA 4MY3A 1Y0YA 2HTJA 3ZOBA 2X9DA 2Q4VA 4GO1A 4I01A 3DU6A 1VQ6I 3TJQA 2N52A 3DLAA 4G6TB 4KSFA 4UEFA 2Y9ZA 2BVMA 1RR7A 5FKLA 5JVGF 2DPSA 4JZ0A 4O23A 4OINF 1WGCA 1RKWA 3R5DA 3G1LA 4FUUA 3DBHB 2VPLA 1D8KA 5DCMA 1LDJA 1TOTA 3KQXA 1QVTA 2VOOA 2BY3A 1BN5A 5EC4A 2NOJB 4UUTA 2A69F 2FD5A 1SVMA 3IKTA 3IRQA 3J7AY 2CNTA 4HPSA 3LACA 3HUGA 2P81A 5B1AH 1ULYA 4XNFA 5LYIA 1SFKA 4Z65A 1WPKA 5J1RA 2V1DA 3QWPA 3D2PA 4PFPA 4Y17A 1R79A 3PP9A 1NTCA 5HLGA 1XF8A 4UY8I 4W1UA 2GIVA 2ZFWA 1BO4A 4UHTA 1GT0C 1SANA 3K4LA 3VDXA 2PJAA 2RB7A 1S29A 3UKGA 3HJEA 4G6DA 1LVKA 2GXBA 3F5BA 2DA5A 1Y39A 3MKLA 2XROA 4MRIA 4NGSA 2BYVE 1IRFA 3H9QA 4DYRA 5HLTA 1IRGA 2I00A 3EPZA 3PBEA 1ZG1A 1TF8A 5E1WA 1MD0A 3PUFA 3I4NJ 4L8AA 4M6XA 3SZGA 4M6GA 5A27A 3G71I 3A0BC 3ZN1A 5LHGA 3WABA 3WG7H 3G6EI 1ZN2A 1VQPI 1IAWA 4NFRA 3R9GA 2POKA 4BQNA 3HUGB 2L9NA 3ZMUA 5JFRA 2GZWA 4KSAA 1SMYF 2VOPA 2UZ3A 3DLJA 4CYQA 4KN7X 4FD4A 1JUMA 1GVDA 4MFQA 2C6GA 3EUAA 1SAXA 2A6EF 2XIGA 2IP2A 1BM9A 1YX5A 4MIMA 1KZHA 3K1NA 1R43A 1RC9A 2JRMA 5HDGA 3RDIA 4IHXA 3J7AO 1U8BA 3FX6A 4JJXA 4MXUA 2ARHA 3MAJA 4ZTJA 5J8FA 4IHYA 1P9GA 2L5QA 4XRSG 2QSHX 5D4RA 2EK8A 4DUKA 3ASNH 4FQGA 1SGQI 2PDOA 3CDIA 3BQZA 4I76A 2RN7A 5D5WB 1USTA 1NXUA 2P6SA 3FISA 3B8GA 3CMYA 1ZYRF 2IJLA 2VQYA 1CT0I 4RS2A 1Z8XA 1S60A 3FECA 4BY1J 2COBA 2O3FA 5DUKA 4KIBA 2B4DB 4LQ6A 3IRRA 3LSTA 3TL4X 2K4JA 4OAYA 2IL4A 3HPHA 2PI0A 3I59B 2ZCWA 1LCPA 4HPQA 1XGMA 4E7SA 3CESA 4A3EJ 1K78B 2ZFUA 4KIFA 1A36A 3GTMJ 3OXGA 3B4VC 3VOEA 4A3GJ 3IC1A 3JRUA 2VQLA 2ZO4A 1IY5A 1DQUA 2DO7A 1WJDA 3U1DA 1S7KA 4CSWA 4OLLA 2JTVA 4IUSA 1JKRC 2QYOA 2GIZA 4CGLA 2GKTI 1ULMA 1EKEA 4EVYA 2B4DA 1T08B 3OYKA 1S6LA 4IF4A 3C2BA 2BW3A 3ZN0A 5FLMJ 4U7BA 2TCTA 3HSFA 1IB1E 2HDWA 3L2UA 3BR6A 3LA7A 2W48A 5HLHA 4HNVA 3EQLF 1YJNI 2VUMJ 1FC3A 1R4MB 2L9VA 5FFXA 2A6TA 2WYRA 3R1KA 3RBUA 2JZMA 5GPAA 4AC0A 4Q7AA 3I5UA 4PK3A 2AQEA 3NH5A 1VQ8I 4MFZA 2HKOA 3BR1A 5IT3A 4A3FJ 5JHWC 3IWGA 1JT0A 3BOQA 1WHUA 1J75A 4AXVA 3R5CA 1VQMI 1IG7A 3BLNA 1BBYA 2FCKA 1X3ZB 2L7ZA 3HB9A 1RR8C 4CYNA 3K6GA 1XGNA 5EEGA 4CCNA 2K85A 5E8IA 2FS5A 3TP0A 1OR7C 4IJAA 2VASA 5K7HA 1ETOA 3GZ5A 4BS9A 2ZEHA 3D66A 4MNUA 2GFQA 2W82A 3OS2A 1U3EM 2DA6A 3CTAA 4KOWA 1ON2A 3BWGA 1W4MA 2DW4A 1SGYI 5ISVA 3VDPA 2BOLA 3D0SA 3RQIA 2F5IA 2RGVA 3E6CC 1LKXA 1RRJA 2L01A 2L4MA 2F7VA 5K8NA 1ZR4A 4OMYA 2JBJA 3G8WA 4DYCA 3HDDA 1FNNA 2SGEI 3IWWA 4P4FA 4RB3C 4KN4X 3W6VA 3KLNA 3PNYA 1K4SA 4NGPA 4LFUA 3F3XA 2PMHA 2UWMA 2OZ6A 1R1UA 5DWNA 3DKYA 2ZNYA 4PFOA 2VODA 2P6TA 1TT0A 4N9IA 5FB2A 2BUSA 5E3RA 2OH1A 3QPSA 3LA3A 4HG2A 2R7DA 1EJ9A 3FRMA 2LY9A 4HQMA 3CDHA 3LODA 1A5JA 4IQJA 1N77A 3VEPA 3DR6A 2L9RA 2M9HA 3HOZJ 1HJAI 4HNYB 1I5ZA 3BTCA 4IRHA 5K5RA 3IH2A 3L7WA 3SDBA 3L2RA 5KTCA 5CVUA 5HS7A 2LF8A 2B0UC 5K8OA 5FO5A 5CVVA 2R5ZB 4UBRA 4JXQA 2JVGA 1MKMA 1LJ9A 2E19A 3O2PE 3W2VA 3CDLA 5CYVA 2LY1A 1G3TA 2R7SA 4MGRA 5F0FA 4BU2A 3BI1A 3BXMA 3V38A 3GFJA 1Y0NA 4RI1A 2G3TA 3K9TA 3OL4A 4ZYDA 2VLAA 2HC9A 2GU2A 2REFA 2L7KA 2VONA 2WUUA 4DBQA 2XEGA 3H8EA 4ENNA 4J00A 1IYLA 5FKOA 1YIJI 1BW5A 2BBYA 4I2OA 4MBUA 5J1UA 1QSNA 1YG2A 4MQ9F 4TV7A 1GV5A 5EDNA 1Z91A 3FMSA 4DIQA 1W7PA 4EFDA 4CA0A 4RAFA 2F4IA 1JI8A 2YNCA 2K9MA 4WXHA 2ZJRF 2O61A 1Z8WA 2I79A 4KOSA 4CYPA 3PB8X 2X1CA 5D8LB 5EGOB 3FKJA 2QLZA 3CP8A 2XRCA 4DJAA 2OD5A 1YQAA 3KGQA 4C7IA 1S9HA 1QU3A 2M1BA 3CUQA 1LR8A 1X19A 2NYXA 4MLOA 2K5CA 2VT3A 5E1XA 3H3VK 3V7CA 2RVCA 1H88C 2M7BA 1SMTA 3ZQ7A 5C82A 1LFWA 3FXTA 2XAQA 4LITA 2GAUA 3CXLA 2YU9J 1U9NA 2Z3PA 1E3PA 1TKHA 1CHOI 1G6NA 1CGPA 1OYWA 1WI9A 1RPWA 5ICFA 2ERWA 4Q38A 1Z7UA 2LREA 2MG4A 4AYBN 2M4GA 5IP9J 3BZ6A 2UUZA 3SFIA 3CJRB 3BJ8A 1T6SA 2V1CA 3M8FA 1D0ZA 4XRSA 3E5UA 1X2MA 4P9FA 5ICGA 2NU3I 2WAQA 3BCBA 2EK9A 2DU9A 4KJZA 5J6XA 4FASD 3BPVA 1ZELA 4HAMA 2XSDC 1TBNA 3K4NA 4UIAA 1P2FA 3GTLJ 1DP7P 5FRNA 1WCMJ 3D3SA 3M1CA 4MCPA 3BQYA 3GFLA 1BI2A 3DU5A 5E8GA 5FUYA 3FZVA 1JWQA 3KCCA 3DP7A 3ZQCA 3D1NI 2HUZA 5HVFA 5IB0A 1OYYA 1QQIA 4ON0A 2EA4A 3KP7A 2JQ7A 2PFBA 4U0WA 2B3VA 2DYRH 3B3TA 2VXZA 3RPUA 3AG4H 3K1PA 2EBJA 2GXAA 2MLGA 2DN0A 3OYJA 4E7ZA 2LKXA 4XKWA 3D7DA 1LR9A 3KHZA 4OC5A 1FLIA 3N7ZA 2Z3LA 4RAYA 4YFNF 3CXSA 1P9QC 4GDFA 1F57A 1YS6A 1OVOA 4XNHC 3L1PA 3A01B 4EGZA 3K2AA 1VQ9I 5IX3A 2F5DA 3SGBI 3D68A 3EYYA 1DU0A 1VGYA 3GTOJ 2L7MP 3E1SA 2EUIA 4RA2A 2CJJA 4KIGA 1YREA 5AONA 1TWAJ 4A32A 1QQ9A 1ONVA 4MFJA 3SEZA 1FIAA 4KITB 2DPDA 3ZQGA 2WVJA 1XD7A 1WK4A 1HDDC 4RDUA 1WJ5A 3BY6A 4KS9A 4RS8A 3CPAA 2VKDA 4O5VA 2XAJA 4JK1X 1DE4C 2G9WA 3E0KA 3DTEA 1ZARA 3CDXA 4ZTFA 3HGGA 2BL1A 4UFWA 2JYYA 2I3CA 5K5QA 3K7AJ 4MPIA 1IU8A 2L8EA 4ZDPA 3OYEA 3QAHA 4JD6A 1TKFA 3CCUI 5K1YA 1R36A 4C2ZA 2DODA 3W2AA 1Y9KA 2DA7A 5EG0B 1JGGA 2EFOA 5D29A 3VYSB 2GA2A 2HVQA 3GFMA 4OIRF 2V1UA 3BG5A 1V0CA 5D8NA 2MLKA 2YUSA 4LLGF 2D1HA 3CCLI 2ZEFA 4E0AA 3WTSC 2DCEA 2PJRB 4LUAA 4KFCA 1LR7A 2CUEA 3BTLA 3T5XA 1ARMA 1CT4I 4BY7J 4EJUA 3MZYA 5KK1A 2L9SA 4QB9A 3QU3A 3KEOA 3SQNA 1K61A 1FYKA 1S7LA 3WC7A 1IIDA 2HOEA 3IJ3A 3HXLA 4R1HA 4PZJA 2GANA 3GYAA 4ZJZA 5HI7A 4GYGA 2W00A 1GV2A 1QO0D 3GTQJ 4NUBA 1O57A 3CO6C 1PUFB 1BOAA 3FXMA 1IW7F 1W5CC 3M1EA 4RGXA 2FMYA 2O6GE 4A93J 1QPIA 4D5FA 3A9LA 1XX6A 2FMLA 3F8MA 5M5YJ 4LG0B 2CNSA 3SXOA 4BJ6C 1B6BA 4MMOA 4IOAF 2LEOA 3TE4A 5M5XJ 4PPZA 3CJTB 2A05A 4IEJA 1K4TA 2WWYA 3LA2A 3K2KA 1TKJA 5G22A 5H20A 2RV8A 1A04A 3OIOA 4ZX9A 2DTRA 4MEXF 5E3NA 2QQCA 3QTLD 1QSOA 3Q0UA 4Y3OA 4P96A 2LKSA 4GM5A 2O7OA 3L2WA 2H6CA 2CW7A 2MH2A 1NUBA 2UXXA 4MJ8A 3S6HA 2Z10A 4U9YA 2R7VA 5C4XJ 1X1CA 2XF5A 3MKYB 3WT4A 4ZC3A 4PSXA 4S05A 3QOEA 2J8MA 4P6YA 1OMUA 5KTAA 3MCZA 5HNFA 2L0KA 3FC3A 2WPWA 2Q0OA 2XC7A 4E70A 1KBFA 3KP3A 2DT5A 1B9NA 2PIYA 1IV8A 3CMMA 3LD2A 2ME0A 4AVZA 4XPKA 1X4OA 5TJJA 2FBKA 5DCFA 1YLFA 3SJMA 3QYBA 1U5TC 1ZRCA 4MFDA 3QB8A 5BMZA 3G1MA 3J7ZI 4X3RA 1JUPA 3LSGA 2PEXA 3H5NA 3RKXA 3ZZIA 4KUAA 2IS4A 3DNSA 4IQ4A 1LFUP 5DUIA 3C1DA 2ZEEA 3KZYA 4E2AA 1Q2DA 2PCUA 3DEEA 2FIAA 4MHDA 5LYDA 1QHGA 2NMTA 4P4EA 4LX9A 1I1SA 3KY9A 2RNGA 2CQXA 1NMTA 1ORKA 2H6BA 4WK8F 3TO6A 2HQNA 5HOOA 2M0MA 2OVOA 4M3BA 1WWZA 1NHAA 1B9MA 1UAAA 1QVUA 3TDZC 4L18B 2GQQA 1W5SA 3H9GA 5C88A 2ANPA 4UWJA 2HOSA 1Q1VA 3HUVA 4OKOA 1NSLA 1M4DA 3IO1A 3O3KA 2O53A 3LSHA 4CZCA 1U8RA 3VWDA 5KAIC 1LRZA 2JLMA 2FX0A 3N5FA 2DTZA 2QYVA 2CQKA 4UFVA 3V7RA 1A2ZA 2Y30A 3W2WA 4QBJA 3ISPA 4KVME 3TCVA 3LSMA 1TQMA 3RPUD 4IXAA 3FF5A 2VZYA 2UV1A 2DAOA 4ESBA 1S7NA 1BIBA 1V1HA 3G4SI 2PJ2A 1P4XA 3GFIA 4BEHA 2X3TA 3KZZA 4Q36A 4B44A 4X6AJ 2V9PA 4XL9A 1H9TA 1OFCX 2B63J 2KL4A 5M3MJ 4YGOA 1D1CA 2KIQA 1XSVA 3DWLE 1OQYA 3VSKA 2ZB9A 2H27A 4KYWA 3U9GA 2NYQA 2QCOA 2HS5A 4PJMA 4J19A 3CC2I 3RQ4A 2ENNA 5G1ZA 3UGIA 3L09A 3CQZJ 4NGRA 4UXHA 2HPIA 2QQ9A 3OV8A 5ILVA 3EETA 5FUWA 2QMLA 2KT0A 4G9YA 4F52A 1TBOA 5CCMA 3FDYA 3R95A 3D7HA 1YE9A 5LRGA 1KYZA 3V7SA 3BROA 4HOBA 3A1YA 3B35A 2AQFA 1CX8A 1Z3YA 4HF1A 2B4BA 1T33A 1LFBA 3K4MA 5CQGA 2G3AA 3MN8A 4AB7A 1N71A 2BHZA 4QPOA 4C2TA 1I3QJ 3JRIA 2QBYA 2PJ6A 1DGRM 1F1ZA 3QYFA 1WVRA 3DPTA 3CJQB 4F93B 3T90A 1R6RA 1F9NA 2EQRA 3OYIA 1ELMP 3L2QA 1R5ID 3EFAA 2PQ8A 3OYNA 2YSRA 1CPXA 2VKHA 1GVJA 1XS9A 4WWVA 1OCCH 2KMQA 3CUQB 4EQQA 1Z2IA 2NS7A 2ZW7A 2Q4YA 1KQ9A 2X1EA 3HIFA 2BW3B 2YNEA 1FMVA 1R71A 4DBRA 4JBAA 3R5BA 2CUFA 1B8IB 4B12A 1MK4A 1TBXA 2HYFA 4XOPA 2HQRA 1H9GA 4A6EA 5IYCJ 3EDPA 1OISA 1OJLA 1Y56A 2KISA 5F49A 1HDLA 4XORA 5EEAA 1I1GA 4XICA 2X6WA 4C9YA 3BZCA 1T8IA 4NSQA 4D0PA 4B09A 2PSWA 1MSEC 2EO8A 4I98B 2PVVA 4CGNA 2DMTA 3BTIA 4KUBA 4HKFA 3PM1A 5IT9Z 3WC5A 2JA7J 1RFHA 4KA4A 1T56A 2BVLA 3ZPLA 4XOTA 3K2ZA 4LQGA 2CIJA 1HA8A 2V77A 2LOOA 1I3AA 3GZNB 3P9KA 2A4NA 1XSDA 4OIOF 5HNHA 2JEWA 2LUYA 2CXAA 1GHEA 4A94A 3ZP5A 3BPXA 3OSGA 1MBEA 4JX4A 4PJLA 4NQWB 5KNLA 2PR8A 4JOMA 4M71A 3H1CA 2PJCA 1EH7A 3QP6A 3JSOA 5C44J 3HTSB 3RNZA 4V2GA 4ABZA 3MEKA 3IV5A 2B3UA 1XG1A 1IN7A 3JREA 1FARA 3ZMVA 2JBKA 5EZHA 4CS0B 3GO5A 3HRSA 1B59A 4P1WA 3JRBA 1TBRR 2GLFA 3TW7A 4OAEA 1N13A 2IBDA 4FX4A 4UV9A 3UGLA 1YITI 2P8TA 3E5QA 2DOFA 1SFUA 2V4JC 4I0AA 5BOXA 3FJUA 4HRIA 3QPLA 3JRGA 1OR7A 1FBSA 5AIPA 1N25A 4MHGA 1Q9BA 2VBXA 2A07F 4UXJA 2VIXA 2K9LA 1VQOI 2CTBA 3RPQA 4NC6A 3QP5A 5G21A 1FBUA 1QZZA 4ONWA 2R3SA 1E0EA 2Z9OA 4JYWA 4OC4A 4OOIA 1QRYA 4BHPA 4S0HB 5IOZA 2A5YB 2R92J 1LFPA 2XB0X 2ZW6A 2BHYA 2PMZA 3UOEA 2VJ5A 5J1QA 1O3SA 1IRXA 2K9HA 3IAM2 4E1PA 4R3KA 2ATRA 1IJWC 3VDUA 3TX8A 3BT9A 2CF4A 1MT1A 4N9HA 5HLIA 2AS5F 1V3FA 1XDUA 4NC7A 5DTDA 4QC6A 5A28A 2FJ1A 1PP8F 3IIBA 5CKTA 4YU9A 1MJAA 3E6BA 4XLPF 3AAFA 3CCSI 2V8HA 2H8RA 4JQFA 1IY7A 4BINA 2ELJA 2KDOA 1WKMA 3A2KA 5CPAA 4LMYA 4U88A 4DZJA 2HQAA 1MDMB 1S20A 2MC3A 4JWPA 5LBQA 2M0CA 1CP6A 3KYLA 1VHSA 2E1MC 3KZIC 3SI2A 3NE8A 4HNTA 2IVMA 4LK0F 4UVAA 2ZBKA 5D5XB 3A01A 2ZJPF 1XGOA 3NQOA 2Z16A 4M9ZA 1SFOJ 1SVOA 1XTAA 3CP2A 3F23A 5E3PA 2I5UA 3R5AA 2B9SA 1GXQA 3S2WA 2OTLI 3B73A 3S1MJ 3PRTA 3TTHA 1NK3P 3TDUC 1WJCA 2F5VA 2BE5F 3FIWA 2ZOGA 1MMDA 4RGUA 1TGSI 2XKOA 2CV1A 4F0XA 3V8JA 1SAUA 2X0LA 3K10A 3JSPA 1KBEA 1SGEI 2CG4A 4AU7A 5K8PA 3QOPA 2G0EA 2A68F 4J01A 1VTNC 2CFXA 4PV6A 2BV6A 3KZWA 3JVNA 2VC1A 5F0HA 1XIXA 1JGSA 4CCMA 1VFCA 2BY0A 2PRQA 2FT0A 3REOA 3OOUA 4XPDB 4B5OA 1TIQA 2K5TA 2IT0A 2BY1A 2LTPA 4QLCU 3HOTA 4OC1A 2HQYA 2NS0A 5D4SA 4BDYA 5JGFA 3JRDA 2JSPA 2FL4A 4L9NA 3F21A 4LB6B 5J3LA 2LY2A 2DB6A 3W6SA 2FSRA 3WTTC 1IUFA 1AKHA 1WJFA 3R4KA 1J5YA 1CP7A 2EZLA 4DYQA 1TWGJ 3WC6A 3RYPA 1S5LC 2QVOA 1J9IA 4H6UA 1B72B 3GWZA 2PJ0A 2CTCA 1SFXA 2OCEA 5JVTA 1WJEA 4EVIA 4KMFA 3SGQI 2ZSHB 3OYDA 4A2UA 3JCUC 1RESA 2G7UA 5DS9A 3KP2A 5E3OA 1SVLA 2K9NA 2RQQA 1U78A 2JN6A 1O4XA 4YRHA 1PVEA 1ETYA 4HNWB 2M34A 2VRWB 2Y31A 4YG2F 3M9AA 2XPUA 4E7KA 2XPVA 5IP6A 2VBQA 4IAVA 4JLYA 1KYWA 2DA3A 5C4JJ 4ORFA 1WH7A 4W97A 2KRCA 1J2XA 2VT2A 2GOXB 2E71A 4MEYF 3KYDB 4YIFA 2BXZA 4WP4A 3C3WA 4XN0A 3BZKA 2GREA 3JR9A 4GXHA 2FQ3A 1HSJA 2KRHA 5F08A 4B11A 4QWQA 1HW5A 3EUHA 3L2VA 2MH9A 5BS6A 1IF1A 2KQRA 2M3AA 2K3FA 2R7OA 2ZMEA 3BCAA 4CDGA 3QODA 5TRDA 1BPMA 3MQ0A 2KDZA 4OWRB 3F6OA 4G7ZF 2Q7BA 1S7EA 4WWCA 2Q2EA 4E7LA 3H5ZA 2GVIA 1MMGA 3FXUA 1FY7A 3WGHA 3WE2A 1FYMA 1TZLA 1IOFA 3K4KA 3WR7A 1OLTA 3SZPA 1ERDA 1Y7EA 5IYBJ 2ELKA 5LGNA 1R4NB 2M8GX 4O6JA 4X0GA 4L0YB 4EATA 5B66C 2ARPF 3GXOA 2DQLA 2LFBA 3IH3A 3IWZA 2KCWA 1QGPA 1AA7A 4Y13A 4ZH4F 2CRGA 3FXQA 2ACJA 2FXFA 2E7XA 2QGUA 2PBIA 3DTKA 4MTEA 2ENZA 1JXSA 3K70C 2IXSA 3T0YA 2QZ8A 2JPBA 3HLPA 3I3GA 5JQ4A 3CPXA 1TNSA 1XE4A 2M2EA 3LOCA 1ETXA 4B6DA 2F5FA 1LUJB 5D5VB 4ENMA 4CAWA 4LIUA 5DWMA 2QQ8A 1BI1A 3WU2C 2I8DA 3B3SA 3QAYA 3K70D 2EWBA 3KEQA 2KMPA 1KWMA 2A20A 4IHTA 1QSRA 3PGPA 1OCTC 4I0BA 1FOXA 4WJBA 2FIWA 1STZA 4A3IJ 5LYFA 1S8NA 3IWEA 3PZJA 1FBQA 2OAZA 1DGWY 3C18A 1QSMA 4XLHA 2Q0YA 1UHSA 2NVUB 1U6GA 1MBFA 2DMQA 1MW7A 2JA1A 5H86A 4BMHA 5IT9K 3CCJI 5ILSA 1Z9CA 4MTDA 1A6IA 2A5WA 3ZQLA 2HZTA 2R93J 2Q1ZB 3SEKC 2JDDA 2DQRA 3HSRA 3TT2A 2WV0A 4P4DA 2OPTA 3IP4B 5H2FC 3PQJA 2XEIA 1Y8RB 1D1AA 3ISZA 2OOTA 2XPWA 4B3AA 2EINH 2LBFB 4L9MA 1TLHB 4QPQA 1GYTA 2DMUA 2V53A 3RCOA 3P5JA 4PXDA 3HM5A 4HF0A 3CLQA 4WXCA 3CCVI 4XKVA 2KMUA 1YGHA 5IP7J 3PFEA 1O3RA 5FVJA 1ODDA 1H8AC 5L3EA 4MO7A 4CH7A 3F8NA 1SGNI 2STTA 2Q8KA 1FYLA 3LSPA 3GTGJ 3VE5A 3P9IA 4A24A 3D5SC 4XLFA 5JHUA 2CSOA 2HFHA 1X1AA 2DOAA 4EMSA 2XRLA 4IOCF 4XKCA 3ECOA 2W1OA 2DDAA 3F72A 3TO9A 2HZDA 2WC2A 2B5GA 5A2QK 4NBQA 2ZEPA 5FKNA 5CVRA 3BJ6A 3LMSA 4YWYA 3JRHA 5D6EA 1W1WE 1ZK8A 5KCMA 4E6KG 4HGUA 3NWSA 1Z6TA 5DDGA 1W0TA 2Q7SA 1Z4RA 1H0MA 4UF4A 3DCFA 3EUKL 2ELIA 2IS2A 2MGQA 1U0JA 1BC8C 4OC0A 3N4MA 2J9RA 5CQEA 4I49A 1X3WB 2Q2EB 2V79A 1IUYA 3WTWC 2DA4A 2V8DA 2MW8A 2ZEOA 4C68A 5EGOA 2E34A 1HW1A 5JLWA 2OZUA 4M74A 1VI0A 4V19K 3TBIA 1K7UA 3B3WA 2NVTJ 5CJ9A 1UVGA 2XSJC 4M6IA 4N4NB 5E3QA 1QSTA 2D5VA 4A2ZA 2FBHA 2HYGD 3H5RA 1JUSA 2RAEA 2KMRA 4L89A 3OVOA 2FSWA 2LDUA 5LHIA 3KR5A 1R3NA 3S17J 3PNVA 3H4QA 4UEEA 3ZMZA 5CPRB 3S16J 3SJXA 3FMQA 4M3EA 4ZYAA 4CAEA 4ZGYB 3GVAA 2IA0A 4X2TA 4JYKA 4DW6A 2KFDA 4A30A 5L3FA 1ZH5A 4R57A 4RUHA 3KKWA 4LIVA 4V2FA 4HX8A 2FBIA 2UZKA 3OYAA 4CGMA 2QBYB 5HDNA 2VKVA 5I0CA 4IO9F 2O0YA 4IRIA 4L0ZB 4X1EA 1I27A 1KGSA 4L5IA 3QWLA 3V4GA 1VQ5I 1ZRFA 3AL0B 1ARLA 2ZPAA 1TNTA 3I53A 4ZYEA 2JXDA 3OYBA 2EJRA 2BEOA 2PX9A 3S1NJ 3NH8A 1VF9A 2KP6A 4XKBA 5FGMA 3EYIA 2XASA 3AG2H 1I50J 3LFUA 3OOPA 5DYMA 5J4VA 2R5YA 1TIHA 4Y4RA 3R6SA 1LVAA 3BC8A 1YVOA 4ITVA 3VFZA 3V8IA 4II3A 5DCMB 5TISC 4BQQA 2IGOA 1Y1BA 2M87A 2ELHA 4AUXA 3UGDA 2R1IA 1HKQA 4GFBA 1IXCA 5K7ZA 2PLYA 2L2OA 2WCYA 3E6DA 2Z3NA 3OS1A 1IZ1A 2CU7A 3GBGA 1F2PA 2Q04A 4F91B 4OIQF 1M1EB 2BCOA 1BW6A 1Y0UA 1S72I 4A3LJ 2RFHA 5FROA 2PJ7A 2R8VA 2SGQI 1BI0A 4KDPA 3SZTA 3MGDA 4RN7A 2DIPA 3WU0A 2EB7A 1YO5C 1OMIA 2Y48A 4BE0A 1W36D 1QA6A 1EH6A 2QA4I 1K7TA 1B1BA 3U2RA 3IAS2 1Z8LA 2K7LA 1HXDA 1R5GA 2CWHA 3NE7A 1R22A 4NGMA 3PBBA 1W4RA 3F8BA 3IFEA 4B3XA 4XONA 2K4BA 1IOIA 1YTYA 2V26A 4RB0A 1HOMA 3S9LA 3W6KB 5BQTA 1FP1D 1JT6A 2PIZA 3IHUA 5DM6F 1ZG9A 3BJOA 4I7HA 1EF4A 4PXBA 5IY5H 3FF3A 5DD4A 1HDQA 3GMEA 2FOWA 3J80K 1O3TA 3VATA 4HX7A 3DFGA 1SD7A 2DI3A 3SEQA 2KRFA 2ZOFA 4FKDA 3U21A 4A31A 1BI3A 1VZ0A 1V5EA 4WXDA 2R7TA 3DDDA 4DNCA 1BMOA 3TEDA 4UCMA 3W91A 2ID6A 2R7ZJ 5JM6A 1K7VA 2FOKA 3G73A 1ELLP 1QPMA 1ZKGA 4BBRJ 2ZXHA 3IEHA 1MBKA 3I54A 2ZEMA 4QIWN 3FVLA 2NXNB 1QHHD 3ZMSA 1Y1VJ 2XGXA 4F3QA 2V9KA 4ZZLA 3OMYA 3TKYA 4HF2A 2VBZA 4H89A 2M30A 3DV8A 4FISA 4CGZA 2Z11A 2PMUA 4HDVA 2E2HJ 3R0JA 2HEOA 3RI4A 3K4JA 2CGPA 3E7LA 2YNDA 2MYSA 1HF0A 5A2QZ 3ONQA 3VB2A 2GA1A 4EM2A 1UFHA 2HKXA 2O28A 1CBXA 4A3BJ 4ZY1A 2E1NA 2RIJA 2HGCA 3I0TA 1A6QA 8CPAA 1FP2A 1FT9A 4NB5A 3JTGA 1TW2A 2CFOA 3LMMA 2OQGA 1ZAOA 4KLWA 2FXAA 4A12A 3JRFA 2VL8A 2CH0A 3WTXC 5HVQC 1UVFA 3F0CA 1P0HA 4KNYA 2PJ3A 1U5TB 4A95A
chains in the Genus database with same CATH topology
2VN2A 1RO5A 5CLSA 1EV7A 2RKHA 1L0CA 3HHHA 2X4HA 4AVBA 4LD5A 1P4NA 4UUVA 3CXPA 4XRFA 3JW4A 4EM0B 2EV0A 3J81K 1YW9A 1E2XA 3F22A 3QPHA 4UFXA 3WODF 1XMAA 2CY2A 1I21A 4HDUA 5H84A 4G94A 3K0LA 4AVAA 3RJPA 4C2YA 4OIPF 2L02A 3ROUA 5HH1A 3BDDA 3T1BA 2G0BA 5AG4A 3DR8A 5LGUA 2DPUA 4NCZA 1U6MA 4HYEA 5L3BA 3IL2A 4UCPA 1K6OA 5IV0A 2EA2A 5EEHA 4M6YA 4UA3A 1KU7A 2XVCA 3UY5A 3VWEA 4DQ2A 3PFIA 2JDCA 4PSWA 5F47A 4AD9A 1FX7A 4BYYA 2YNCC 4LLNA 2QIRA 2KIFA 3DXJF 2Z33A 4B13A 5F6FA 3DQVC 1IXRC 2BGCA 4U0YA 1LDDA 2MD5A 4KZTA 1TQIA 3VODA 3FMRA 5HS9A 2BSWA 3GX4X 4AG9A 2QENA 1M4GA 5E1ZB 3GYHX 2DPTA 4KLVA 1WRJA 2ETHA 1Q2CA 2A6HF 2LSOA 4AWXB 1ZG5A 1OYIA 5CVIA 2OZGA 4A6DA 2B58A 2GE3A 1AWCA 4OADA 4MFPA 2QWWA 2W85A 1KU9A 4HX4A 4EV0A 2Q44A 4C7HA 3JUWA 1XMKA 4HV6A 4CYDA 4YFJA 1K78A 4ZYHA 2A61A 3KETA 1ZGAA 1LDKB 2VBWA 2V1XA 1W7PD 1F5TA 1DUXC 2Z3MA 2Y0MA 4FD6A 2DK5A 3J80Z 1XCVA 2FE7A 3IGRA 4ENJA 4G6QA 4NEXA 1IN5A 4A0XA 2V6CA 3FX3A 2HR3A 5HS8A 2VZZA 3RIRA 1R23A 1R58A 3HHGA 3ZMDA 1YX0A 4RB2C 2YR2A 4Z2YA 1FOKA 5FD6A 4F6AA 5E20A 2P7CB 4XNHB 2B0LA 2XV4S 3G3ZA 3GKRA 1T0FA 5LEKA 2W24A 5H6RA 2ISYA 1PU9A 2EFNA 1SD4A 3I71A 4BXUA 2K27A 2NNNA 4WCGA 3LAJA 3G3SA 4MY0A 4XSXF 3ZJ0A 3JTKA 1IXSB 1UB9A 3TQNA 4RGSA 2CW0F 4HW0A 4U7DA 1YYVA 2VE9A 1YLEA 1FSEA 1TQPA 1C0WA 3SHPA 2IPQX 4FT8A 4PGHA 3J81Z 5JR3A 5AG7A 4NXYA 2XUBA 1G3SA 2O8XA 4CAVA 4LGWA 4A5NA 2C6YA 1ON1A 4NHJA 3R0AA 1B4AA 1ZHFA 1WSUA 2KKOA 3RKWA 4HLYA 3HRMA 2RDPA 3F8KA 3WU1B 3L2CA 1T38A 1FSHA 3ABUA 2EV6A 4XBFA 2NRAC 5E96A 1XSXA