2OZUA

Crystal structure of human myst histone acetyltransferase 3 in complex with acetylcoenzyme a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
253
Chain Sequence
b'RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQSIKKLSKLTGICPQDITSTLHHLRMLIRREKLIQDHMAKLQLRPVDVDPECLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase MYST3
publication title The crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 253
sequence length 270
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ozuA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2ozuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ozuA02
3WTWC 1XSXA 1KUYA 2H6BA 2PDOA 4L5IA 3MZHA 2PG4A 3W6SA 2PQ8A 1TNTA 3KLNA 3QU6A 1XGNA 1MZBA 2XAHA 4GGGA 4OMZA 2OD5A 2A4NA 1WKMA 5D5UB 1ZG1A 1I6XA 3FM5A 3LD2A 5HOOA 5D6FA 4QVTA 4JJXA 3K9UA 3K1PA 2OA4A 3SXOA 3KZZA 4PV6A 3BPXA 1LDDA 1XMAA 2FXFA 4JXRA 4FD6A 4QB9A 2JSCA 3ZMTA 3HHHA 5DD8A 2FEZA 3CUOA 2W84A 3IRQA 1ZN2A 1J4JA 1XCBA 2KIFA 3VB2A 4U9YA 5CVUA 3F0AA 3G8WA 1H9GA 2EFNA 1UCRA 4Y13A 5LEKA 1JHFA 2P6SA 4G94A 2RC4A 4R3LA 2NRAC 3R9FA 2UZKA 4G9YA 1S3JA 4KVME 4O6JA 3DR8A 4CAWA 3JSPA 2RGVA 1W4MA 3V7RA 4L9TA 2R1IA 1TTYA 4KNYA 3FXTA 3QPTA 1ZG5A 1IICA 3P9KA 3F21A 1FBQA 4FX4A 2CNTA 4HNXB 5DCMA 1MJ9A 2VODA 1D8JA 1HSTA 4Y49C 3HUGA 5E17F 4A5NA 1UB9A 1F1ZA 4RGXA 5HDNA 3TOAA 4X5KA 1K79A 4RB1A 2HGCA 3D2PA 4RS8A 3I0TA 2FL4A 4YIIA 3J81K 2QBYB 3NEUA 4IRHA 4UVCA 2Q0OA 2F5EA 3NQOA 4A12A 4LGWA 3ERED 3O2PE 1G3TA 4CS0B 1Z05A 1IN5A 1DPRA 3FF5A 5FFXA 3MWMA 5DV5A 1WWZA 2P4WA 5L3BA 2B3UA 3GZ5A 1EH8A 4AIKA 2QWWA 2Y75A 4WXHA 3W6JB 3I59A 1PDNC 3I58A 4KVOE 2OZ6A 2ACJA 1G3WA 3BPVA 1P6RA 5ED4A 2VZYA 5F49A 2PFBA 1XB4A 1YVKA 4BQAA 4FHTA 1Z9CA 2FS5A 3QRFF 1Q2CA 1YTYA 3FYNA 1ZYRF 5L3DA 4FT8A 2ETHA 4II9A 4EJOA 1USSA 4I01A 1MDMA 2QUFA 2JT1A 4M9XA 4U7BA 3C7JA 3LA7A 4YFNF 3O6BB 2Z99A 5EC4A 2IJLA 2EJRA 3V8IA 1XGOA 3H92A 2X4HA 2DFIA 4D0PA 3F8NA 1BIBA 4OADA 2B4DB 1QO0D 2B4BA 4M72A 1DDNA 4MJ8A 2Q8KA 4KUMA 2ZNYA 2HYFA 1XIXA 1Y9KA 1BC7C 1R1VA 3ZMDA 1CF7B 2MA3A 3E6BA 4BYYA 1N71A 5J6XA 1EV7A 1IXRC 1R22A 5D8LB 1UFHA 4P9UA 2FIAA 1LEBA 3U9GA 3K0LA 2FU4A 2VT3A 3T8TA 1I12A 1XMKA 4HA8A 5DEQA 1TLHB 3JUWA 4JK1X 1LB2A 4L9JA 4RGSA 1XE4A 4UA3A 3C26A 1S8NA 3SXYA 3EXNA 3KZYA 3FBUA 2GIVA 5J8FA 2FMYA 1LJ9A 2GAUA 1BIAA 2EFWA 2MLKA 4QLCU 2JZYA 4LG0B 1G3SA 2L54A 3KEOA 3QOPA 2HZTA 2VBZA 3IL2A 2GWRA 2EA4A 4J3GA 1W7PA 2GA1A 3ULQB 4XPKA 3WODF 2V9VA 1BN5A 5KVRA 1TW3A 3KCCA 3OOPA 1QSTA 3U1DA 1QPMA 2VBWA 4HOBA 4EM0B 3GYAA 4MNUA 1ZLJA 4BHCA 2WPXA 1RNLA 2OB0A 4ZYGA 2VEZA 1BI2A 4K30A 4ZBGA 4OMYA 3F6VA 2QQBA 5D5WB 2H09A 4OIPF 1O57A 2R7DA 1PUAA 1GHCA 2XAGA 2FT0A 4LUAA 2VC1A 4DNCA 4R79A 3FNCA 1KU7A 5HMNA 3GX4X 3T9YA 3ABUA 1L0OC 2ZNZA 2YX7A 1BC8C 1MKMA 4YFKF 1MGTA 1FYLA 4MQVA 3OV8A 1Z1DA 3ZP5A 2KKOA 4L9VA 3RKXA 2VE9A 5K5RA 1VKCA 1BI0A 4CGZA 3WG9A 1OPCA 3CLOA 4HZFA 1HKSA 3PGPA 3P2HA 2XAQA 3DNSA 1QSRA 3I3GA 2V6CA 1FWZA 2Z9OA 1HBXG 3Q9VA 1R36A 5FFZA 3E6DA 4E70A 3Q5FA 5F48A 3GW2A 5LEJA 4N0BA 5CLSA 2ZW7A 3JW4A 2G0BA 1QZZA 3MCZA 5F1RA 5HH1A 4JQFA 4EV0A 1ZG3A 1BBYA 4Y17A 2PR1A 2FNAA 5FB2A 3W6XA 2L4AA 4AD9A 3R9GA 2ELHA 2I00A 1O7FA 2HOEA 5IT3A 1D5VA 1TQMA 2UXXA 1YVOA 5LBQA 1RUOA 4AVAA 2CG4A 1HSJA 2C27A 2A6EF 1LVAA 1HW5A 3F6OA 4ORFA 3TFYA 2KJCA 3ML6A 2H94A 2R7FA 3TDZC 4S05A 1CJWA 4EJVA 3MQ0A 2RDPA 2VXZA 5FVJA 2E7XA 5KTCA 1P92A 3JTHA 2AJ6A 4PSXA 5F47A 4M6YA 2ISZA 1IUYA 1ZAOA 3TOBA 2XUBA 4ZZLA 5HLHA 4QWQA 1TQPA 5AONA 2Z10A 4O3MA 1CF7A 2DTRA 4HX8A 2REEA 4IF4A 4IRIA 2F5FA 4GYIA 4EVYA 2VBXA 3ZZIA 5LGTA 2HUZA 1U6MA 2OZHA 1AOYA 3F8FA 1G4DA 4CDGA 2H27A 5DWMA 3TDUC 3L09A 2QENA 4EGZA 5E1XA 1IN6A 1QQIA 1OYWA 3K1NA 3CUQB 2CNMA 4LG0A 2CO5A 3HRMA 2BL1A 5BQTA 2ZKZA 1IW7F 3MEXA 1FYMA 1GXQA 2MC3A 1Q1HA 4ZYEA 1YR0A 4R57A 3PQKA 3E3VA 3ZN1A 1O7LA 1KUXA 3D0SA 2DI3A 5JQ4A 3J80Z 1ZRCA 1KZFA 3K9TA 2MLGA 3BOQA 2HKOA 3TGNA 2CNSA 2IA2A 2VT2A 2F5DA 5ISVA 4CXFA 3P9CA 4FD5A 4NF1A 3EY5A 4HDUA 2M1BA 3IWGA 1BOAA 1O3QA 3ZQ7A 4U0WA 1WRJA 4HKFA 2H6CA 2P8TA 4U0YA 4KOUA 2NNNA 3P7NA 4HLXA 5LRRA 2X7BA 1YYVA 1S7OA 2AE6A 1HW1A 3FM3A 1HW2A 2VZZA 4A2UA 3DXJF 5KK1A 4LB6B 4CAXA 4H0EA 3I54A 3E97A 2HTSA 3ZMSA 2DXQA 2HEOA 1FSEA 1SFXA 2VN2A 2XRNA 3WGGA 1FP1D 1F5TA 3GYHX 1PP8F 2FBIA 1F4KA 2Q0YA 4L89A 2O0YA 1FBUA 1SAXA 3D8PA 4XBFA 1R1UA 4E2AA 1CGPA 4R8HA 2CW0F 3L2CA 1YLEA 1YIOA 4N9HA 1U5TA 3WGHA 2R98A 1YS6A 4WXDA 3B02A 2GE3A 4OIOF 1KYWA 1W5SA 2HQYA 5E1ZB 2ZW5A 1ZRFA 4MHGA 2DK5A 1REPC 1WK4A 4RAZA 4MTEA 1B6BA 2PMUA 4KMFA 5D4SA 3BWGA 4R1HA 1Z91A 5D5XB 4AIJA 1BI3A 3DP7A 1KQ8A 5LRSA 3NRVA 4AB7A 2A6HF 3TKYA 4R9MA 2FXAA 3TCVA 5JFRA 1FP2A 2B3VA 5ERIA 4CRZB 3ISPA 4UV9A 3FX3A 4M3SA 1R7JA 2P6TA 5GCNA 1S7NA 1YGHA 4HF2A 1J7KA 1B4AA 5CNPA 4S04A 5HS9A 1Z4EA 1DP7P 3J80K 1KU3A 4EM1A 2QVOA 1XDSA 3S2WA 4A6EA 1T0FA 4AVBA 4RAYA 5KTAA 1W7PD 1I1DA 4M73A 3M9AA 3WTVC 1USTA 1OMIA 1B87A 3FRMA 4XNHC 2WV0A 3I4PA 1LEAA 3SHFA 4OIRF 3ELKA 5E1WA 1Z7UA 5FO5A 4I0AA 5CVRA 4B5PB 3REOA 4Y15A 3IC7A 3TO9A 2W57A 2RN7A 2PN6A 3CO6C 5AIPA 4ZZDA 3QU3A 1JGSA 5CVJA 3VEPA 2BEOA 2VC0A 2QIRA 4KIBA 3S6FA 4L8AA 5IX3A 1V3FA 4HDVA 2XVCA 5DUIA 1K7AA 2RV8A 4HV5A 1ZGAA 2ZMEB 3QAHA 3GFLA 4KLWA 3HHGA 1I1SA 4YIFA 4AWXB 4L0ZB 3B73A 3HRSA 4Q4ZF 1XEBA 2XV4S 1S5KA 2J5PA 3CXSA 1BM9A 4KUBA 4IPAA 3GZ6A 2L01A 3HYIA 4KOYA 3WTSC 3CJNA 4CHUA 1I21A 2Q4VA 3ZMZA 1UHMA 3RKYA 2BGCA 4P9FA 4G7HF 1KQ9A 1SMTA 3VODA 1DPUA 2XROA 4JLYA 3GLXA 2Q2EA 4MY3A 2R8VA 2G7HA 1E17A 1IYKA 2FF4A 1D8KA 1U3EM 2JRTA 4ASNA 1J5YA 4M6XA 3FWEA 5L3FA 2AXLA 3W91A 3RYRA 2KIUA 1S60A 2MD5A 4RGRA 2YX4A 3GWZA 4A6DA 3D5LA 1PUEE 4XLNF 1SD5A 1B6AA 2W25A 4UV8A 1HKTA 2YU3A 3IKVA 3FXRA 2ZXJA 4IHTA 3EDPA 3F8CA 2QMLA 4OOIA 5JHUA 3GF2A 2QZ8A 1E2XA 2LKPA 5ICFA 2ZFWA 2QLZA 4LFUA 3VWDA 4A0ZA 3KP7A 2RNJA 3DV8A 3KP3A 1MD0A 2ZCWA 2OZUA 3LAJA 3EFAA 1R23A 3KEQA 4PK2A 2QYOA 1H0MA 4ENNA 1OZPA 5K1YA 5TJJA 4AG7A 3N7ZA 4HF1A 5D4RA 4O5VA 1M44A 4YG2F 1ON0A 1P0HA 2F5CA 3I53A 3V7SA 5HDKA 3EYIA 3EO4A 1YFHA 4ESFA 3IGRA 1XGSA 3D2MA 3VOEA 4R87A 3V8KA 2JTVA 4UVAA 3K1MA 1T98A 1Y9WA 2LDUA 2Z11A 3QP6A 1DUXC 4Y49B 4QBJA 4BHBA 4XPLA 3VWEA 2DQLA 1A04A 4DQ2A 4XPDC 4BNCA 1RO5A 3F3XA 5H6RA 3E6MA 4JXQA 4AVCA 3KKWA 4L5JA 4ETSA 1TNSA 3WTZA 4PCQA 5EBVA 3WTUC 4CYDA 3W6KB 3DR6A 1M1DA 2A5YB 1UHWA 4IVNA 1I1GA 4XLPF 5H20A 3R9EA 5H84A 1ONVA 1NMTA 2GZWA 1KYZA 2FMLA 1V4RA 2A69F 4PGGA 2Y0MA 4I2OA 2TDXA 5BPIA 1M4GA 4HX7A 1EH6A 2PI0A 1WWXA 2O28A 5ILVA 2FE3A 2RQPA 3TE4A 2HYGD 4EMSA 3ROUA 1JHHA 5LHIA 2YR2A 1Z6RA 1YG2A 2V79A 2QBYA 4EJUA 1VTNC 2PSWA 2K02A 2MBFA 4KICA 2CQKA 3M1EA 3JAMK 4ON0A 2ADUA 2IT0A 4HNWB 3GFJA 2O6GE 1FT9A 1QGPA 1ZLKA 4I02A 2JEVA 1QZYA 4KIFA 3BZ6A 1KQ0A 4A0XA 3WTYC 3ZMUA 3KP4A 1P4NA 2V1UA 4M74A 4XSXF 4Q5SF 2OZGA 4I0BA 2OBPA 1B9NA 3DPTA 2J8RA 3M8FA 5D8KB 4UWJA 1U2WA 1NHAA 1QSOA 3I5UA 5L3EA 3LAPA 2K27A 1FX7A 3C3WA 1XDUA 2HQRA 5E20A 3RPUA 2VONA 1I27A 4FD4A 3ABTA 5E8IA 3UY5A 5BMZA 2OAZA 4EM2A 2AS5F 1OYIA 3S6HA 3HOSA 1YREA 1L3LA 2QECA 3GFIA 3RJPA 1GXPA 3KP6A 2KRFA 3K2ZA 1SD4A 4GCVA 4KDPA 2ZJ2A 5L3GA 3F5BA 5LGUA 4AG9A 4GYGA 2B4DA 5AIQA 1RUNA 1IN8A 1YK3A 2EFPA 2XKOA 2XAJA 1ULYA 5CVIA 5C82A 2BV6A 1FSHA 2UWMA 4MEYF 2E1NA 4H89A 1ON2A 2MH9A 4HX4A 1NSLA 4BXUA 1F9NA 5LHHA 1XF8A 4NQWA 5KTDA 1QBJA 4U5YA 3DF8A 4KORA 1S6LA 5LHGA 3BLNA 3F22A 4YFJA 4U9ZA 2RVCA 2P6EA 2Q44A 1ZH5A 1IXSB 4N9IA 3LFKA 1R1TA 5FLXZ 2IPQX 3QP5A 3KFWX 2IA0A 3BJ8A 2OU2A 1T2KA 1J75A 2F5IA 3WE3A 4WCGA 2PR8A 4RI1A 1JXSA 2GA2A 3T0YA 2K7LA 3N4MA 4UNOA 2O61A 3RYOA 1I5ZA 3BJ7A 1IRFA 4R3KA 3R6SA 4Z2YA 2VBYA 3WR7A 4KOVA 2NNYA 4Q48A 4L18B 3B8GA 3SZPA 3RKWA 5DCMB 4MEXF 1IN4A 2JPCA 3KETA 3WTTC 4OLLA 3M7GA 3PFIA 4KZTA 3SFZA 3SZTA 4YRHA 3C18A 1IB1E 1LRZA 3T1BA 2K4BA 4LLLA 3EUHA 1OR7A 1U78A 4G7ZF 2HFHA 2WPWA 5E8GA 3CO7C 1MK4A 3FHZA 2VOOA 3U2RA 4A5MA 1PU9A 4UBRA 1S7AA 3WU1B 1GVJA 1U8RA 2V1XA 4LK1F 2B0LA 3NE7A 4OINF 3WGIA 4JWPA 4NSQA 4G6QA 2G9WA 2G7UA 3I59B 4ZYHA 1KUVA 2A68F 3WU0A 3RTRA 3R61A 4IRGA 1FNNA 2V1DA 1LDKB 2Y48A 2HS5A 1RIOH 2Z3YA 2BEIA 2HTJA 4ZH4F 2GXBA 2DAOA 2D4OA 5LGNA 4ONUA 3S6GA 1OYYA 2EV6A 4MBUA 1FC3A 2WWYA 2STWA 3E5QA 2QM3A 1Q2DA 2IL4A 4IXAA 3HRUA 4NB5A 4OU0A 4P5OA 1HKQA 4HBLA 5F6FA 2K5TA 4CRYB 3G3ZA 1B1BA 1MDMB 2HDCA 1FPQA 1HXDA 3BY6A 2ZO4A 2J8MA 4ESBA 4WWCA 2KCWA 5FD6A 2O03A 1G6NA 4U0VA 5A2QZ 2UXNA 1T38A 3MGDA 3FXQA 4WX9A 2D1VA 4AVPA 4F7ZA 4HYEA 5E18F 2L4MA 3DEUA 4MY0A 2FNPA 4K2EA 5FLXK 1YLFA 3SHPA 2RKHA 4IJAA 1ZARA 1SFUA 1MJBA 3CXPA 2ZW4A 1RXTA 3D3SA 1PP7U 2YPRA 2P5VA 4M85A 3QPHA 4UXNA 3F23A 1BO4A 1O3RA 3ECHA 1FBSA 1V0CA 2B5GB 2JLMA 1OKRA 5HS8A 2G3AA 2EFQA 2X0LA 3FMRA 2PC1A 4M9ZA 1GHEA 1K6OA 1B9MA 2OH1A 4HW0A 2EA2A 1FZPB 4UUVA 2HV2A 4F6AA 3WTXC 2PMHA 1R00A 3SXNA 1P4AA 1UFMA 2E1CA 2LSOA 2B58A 2VOPA 3JTGA 2GANA 1W7PB 3KE2A 2VI7A 4MI4A 3V8JA 3HTSB 3MFKA 2G3TA 2BYVE 3I71A 4B8XA 1XMTA 4HAMA 3CUQA 2EV0A 4LMYA 1R58A 1Q2YA 2OQRA 2ZW6A 2ESHA 3CTAA 2DT5A 2HKXA 3BJOA 2R3SA 1K4JA 2FQ3A 4A0YA 4WK8F 4ENKA 2M45A 3V4GA 3RYPA 4GXOA 1YX0A 5ICCA 5IT9K 4B09A 3DDDA 4KYWA 3DQVC 5LLQA 5HS7A 4CZZA 2Q7BA 2DU9A 3E5XA 1ON1A 5BOXA 3E5UA 2NAZA 2GXGA 3HOTA 3GEZA 4GS4A 2ZPAA 1Z4RA 5D6EA 2JDCA 5HVQC 3GFMA 2P6FA 2J8NA 3R0JA 5H86A 1R57A 2P7CB 2L3DA 2NMTA 1KA8A 4KOTA 2KJBA 4LLNA 2R7HA 1YO5C 5HLGA 1NE9A 3L7WA 1BOBA 4FD7A 2DO7A 4PGHA 5A2QK 1S29A 4PK3A 1XSDA 2A61A 3LA2A 2VQYA 3GKRA 1JE8A 4JD6A 2Z33A 1M4DA 3GVAA 1YS7A 1KGSA 1XSVA 2M5WA 4NHJA 4OIQF 3OWCA 2DW4A 2ISYA 5TRDA 3HTUA 3F8MA 3F8KA 4NCZA 4NXYA 2CY2A 4U88A 1TQIA 5K5QA 4CAVA 1J2XA 2LNBA 4KMUX 4AIHA 1K78B 5BPDA 4UVBA 3T5XA 3E6CC 1B59A 1X3UA 2WC2A 1ODDA 1IXCA 5JR3A 2ZXVA 4ESJA 3PQJA 4PDKA 2VE8A 1U5TC 4LB5A 1VHSA 3VFZA 5F64A 3JAMZ 1IIDA 3DFGA 4GO1A 4PSWA 3IWZA 2L02A 5EEHA 2XAFA 3KP5A 2D4PA 4KOWA 2W24A 4Q47A 3RIRA 2DK8A 2XGXA 4UHTA 3BJ6A 4L9NA 1J0RA 4I7HA 2IP2A 4LK0F 3RPQA 2PEXA 4YFXF 2FRHA 3FMSA 4CO8A 2FOKA 1S7FA 3V8LA 1IYLA 3HIFA 3TT2A 3O3KA 3R0AA 3ECOA 2WTEA 3H4QA 2Q04A 2ZBKA 3BJAA 4U7DA 3MAJA 3ZMVA 2HQNA 3DKWA 4XNHB 3GXOA 5FGMA 3IKTA 4TV7A 2MH2A 2J5OA 3Q9SA 2M8EA 4MQ9F 4CICA 2B5GA 3R4KA 2JDDA 4M71A 1YW9A 3PP9A 2DQRA 1ZGJA 3FMQA 3HSFA 2P0WA 3R96A 2PBIA 4I98B 4KVXA 1QNTA 1STZA 2FBKA 3IHUA 2JPBA 5CYVA 2FA5A 4RB3C 1YW7A 1S7LA 3DSBA 1MJAA 3H3UA 3BROA 3K69A 2P7VB 5L3CA 3LSTA 2ATRA 2QQAA 1IF1A 5DUKA 4B5PA 2D45A 1S3ZA 4HQEA 3TO7A 2BE5F 2CYYA 1XCVA 1XD7A 3BDDA 1Z6TA 3LA3A 5ILUA 3R95A 3V7CA 4MGRA 4P96A 4EJWA 2D2WA 1FLIA 3H3ZA 1EH7A 4RGUA 5ILSA 2EWNA 1LNWA 3CUQC 3JVNA 1ZHFA 2P5LC 3RDIA 1H9TA 3GY9A 4E8OA 5FD5A 1FY7A 2IRFG 1J9IA 2FSRA 1YW8A 4KA4A 1WI9A 2EK5A 3GO5A 3I64A 3ZJ0A 2ZMEA 5HDGA 2F2EA 4G8XA 5IV0A 2M30A 2CFXA 2HWVA 3GUDA 1TBXA 3EYYA 1S7KA 5JI6A 5CJ9A 4HF0A 5BS6A 1SMYF 3T90A 2IW5A 2DPUA 5ICEA 1TIQA 1T6SA 2LF8A 1M4IA 4KIGA 3KLOA 3FB3A 2M87A 5I0CA 2A07F 4LLGF 2XHKA 1HQCA 2REFA 1LDJA 4KOXA 4KT5C 2BBYA 2A3SA 5E96A 1WSUA 3ZN0A 2DBBA 1SFEA 2EUIA 4KOSA 2VXKA 2IVMA 4RS2A 1U5TB 1KU9A 3HSEA 2Q4YA 3DPLC 1P4WA 4EQQA 1RI7A 2H5MA 2STTA 1SQHA 1K78A 2K86A 4H6UA 4HNYB 3RI4A 2EV5A 1AWCA 4YGOA 4MTDA 2Z0ZA 3LODA 3S6KA 1U6GA 2FBHA 1FOKA 3FXUA 1ZREA 2E7WA 4G6DA 2W85A 1IZ1A 2K4JA 5F46A 5D5VB 4JBAA 1Y0UA 5CVVA 4IF5A 3L00A 4MHDA 3HRTA 3EETA 3F8BA 5K5OA 1QSNA 2XKPA 3J7AO 2CSOA 1LQ1A 3AAFA 2NS0A 4HLYA 4ENJA 4LD5A 3FIXA 4LX9A 2I79A 3G3SA 3WE2A 1R5HA 4PZJA 5IB0A 4BMHA 1WQ2A 3L9FA 2P5KA 1QSMA 2FCKA 4P55A 3QB8A 2COMA 4KN4X 1O3SA 4KLVA 3SQNA 4KN7X 1BJAA 1G3YA 5EEGA 2C6YA 3TTHA 5H6QA 2HR3A 3CDHA 4BH9A 2FIWA 1BI1A 2PLYA 2PJPA 4UWIA 5DD4A 4XPDB 3COAC 4ZYDA 5HLIA 2PRBA 4M9SA 2D1HA 4E0AA 3EC4A 1D3YA 3JSOA 2KIMA 3F72A 3CXQA 2EB7A 6PAXA 1P4XA 3BP8A 4BAYA 2CWEA 5DCFA 4XRFA 4EVIA 5JPHA 3R1KA 4FX0A 1XGMA 1SD7A 3LQRA 4B5OA 4I49A 1P2FA 3HSRA 5J8CA 1IRGA 1KU2A 3PZJA 4OAEA 5C88A 1R5GA 2EVNA 2XIGA 2ARHA 2QQ9A 4F0YA 1YQAA 4KUAA 1L0CA 4EJTA 1IN7A 2VBQA 5DYMA 3FZVA 3LWFA 4RB0A 2O3FA 2XASA 2O8XA 1IAWA 2BSWA 2LF7A 2IA1A 2Z5UA 1T39A 3ZPLA 2GQQA 1FYKA 4WF2A 1SD6A 2EFOA 4G7OF 3N97A 3E0KA 5IT9Z 2YSRA 4HQMA 2ESNA 3T8RA 1C0WA 4QC6A 3MZYA 4LJZF 4IHSA 4IUSA 4EGYA 2CGPA 4BHPA 4KFCA 3P2FA 3TQNA 4WXCA 4NEXA 3IRRA 4ENMA 2DLLA 1J59A 2P6GA 2OQGA 3R60A 1O3TA 3G73A 4L0YB 5DWNA 1Y7RA 2FSWA 5JVTA 4RB2C 3M8EA 2FE7A 1Z9UA 1RZ4A 2DPDA 1CM0A 3IWFA 3TO6A 3J81Z 4H6ZA 3KP2A 5DDGA 2NYXA 1W5TA 4HV6A 3I9SA 4QUSA 1ZRDA 4XSZF 1TW2A 2BUEA 3P9IA 1XN7A 5ICGA 4I09A 3EQLF 3LQQA 3C1DA
chains in the Genus database with same CATH superfamily
4W9YA 3WTWC 2ODFA 4MCQA 1XSXA 3KEYA 1KUYA 2H6BA 2PDOA 4L5IA 3MZHA 2CV0A 2PG4A 2IS6A 3W6SA 2PQ8A 4A3FJ 1TNTA 4BBSJ 2KMPA 1EF4A 3L2QA 2DYSH 3KLNA 3QU6A 5J40A 1XGNA 1MZBA 2ELIA 3KYLA 5GAGJ 2XAHA 5GTHC 4B43A 2E1MC 4GGGA 4OMZA 5FUVA 1DS3I 2QJ8A 1LOKA 2OD5A 4J00A 4DJLA 1ZQ3P 2V53A 2ID6A 5ELYA 2A4NA 1WKMA 4Y33A 5D5UB 1SVOA 1ZG1A 2IXSA 4QPOA 1I6XA 1IV6A 3PB8X 1VQPI 3FM5A 3LD2A 5HOOA 5EEAA 5D6FA 1N78A 2EBIA 4NGSA 4QVTA 3BG6A 2W0TA 4JJXA 1MMSA 3K9UA 3EUAA 3K1PA 2OA4A 3SXOA 3KZZA 4PV6A 3S1NJ 4I76A 3BPXA 3C2HA 3MKYB 1LDDA 1XMAA 2DPTA 2FXFA 4CPAA 5AG4A 5FKOA 4JXRA 1TF9A 4FD6A 4QB9A 1S7EA 2JSCA 3FK6A 3ZMTA 2HOTA 3HHHA 3R5DA 5DD8A 9ANTA 2FEZA 3CUOA 3WC5A 4UUTA 2W84A 1HA8A 2YNCC 4ABZA 4KSIA 3IRQA 2CS3A 3K2AA 2FE7A 3CF2A 1ZN2A 2JBJA 4KISA 1J4JA 1XCBA 2KIFA 3VB2A 4U9YA 5CVUA 2XEGA 1UG0A 4YEJA 1SGQI 3F0AA 3PUFA 3G8WA 1H9GA 4ZY1A 2EFNA 1SC7A 1UCRA 3IIBA 2LC2A 4Y13A 3L2VA 5LEKA 1JHFA 2P6SA 2JBKA 4G94A 2RC4A 2WSAA 2NRAC 4R3LA 3R9FA 2UZKA 4G9YA 4C30A 1S3JA 5JLXA 2J87A 4KVME 1VF9A 4O6JA 2BUSA 3DR8A 3JSPA 1BR4A 4CAWA 2HVSA 2RGVA 1W4MA 3V7RA 5EF6A 4L9TA 2R1IA 3VPRA 1TTYA 4KNYA 3BR5A 4CYOA 4M3EA 2VKHA 3IFEA 3DBHB 3FXTA 3QPTA 1ZG5A 1X1DA 1IICA 4GM5A 3CCEI 4IOAF 2SGEI 3P9KA 3F21A 1Z7LA 4CZCA 1FBQA 2IGKA 3OSFA 2M5XA 4C2XA 4FX4A 1EA3A 2LH9A 3Q0UA 2XGDA 1V54H 2CNTA 4HNXB 5DCMA 2M2EA 1MJ9A 4Y52J 2VODA 3CJRB 1D8JA 1VQNI 4JX5A 4X8IA 1Z8XA 1HSTA 2LRDA 3JRUA 4NGRA 4Y49C 4MCSA 3HUGA 5E17F 4A5NA 2K9NA 5C4JJ 1UB9A 1F1ZA 4HSRA 1VQ6I 4RGXA 5HDNA 3TOAA 4X5KA 5HQ8A 1M4LA 1K79A 2UZ3A 4JYWA 1JTXA 1Z3YA 2HGCA 4RB1A 1VQMI 4B14A 1MMDA 5KNLA 3D2PA 3ERMA 4RS8A 4AXVA 1Z5RA 6CPAA 1TOTA 1ZR2A 3K4LA 3I0TA 3JRHA 2FL4A 4ZY0A 4YIIA 3J81K 3KZWA 2QBYB 5B66C 3NEUA 4IRHA 4UVCA 2Q0OA 4UEFA 5I4MA 2ORWA 2F5EA 3NQOA 4A12A 4LGWA 2H1LA 3ERED 3O2PE 3NH5A 1G3TA 4CS0B 3CMAI 3VYUB 1Z05A 1TF8A 1IN5A 2OTJI 2L9NA 4LQ6A 1DPRA 1A5JA 3ESWB 2KLOA 3FF5A 3CD6I 5FFXA 2WB1N 3MWMA 5DV5A 1WWZA 2P4WA 5L3BA 2B3UA 3D4UA 3GZ5A 1EH8A 4AIKA 2E2HJ 2XRCA 4P4IA 2QWWA 3K6GA 2Y75A 4WXHA 3KHXA 3S9MA 3W6JB 2OR4A 3I59A 1PDNC 2XF6A 3I58A 4KVOE 2OZ6A 3MN2A 3D1NI 2ACJA 1G3WA 3BPVA 1P6RA 4NBQA 5ED4A 2QQ0A 2VZYA 3TW7A 5AG6A 5F49A 2PFBA 1XB4A 1YVKA 4BQAA 2DYRH 2PJ8A 5KCMA 4CGOA 1MBJA 1VQKI 4FHTA 2LOOA 3BC8A 1Z9CA 2FS5A 3QNVA 2M7AA 2W4SA 3QRFF 1IRXA 3AKZA 3B3SA 1Q2CA 1G2HA 1X4OA 1MH3A 1YTYA 3FYNA 4OKOA 3BQZA 3OYDA 2DMTA 2PJ2A 4MFPA 3MZ8A 4C7HA 1ZYRF 2WA0A 1GDTA 1H8LA 5E3LA 5L3DA 4OC5A 5K8NA 4FT8A 2ETHA 3CCJI 3NWTA 1JI8A 1P9GA 3SJGA 4II9A 3OWTA 2ME6A 4EJOA 1USSA 4I01A 3W2VA 1P9QC 2LVSA 2B7EA 1MDMA 2QUFA 2JT1A 5LYLA 5J47A 2V9PA 4M9XA 4MCPA 4U7BA 3C7JA 3LA7A 5IYBJ 4YFNF 3O6BB 1E3OC 2Z99A 5EC4A 2DCEA 2IJLA 3HKZN 3J7ZI 1Y1BA 2NYQA 1QA6A 2CUEA 2RIJA 2EJRA 3V8IA 1XGOA 3I9V2 3H92A 2X4HA 2DFIA 1ETOA 4D0PA 3F8NA 2ZEMA 1BIBA 3RZAA 1M8CA 4BJ5C 3HB9A 4C2TA 4OADA 2B4DB 1QO0D 3PUBA 2B4BA 3BQYA 4M72A 1DDNA 2Q8KA 4MJ8A 1V1HA 4KUMA 1GV2A 2ZNYA 2HYFA 4KT6A 1MMAA 1XIXA 1Y9KA 1BC7C 1R1VA 3ZMDA 1CF7B 4A3BJ 3S9NA 2MA3A 3E6BA 4BYYA 2VIXA 1N71A 4NGNA 4PXBA 5J6XA 1EV7A 1HDDC 1IXRC 1R22A 3HPHA 5D8LB 3HOXJ 7WGAA 4F9VA 1R6RA 4MO7A 4OC1A 1UFHA 5JM6A 1MSFC 4DW6A 4P9UA 5IB9A 2FIAA 1LEBA 3U9GA 1LVKA 4C2MJ 2JMWA 2LD5A 2F6CA 3K0LA 4NGQA 2R5YB 2FU4A 2CWHA 2VT3A 3CP2A 3T8TA 1I12A 1XMKA 4HA8A 4NQWB 2DA1A 5DEQA 2QKMB 1TLHB 2DMUA 3JUWA 3A0BC 3LL7A 4JK1X 1LB2A 4P6YA 1QVTA 4L9JA 4RGSA 1XE4A 4UA3A 3FMCA 3JRAA 2VPLA 2V1NA 1S8NA 3SXYA 3C26A 3EXNA 3T8WA 3KZYA 3FBUA 2GIVA 3RZOJ 5J8FA 2FMYA 4B44A 1LJ9A 2GAUA 2HU9A 1W3SA 1YLOA 3VARA 1BIAA 2EFWA 2MLKA 4QLCU 3G71I 1XX6A 1GYTA 2JZYA 4LG0B 1G3SA 4F93B 2L54A 3B4VC 3R5CA 3KEOA 3QOPA 3VDPA 2HZTA 4GRIA 1PTQA 2VBZA 3IL2A 2PMZA 3HOWJ 2GWRA 1K83J 2JA7J 4A3CJ 3C2GA 3HXLA 3BHXA 4B11A 2JW6A 4HPQA 5EX3A 2Z3NA 4ORFA 2EA4A 2VQCA 2LY9A 1W7PA 2GA1A 1W36D 3ULQB 3I55I 4J3GA 1H8AC 3WODF 4XPKA 2V9VA 3OS1A 3U21A 5CBMA 1BN5A 5KVRA 1TW3A 3OR2C 2B63J 2HDWA 3KCCA 5HNHA 1Y8FA 4A38A 3OOPA 2JN6A 2R5ZA 1QSTA 3U1DA 3FH4A 1QPMA 2WAQA 2VBWA 1JTYA 4HOBA 4EM0B 1IY5A 3GYAA 4MNUA 5CCMA 3AG4H 1ZLJA 4BHCA 2WPXA 1RNLA 2OB0A 2ZOFA 3CMEI 4ZYGA 2VEZA 1FIAA 3L2NA 1BI2A 4K30A 1U5KA 4XRSG 4ZBGA 1MIJA 4OMYA 5LRGA 3F6VA 2QQBA 4JYKA 2H09A 2V26A 5D5WB 4OIPF 4MHPA 1O57A 2IS2A 2R7DA 5K8PA 1PUAA 1RC9A 1GHCA 3E59A 4MFJA 1TP4A 5GAHJ 2XAGA 1WJ5A 2FT0A 3GTLJ 1MBEA 4LUAA 2VC1A 2R7QA 4DNCA 4R79A 5E3NA 3FNCA 2EZKA 2DA2A 2R7OA 1KU7A 1LAMA 2HPMA 5HMNA 3GX4X 3T9YA 3ABUA 3NARA 4A3DJ 4JOMA 2LLKA 1L0OC 2ZNZA 2KFDA 5F09A 4C3HJ 2YX7A 1I39A 2BHZA 1BC8C 1HCRA 4FASD 2QQDA 1MKMA 2A5WA 2K9HA 4YFKF 1MGTA 3KHZA 5F27A 3H5NA 1CT2I 3M4OJ 3CCQI 3IWWA 3K4MA 4CCNA 2N52A 4B10A 1FYLA 4MQVA 2JA5J 4RUHA 1GUUA 2KP6A 3HPGA 3OV8A 1Z1DA 3ZP5A 4A3JJ 3N5FA 5HVHA 2KKOA 4L9VA 1FOWA 3RKXA 5K5RA 2VE9A 2LREA 3CCMI 1VKCA 4BQOA 1UHSA 1BI0A 4CGZA 4PUSA 4P4JA 2GIZA 3K4JA 3DGVA 1TBNA 4F9UA 3WG9A 4XICA 4RA2A 1OPCA 2H8WA 1OVOA 2VQLA 3CLOA 4HZFA 1HKSA 3TJQA 4CGLA 3Q0WA 3PGPA 3P2HA 1ETKA 2XAQA 3CDIA 1QSRA 3DNSA 3I3GA 4AYBA 2V6CA 1FWZA 2Z9OA 3OSGA 1HBXG 1TT5B 3Q9VA 1TZLA 2KZGA 1R36A 5FFZA 3SZGA 3E6DA 4E70A 4XKCA 3Q5FA 5F48A 2OVOA 2OPTA 3GW2A 5LEJA 4N0BA 2NU2I 1XMXA 5CLSA 2XPWA 2ZW7A 1WH5A 3JW4A 2G0BA 3UR3C 1QZZA 4JX4A 2WYRA 3GIUA 3MCZA 5F1RA 5HH1A 1OCRH 4JQFA 2LR8A 3LACA 4MMOA 2VI6A 4EV0A 1ZG3A 4P4EA 1BBYA 4Y17A 2PR1A 2FNAA 2V1CA 1H89C 5FB2A 3W6XA 3UNGC 2R0QC 2L4AA 4AD9A 4BS9A 2KRHA 3R9GA 3K7AJ 4BE0A 2JA6J 2EINH 1FTZA 5FRNA 2RFHA 2ELHA 2I00A 1DGWY 4BY7J 2GLFA 1O7FA 2HOEA 5IT3A 5FLMJ 1D5VA 1VQ5I 3DKYA 2PJ7A 4A24A 2OCCH 1R71A 1WFXA 4BBHA 2QA4I 1EE3P 3W2AA 2PJ1A 3WT4A 1V5EA 2ZXWH 1LPQA 1TQMA 2UXXA 5DS9A 1Z8LA 1PYVA 4DZJA 1YVOA 5LBQA 1RUOA 1X2MA 3PFEA 1VQOI 4A30A 4AVAA 5J4YA 2CG4A 2X6OA 2TCTA 5M5YJ 2V77A 1HSJA 2C27A 2A6EF 1LVAA 2LBFA 2DA3A 2L5QA 4DYRA 4CGPA 1HW5A 3F6OA 4XLAA 3PFOA 2KJCA 3ML6A 2H94A 2R7FA 3A03A 3TDZC 4S05A 1M1EB 2ZJQF 1CJWA 4EJVA 3MQ0A 1OBRA 4HEA2 3QTLD 1XTAA 2RDPA 2JXDA 2E5RA 2VXZA 4XRSA 5FVJA 2E7XA 1K4SA 5KTCA 1P92A 3JTHA 2AJ6A 3A1YA 4QSHA 1XBTA 3JREA 4E7HA 1TURA 2OD1A 2PMZN 3MKWB 2IBDA 2C6GA 2LY1A 4PSXA 5F47A 4M6YA 2ISZA 1IUYA 1X4PA 4XLCA 1ZAOA 3TOBA 2XUBA 1XRYA 3QYFA 4ZC3A 4ZZLA 1HF0A 5HLHA 2IMOA 3K4KA 1VQ4I 4QWQA 1TQPA 2K9LA 5AONA 4UY8I 2Z10A 2X9DA 4TNUA 1TWHJ 4O3MA 2G9DA 1V55H 1X19A 2GKVA 1MW7A 1CF7A 2DTRA 4HX8A 2REEA 4IF4A 4IRIA 4NC6A 4ZI6A 2F5FA 4GYIA 2GBYA 4GI3C 4EVYA 3X2QH 3JR9A 3PNYA 2VBXA 3D67A 4HRIA 1UVGA 4I6ZA 3ZZIA 3WC6A 1OYVI 5LGTA 3TP3A 2HUZA 1U6MA 2KISA 1ULMA 3RBUA 2E60A 2OZHA 2WZNA 3GTKJ 1AOYA 4B13A 3F8FA 4ZTFA 2R7SA 2R7XA 1G4DA 3PNTA 1CGII 1IOIA 5G22A 2Y9YA 4CDGA 2H27A 5DWMA 1WI3A 3TDUC 2I5UA 3S14J 2RQQA 4DBRA 3L09A 2QENA 4EGZA 2M4KA 1R49A 5FRMA 3MKLA 5HVFA 2ZXIA 5JH9A 4MFDA 5E1XA 1IN6A 1QQIA 1OYWA 2EK8A 3CCUI 3K1NA 2BVMA 3VDUA 3CUQB 5EGOA 4Q7AA 3S1RJ 2LUYA 2CNMA 4MHNA 1MT1A 4LG0A 1ZG7A 2WCYA 3WG7H 2CO5A 3D7DA 3HRMA 2BL1A 3KQXA 5BQTA 2CV1A 2ZKZA 1IW7F 3MEXA 3S2DJ 1FYMA 3PB6X 1GXQA 2MC3A 1Q1HA 4ZYEA 1YR0A 4R57A 3PQKA 4IX7A 3E3VA 1RETA 1AUGA 3PL8A 3ZN1A 1O7LA 1KUXA 2JWTA 2V9KA 3D0SA 1K4TA 1M8BA 4R6TA 2DI3A 1AU7A 4YU9A 4BGDA 3M07A 3OY9A 2AFSA 3PBBA 2M34A 2XGEA 3ABKH 5JQ4A 1BUSA 4N4OB 3J80Z 1OMTA 3CCRI 1ZRCA 1CPXA 1KZFA 3HGGA 3K9TA 1I3AA 2MLGA 2K3FA 3BOQA 2HKOA 3RU0A 2JVHA 3TGNA 5F0FA 3HJEA 2ROWA 1D1BA 4E7JA 1TIHA 2CNSA 2IA2A 4XNFA 1A2ZA 2VT2A 3BG5A 2ZC2A 1FT7A 5TGTA 2F5DA 1IG7A 5ISVA 4CXFA 3P9CA 4FD5A 4NF1A 1KBFA 3EY5A 2OTLI 3WC7A 4HDUA 2M1BA 3IWGA 1BOAA 1O3QA 3H3VK 3GLLA 3ZQ7A 4U0WA 1WRJA 3O8GA 2DB6A 4HKFA 4MFLA 1WCMJ 2H6CA 2P8TA 4U0YA 4KOUA 3TC8A 2NNNA 2K9MA 3P7NA 2ZMEC 4HLXA 5LRRA 5THWA 2X7BA 3V38A 1YYVA 1Y8QB 1S7OA 3SI0A 5C44J 3WHBA 4CUGA 2AE6A 1HW1A 3FM3A 5F1JA 1HW2A 2VZZA 4A2UA 4UUSA 3DXJF 5KK1A 4LB6B 1DTDA 4CAXA 4H0EA 3BR1A 3I54A 3DEWA 3E97A 4N4NB 2CQ7A 2ZJRF 2HTSA 3ZMSA 2DXQA 2HEOA 1FSEA 1SFXA 2VN2A 2PX9A 4GXHA 4PQAA 2LFBA 2XRNA 2PJAA 2SGFI 3WGGA 3UGLA 1FP1D 2HPIA 5KHDA 3BZCA 1F5TA 2EWBA 1XBUA 3GYHX 1PP8F 2FBIA 1F4KA 3GLJA 1VZ0A 3IP4B 1F2OA 2Q0YA 3B3TA 5LYIA 1F43A 4L89A 2O0YA 1FBUA 2LG4A 4HNUA 1SAXA 5FUXA 3D8PA 4XBFA 3MN8A 1LE8A 1R1UA 3IU1A 1T08B 4E2AA 5CPRB 1CGPA 3HDDA 4R8HA 2CW0F 3AG3H 1VFCA 3L2CA 2GKRI 2L9RA 1FOXA 4X2TA 1D1AA 1R4NB 1HPTA 1YLEA 3ZQHA 1YIOA 4N9HA 1U5TA 3B3VA 1T95A 4PFPA 2F7VA 2E34A 3WGHA 2R98A 1YS6A 2CQNA 3GTMJ 4WXDA 3B02A 2GE3A 4E7SA 3RSNA 1LCPA 4OIOF 1KYWA 1W5SA 2DOEA 2WB1A 3EPZA 3ISXA 2HQYA 2N71A 5E1ZB 2ZW5A 1ZRFA 1QHGA 4MHGA 3SYTA 3CPAA 2W7NA 2WAEA 2DK5A 3CJQB 1BLLE 2Z16A 2XF7A 4CH7A 1REPC 4RAZA 3VDXA 5DM7F 1WK4A 2MSYA 3GTOJ 4MTEA 3GOXA 1B6BA 3IH4A 4C3JJ 3JRBA 2PMUA 3OS2A 5D4SA 1PUFB 4KMFA 3B7IA 1SGNI 3BWGA 1ZELA 4AU7A 1WGTA 1X58A 4R1HA 5FJ8J 1Z91A 5D5XB 4AIJA 1BI3A 1F57A 1XC5A 3S15J 3DP7A 5JGFA 1KQ8A 2JA2A 2OF7A 4BE2A 5LRSA 4TWEA 1U9NA 4DOZA 3FKJA 1GLNA 1D5YA 2HI3A 3NRVA 2F4OB 2K5CA 2A6HF 1KONA 2COBA 3TKYA 4AB7A 2FXAA 3TCVA 5JFRA 3OVOA 1FP2A 1YHQI 2B3VA 2K3PA 5ERIA 4B48A 4CRZB 3ISPA 3UKGA 3CPXA 2BY1A 4UV9A 3NWSA 3OYBA 4A95A 4V2GA 3BI0A 1ULNA 2M4GA 3H5AA 1ETYA 2F3CI 3FX3A 1RTQA 4M3SA 1R7JA 2P6TA 5GCNA 1S7NA 4C7IA 1YGHA 2L8EA 1RKTA 3VWBA 4HF2A 1J7KA 1OISA 3QPLA 1B4AA 2Q1ZB 4E7IA 5CNPA 4S04A 3HKZA 5HS9A 1ZG8A 4XKVA 4IO9F 1Z4EA 2AFUA 2EBJA 2V8DA 2VQGA 4MCRA 1UJ8A 1DP7P 3S3OA 3J80K 1KU3A 4EM1A 2QVOA 1XDSA 3S2WA 4A6EA 4ZX9A 1NH3A 1T0FA 2FOWA 2MD0A 4RAYA 4Y4RA 3SJFA 1W7PD 5F0CA 1I1DA 4M73A 4AVBA 1H88C 3M9AA 4OIDA 3WTVC 2V8HA 2ZB9A 5EX0A 1ZG9A 4M6VA 3BTJA 1Y0YA 3HL2A 1USTA 2QPOA 4NGPA 1OMIA 1B87A 3KY9A 3FRMA 1LAPA 5DS0A 4CGMA 4XNHC 2WV0A 2ID3A 3I4PA 1LEAA 4LIUA 4A2ZA 2PVWA 1WJFA 2M8GX 4OIRF 3SHFA 2LEOA 1ZLIA 3ELKA 1HLVA 2A05A 5E1WA 1Z7UA 5FO5A 1UAAA 4I0AA 2ZOGA 5CVRA 4RDUA 3REOA 3OYEA 4B5PB 3IO1A 4NJRA 4Y15A 3PDNA 1HDPA 1XX5A 2CJJA 2MYSA 3IC7A 3TO9A 1CT4I 2W57A 2RN7A 3HBLA 1HEVA 4A93J 4XLFA 2PN6A 3CO6C 5AIPA 1T33A 1TT0A 4ZZDA 2XSJC 4FTHA 2X51A 4FISA 3QU3A 5IYCJ 3S2HJ 1JGSA 5CVJA 4ZTJA 3VEPA 2BEOA 3K10A 2VC0A 4OAYA 2QIRA 5HXDA 1CP7A 1T56A 4KIBA 4UWJA 2AFMA 4L8AA 4BJ6C 3S6FA 5IX3A 5J3LA 1V3FA 4HDVA 1YOVB 2XVCA 1W36C 5DUIA 1R4MB 3ZQFA 1K7AA 5JHFA 2H8RA 2RV8A 4HV5A 1B72B 2JYYA 4IQ4A 2X48A 1S20A 1X74A 1ZGAA 2QCOA 2ZMEB 3QAHA 3IV5A 3GFLA 1JJ6C 1VQLI 3IEHA 4KLWA 2W82A 5A27A 3HHGA 2N17A 1BAVA 4ITVA 2HOAA 2HXIA 2DODA 4XN0A 1I1SA 3BZKA 4YIFA 2B8TA 4AWXB 3G1OA 4L0ZB 3B73A 3GBGA 1R0RI 3CT9A 3HRSA 2DA5A 4BBRJ 5CPAA 2R7UA 4Q4ZF 3MRUA 1XPXA 4FBEA 4NNJA 1XEBA 2EIMH 2PJ5A 1S9HA 1MH4A 2XV4S 5E3MA 3PB7X 2VXDA 2NVYJ 2OC6A 3ABLH 1S5KA 4BE1A 2J5PA 3CXSA 1J09A 1BM9A 4KUBA 2DF5A 3GZNB 1B8IA 1CE3A 4IPAA 4JCVE 2XC7A 3GZ6A 2L01A 3HYIA 4AVZA 3SEKC 1H0ZA 4KOYA 3LOCA 4UCNA 3H1CA 4XK4A 3CJNA 3WTSC 4G6TB 4CHUA 1I21A 2C6CA 3ZQGA 2Q4VA 3ZMZA 1WJBA 1UHMA 1VQ9I 2I8DA 4IHWA 1UUCA 3RKYA 1EKEA 2BGCA 4NC8A 4UCPA 2LMDA 4P9FA 3PB9X 5J1YA 4G7HF 4QIWN 3BR0A 5IOZA 2ECCA 5M5XJ 2RB7A 2VL1A 1KQ9A 1SMTA 3VODA 4D5CA 1DPUA 4B3XA 2XROA 4JLYA 3LSJA 5G1ZA 4XRMA 3GLXA 2Q2EA 1KZHA 3OS0A 4MY3A 2E19A 4BU2A 2PJRA 2R8VA 3BR3A 4E1RA 2G7HA 1POGA 1E17A 3ZQIA 2CWFA 1IYKA 4F55A 2QQEA 3BI1A 4ONWA 2FF4A 1DU6A 3D7GA 3P5JA 1D8KA 2BXYA 4D7NA 5B5EC 1U3EM 2JRTA 1OJLA 4ASNA 1J5YA 4M6XA 2YUUA 3QWPA 5LFAA 3FWEA 5L3FA 3SJXA 2M0CA 2V8GA 2AXLA 4KJZA 1VQ8I 2ODDA 4M6HA 3W91A 3RYRA 2KIUA 3EUKL 1LR8A 1S60A 2MD5A 4RGRA 3H5RA 3CCVI 2EIKH 2YX4A 2F4IA 3GWZA 1R3NA 4A6DA 2FNFX 3R5AA 2QF7A 1WGCA 3D5LA 1PUEE 4XLNF 1SD5A 1B6AA 2W25A 4UV8A 1HKTA 2YU3A 2E1MB 3IKVA 3FXRA 3GTGJ 1ETWA 1RESA 2ZXJA 4IHTA 3EDPA 2VUMJ 4NJQA 2MGQA 4DYOA 3F8CA 2ORVA 2ZENA 2QMLA 2CU7A 2MG4A 4FUUA 2R7VA 4OOIA 2BY2A 1SVLA 3W2WA 4BXFA 1JKRC 1FMVA 4D9JA 1GT0C 3FK7A 5JHUA 2JA8J 3GF2A 2QZ8A 2O7OA 1Y39A 2NU4I 2ARPF 1ACIA 3BT9A 1E2XA 4MFEA 4II2A 2LKPA 5IP6A 5ICFA 2ZFWA 2QLZA 1Y1WJ 4MRIA 4E7LA 2QSGX 1CBXA 4LFUA 3GCMA 3VWDA 1OCPA 4CYNA 4A0ZA 3KP7A 1WKXA 1TC3C 2RNJA 4BQNA 8CPAA 3OYKA 3D68A 5FROA 3DV8A 2VKEA 4R8FA 3KP3A 2BZTA 1MD0A 3HC7A 1W0TA 2ZCWA 2TRTA 1ZR4A 1ZTRA 2OZUA 3LAJA 2NS8A 3OIQA 2JRMA 3EFAA 1R23A 3KEQA 4PK2A 2QYOA 4DUKA 2O9LA 1H0MA 4ENNA 2P6AC 1OZPA 2DDAA 2W00A 5K1YA 5TJJA 3IU2A 3I3LA 3SGQI 4AG7A 5EZHA 1Y7EA 3N7ZA 4HF1A 4IOCF 1BMOA 5D4RA 5HLTA 3OYNA 2CV2A 3SDBA 4BEHB 3L2WA 4B6ZA 4O5VA 1M44A 2FVGA 4ZGYB 4KS9A 4YG2F 1ON0A 1DP3A 3B6CA 4A32A 2BW3B 1P0HA 5HNFA 2Y69H 2KL4A 4Y3OA 1IY6A 2F5CA 3I53A 2GKTI 3A01B 3V7SA 4IK2A 2AQEA 1SFOJ 4IHMA 4M6GA 5HDKA 3EYIA 3EO4A 4LITA 3MEKA 4J19A 4AIDA 2VJIA 3CQZJ 4ESFA 1YFHA 1XGSA 3D2MA 3H9JA 3VOEA 1SEUA 3FF3A 3IGRA 2O5RA 3OYMA 2B0UC 3VYTB 4R87A 2ME0A 4IL6C 5KTAA 4XIDA 3RQ4A 2PJCA 1YRNB 5H2FC 2CJSC 2M7BA 4F0XA 4PJMA 3V8KA 3SJEA 2JTVA 2CMPA 3KPHA 4UVAA 3K1MA 4XLHA 1PCAA 5E3QA 1T98A 3TL4X 1P7JA 1Y9WA 2LDUA 1JKOC 2Z11A 5IY5H 1A6QA 3QP6A 1DUXC 2UUZA 4Y49B 4QBJA 4BHBA 2RNGA 3JTKA 2E5NA 2BO9A 3A4CA 4XPLA 3VWEA 2DQLA 1A04A 4JP0A 4XOTA 4DQ2A 4XPDC 5FKKA 4BNCA 1RO5A 3F3XA 5H6RA 1IUFA 3E6MA 3S16J 2X52A 1QPIA 4JXQA 2AFWA 2Z3KA 4AVCA 3KKWA 3DTKA 2LKXA 4L5JA 4ETSA 1TNSA 3WTZA 4PCQA 5EBVA 3WTUC 4CYDA 2EZLA 1Y1CA 1KWMA 2HOSA 2I3CA 3VH9A 5LYFA 3W6KB 2VRWB 3DR6A 1M1DA 3ASOH 4FQGA 2A5YB 1UHWA 2ZJPF 2NU0I 3FX6A 5AG5A 5K7FA 3PIPF 5GAEJ 4IVNA 1I1GA 3QOEA 5H20A 4XLPF 3R9EA 5H84A 5B1AH 1APLC 1ONVA 5C3EJ 1NMTA 2GZWA 1KYZA 1CT0I 1R5ID 2DA7A 5TISC 3CLQA 2EK9A 4KSFA 4X3RA 2FMLA 3RQIA 1V4RA 2A69F 4PGGA 2Y0MA 2IEKA 4I2OA 2TDXA 5BPIA 1M4GA 4MLOA 4HX7A 1EH6A 1JGGA 2PI0A 3W6VA 1WWXA 3QYEA 3H0DA 2O28A 1X1CA 1WHUA 5ILVA 2KMOA 2XEFA 4DIQA 2FE3A 2RQPA 3TE4A 3I1UA 1SVMA 2HYGD 1N75A 3CCSI 2DMNA 4EMSA 3ROUA 1JHHA 2HQ5A 4DYCA 3TEDA 1U8BA 5LHIA 3OL0A 3HZJA 2YR2A 4Q36A 1Z6RA 1YG2A 1NG7A 2V79A 4XORA 4EJUA 1VTNC 2QBYA 1PTRA 2PSWA 2K02A 2MBFA 4KICA 2CQKA 3M1EA 3JAMK 3CP8A 2Q43A 3D5SC 2Q7SA 4ON0A 2HXOA 2ADUA 2IT0A 3M8JA 4HNWB 3GFJA 4D5FA 2O6GE 1FT9A 1D1CA 1QGPA 1LR9A 1ZLKA 2R92J 4I02A 2JEVA 1QHHD 2EZHA 3DCFA 1QZYA 4RMNA 5JLWA 3H9GA 1FTTA 4KIFA 2FUG2 1WJEA 3BZ6A 3LMSA 1KQ0A 4A0XA 1JWQA 2BOLA 3ZMUA 3WTYC 1R79A 2WVJA 2NVUB 3KP4A 4E4HA 1P4NA 2ERWA 1OFCX 5CQEA 4M74A 4XSXF 1Z0XA 2V1UA 4BY1J 4Q5SF 2AFZA 2OZGA 3D7FA 4I0BA 1FIPA 2OBPA 1B9NA 3G2BA 1JUMA 1PVEA 3SI1A 4BJTA 3DPTA 3NE8A 1CHOI 3M8FA 5D8KB 2J8RA 3SFIA 2HYJA 4MFQA 4M3BA 1TKJA 1U2WA 1N13A 1JT6A 2X6YA 2V8VA 3UGIA 1TUSA 1XG1A 2AHQA 4W1UA 3FXKA 4Y7NJ 1X2NA 3I56I 5J1RA 1NHAA 1QSOA 1KBEA 2DOAA 2DDBA 3CC4I 1RPWA 4RAFA 4C2YA 2FJ1A 5M3MJ 1DS2I 3I5UA 3FJUA 4ZJZA 2I10A 5L3EA 3LAPA 1XFOA 2K27A 3B3WA 3KI9A 4NGMA 3QQAA 1VIXA 5G20A 4EATA 1FX7A 3C3WA 2R7TA 1XDUA 2HQRA 5E20A 3RPUA 2VONA 5HI7A 1I27A 4FD4A 3AL0C 3ABTA 3PFYA 5E8IA 1YQEA 5BMZA 2OAZA 4EM2A 2AS5F 3UY5A 1OYIA 3S6HA 1WJCA 3HOSA 5F08A 1FNOA 1YREA 1L3LA 2QECA 3GFIA 3RJPA 1GXPA 1QRYA 3KP6A 2KRFA 3LWUA 2F4MB 1O4XA 4UEZA 2ZFUA 1OMUA 3S3NA 1LR7A 1YI2I 4OWRB 4PXEA 3K2ZA 2KHMA 4M3DA 1SD4A 3B6AA 4GCVA 1SFKA 2JSPA 4KDPA 2ZJ2A 5L3GA 2O53A 3F5BA 3DTIA 1AHDP 5LGUA 4AG9A 4GYGA 2B4DA 3MKZA 5AIQA 1UELB 1PCEA 2DOFA 2WY8Q 4IEJA 1RUNA 1IN8A 2XEIA 1YK3A 2EFPA 1V5GA 2XAJA 2XKOA 2DKVA 2SGPI 1ULYA 2GVIA 5CVIA 1TKHA 5C82A 1I3QJ 2BV6A 1Z8WA 4EFDA 2DFFA 1FSHA 3UOEA 2SGQI 4MHYA 3CC2I 2R7RA 2UWMA 3PEIA 4O23A 1OLTA 4MEYF 2E1NA 4H89A 1ON2A 2MH9A 4HX4A 1W1WE 1X3WB 3FHNA 1NSLA 3CDXA 4BXUA 4BKXA 1F9NA 1K61A 3ZQCA 4A33A 1QMUA 1JT0A 3QAYA 3FC3A 4B6DA 2R5YA 5LHHA 4BDYA 4KSAA 1XF8A 4NQWA 4E7ZA 1KMAA 2YNCA 5KTDA 1QBJA 5GADJ 1AMPA 4U5YA 2LY2A 3DF8A 4CCOA 5EG0B 1S6LA 5LHGA 4KORA 4OC2A 1WJAA 2CUZA 3CCYA 3F22A 3BLNA 4YFJA 3PIOF 4U9ZA 2RVCA 2QQ8A 4UFWA 2Z3MA 2NOGA 1P7IA 3Q0VA 2P6EA 3N05A 2IGMA 2Q44A 1ZH5A 1IXSB 1YITI 2X3TA 5D29A 4N9IA 2JQ7A 1ZKGA 4B47A 3LFKA 1R1TA 1U0JA 4ZDLA 4CCLA 5ICGA 2IPQX 5FLXZ 3QP5A 3KFWX 1NSAA 3H0GJ 3KYCB 2IA0A 1XA6A 2OUMA 2W1OA 2XDVA 3BJ8A 2OU2A 1T2KA 3H35A 2L7KA 1J75A 2DPSA 2Q51A 1Y6IA 2F5IA 3WE3A 4WCGA 1AKHB 1YW6A 3FBNB 2PR8A 4RI1A 2CH0A 4D1QA 1JXSA 4B1RA 3CJTB 2GA2A 2ZSIB 3T0YA 3SI2A 2WBMA 2K7LA 3N4MA 4UNOA 4D7MA 2O61A 2DT7B 2IS1A 1I5ZA 3BJ7A 3RYOA 1IRFA 3F9KA 4R3KA 2C1CA 3R6SA 3UEJA 3GUXA 1TWFJ 1P9ZA 4P4FA 4Z2YA 2VBYA 3CZXA 4KOVA 1ETXA 3WR7A 2NNYA 2ZEOA 4Q48A 1X1AA 4L18B 2XF5A 3B8GA 3SZPA 1CX8A 3RKWA 2PIYA 5DCMB 4MEXF 1IN4A 1LFBA 2JPCA 3KETA 3WTTC 3IH3A 4OLLA 2LK2A 3PSIA 3M7GA 3PFIA 4FE4A 4KZTA 3DBRB 3HUGB 3KIOA 3SFZA 4B4CA 3ZQLA 3SZTA 3K4NA 1E0EA 4X6AJ 1W4RA 3C18A 1IB1E 2WV1A 2EILH 2KZVA 3RAMA 2KMRA 3TFYA 3W3CA 1LRZA 3T1BA 2ZEPA 2QQCA 2K4BA 4LLLA 4UIBA 3EUHA 1QVUA 1OR7A 4AM3A 1U78A 3FEEA 4G7ZF 1QQ9A 2CUJA 1A6IA 4OVOA 4FE7A 1YMEA 4Z65A 2HFHA 3E7LA 2WPWA 4XR6A 2LYCA 5E8GA 3CO7C 1MK4A 3FHZA 2VOOA 3CMYA 4NC7A 3TW6A 3U2RA 4A5MA 4F3QA 1PU9A 4UBRA 4IKFA 1S7AA 2RREA 3WU1B 1GVJA 4IZZA 4R76A 1U8RA 2LTPA 2V1XA 4LK1F 4OIWA 1BPMA 2KPMA 2B0LA 4UB6C 3NE7A 3HGYA 4OINF 4F8ZA 2KDZA 3FISA 3WGIA 2BCOA 2EO8A 3HOUJ 1IC8A 4H2KA 4JWPA 4M3GA 4CAFA 3D5RC 1HEEA 2VJ5A 3K4CA 3RZDJ 3DLLF 5DM6F 4NSQA 1YJNI 2Z3LA 2WADA 5FKNA 4G6QA 2DMQA 2XEJA 2G9WA 2G7UA 3I59B 4ZYHA 1KUVA 2A68F 3WU0A 2PE3A 1PJRA 3RTRA 4RLQA 3KYDB 3R61A 2Y2ZA 4IRGA 4E1PA 2ZEHA 2MFZA 4RAGA 1FNNA 4KITB 2V1DA 2DA6A 2DTZA 1LDKB 2Y48A 4YRVA 3LSRA 2HS5A 1RIOH 2W48A 3OYCA 1MNDA 2Z3YA 2BEIA 2HTJA 3OMYA 1IW4A 4ZH4F 2GXBA 3IC1A 2DAOA 4FCYA 2JK3A 2D4OA 5K8OA 1IGBA 5LGNA 1UVFA 3ZQQA 4ONUA 3S6GA 1Z8TA 1OYYA 2EV6A 4MBUA 1FC3A 2WWYA 2STWA 3E5QA 3AL0B 2QM3A 2KMQA 3H5ZA 1Q2DA 2IL4A 4IXAA 5E3PA 3HRUA 4NB5A 4OU0A 5GTIC 4P5OA 1HKQA 4HBLA 3SDGA 5F6FA 2K5TA 1CSOI 2V1CC 4R7MA 4HNVA 4CRYB 3G3ZA 1B1BA 2R7WA 1NK3P 1OCCH 1HC8A 2AXTC 1MDMB 2HDCA 2L9VA 1FPQA 1HXDA 3BY6A 2ZO4A 4F52A 4ESBA 4WWCA 1BA5A 2J8MA 2KCWA 2LP0A 2VASA 4M3FA 1LUJB 3K2KA 3NA6A 5FD6A 2E2IJ 1CQTA 2O03A 1G6NA 4U0VA 1A36A 5A2QZ 2UXNA 2ANPA 1T38A 3MGDA 3GTPJ 4MXUA 3FXQA 4WX9A 2E71A 2D1VA 2WAFA 4CCJA 1IGNA 2ICWG 3BCBA 1VI0A 4AVPA 4A37A 4F7ZA 2YNDA 3BG9A 4HYEA 2L4MA 3DEUA 5E18F 4C68A 4MY0A 2FNPA 4K2EA 2EPFA 5E3OA 4G1PA 5FLXK 3JRCA 2YU9J 1DGRM 1YLFA 2PIZA 3SEQA 2MW8A 2RKHA 3Q3SA 3SHPA 4PXDA 1SAUA 4IJAA 3DEEA 1ZARA 3G1LA 4A39A 2PJ0A 3J7AY 4AC0A 1G59A 1SFUA 1MJBA 1ITYA 4FKDA 2CTCA 2KT0A 2ZW4A 1RXTA 2WGCA 3CXPA 3TX8A 3D3SA 1PP7U 2M9HA 2P5VA 2YPRA 1YE9A 3QPHA 4M85A 3DPUA 1RR8C 4UXNA 2Y9ZA 3LNQA 3F23A 4IQJA 1PYTB 3LSHA 1BO4A 2EIJH 3HG9A 3IJ3A 1O3RA 1S5LC 3ECHA 4UFXA 3OR1C 3E2IA 2ZEGA 1FBSA 1V0CA 1IRZA 2B5GB 1A35A 1OKRA 5HS8A 2G3AA 4BQQA 1OQYA 2JLMA 2EFQA 2X0LA 3FMRA 2PC1A 5DTDA 5K8MA 3ASNH 4M9ZA 1TL8A 2DIPA 1GHEA 1K6OA 1NK2P 4BXXJ 1TKFA 1B9MA 3GTJJ 2OH1A 1IJWC 5LRKA 3D00A 3ZR8X 1IU8A 4HW0A 2EA2A 4XMYA 1FZPB 2YNEA 3BTIA 2GFQA 2ZEDA 3VSLA 3OYAA 4UUVA 2HC9A 1SGRI 3WU2C 4ZYAA 3L2UA 1LFWA 2HV2A 2DFHA 4F6AA 3AFHA 3WTXC 3ISZA 1JUPA 2PMHA 1R00A 3V42A 3SXNA 3CCLI 2D5VA 1P4AA 1UFMA 3KR4A 5AGEA 2E1CA 3G1MA 2LSOA 2B58A 2KQRA 2VOPA 4P44A 5LYDA 3JTGA 2GANA 2KDOA 4UXIA 2J9AA 1W7PB 1I50J 2BVLA 1YX5A 2ZSHB 3KE2A 2XSDC 5EG0A 1VGYA 2VI7A 4MI4A 1IDZA 3V8JA 3HTSB 4FAIA 2A6TA 3MFKA 2X1EA 4B3AA 4UB8C 2BYVE 4L9MA 2G3TA 1Q1VA 1WVRA 3I71A 4B8XA 2R5ZB 3PSFA 1JJ8C 4HAMA 2KCXA 4XLEA 1XMTA 2PJBA 4PXCA 3CUQA 2EV0A 1AA7A 4LMYA 1IY7A 1R58A 2F5VA 9WGAA 3SJMA 1Q2YA 2OQRA 2Z3PA 3OYHA 1X1PA 2ZW6A 4XOPA 2ESHA 3K70D 1D0ZA 1FAQA 3DLAA 4V19K 4CCKA 3CTAA 2DT5A 2CUFA 2HKXA 3BJOA 3H9QA 2R3SA 1AKHA 1K4JA 2FQ3A 4A0YA 4WK8F 4ENKA 2M45A 3F0CA 2M0MA 5J1UA 2JVGA 3RYPA 2XPUA 4LG3A 3V4GA 1SANA 4GXOA 2HVRA 3IH2A 1YX0A 5ICCA 5IT9K 4B09A 2ENNA 1Z2LA 3AG2H 3DDDA 4KYWA 3DQVC 5EJCA 4DYQA 3OIOA 1ZO0A 1Q9BA 2CF4A 5LLQA 5HS7A 1WH7A 4CZZA 4DZPA 1ELMP 2Q7BA 2OOTA 2DU9A 3E5XA 1ON1A 5BOXA 3E5UA 2NAZA 3VYSB 3FECA 2GXGA 2NU1I 2SGDI 3HOTA 1W0UA 3GEZA 1BW5A 4GS4A 2ZPAA 1ERDA 1Z4RA 5D6EA 2JDCA 5HVQC 1UMQA 1WTJA 1LKXA 2L2OA 3GFMA 4PK4A 2R4GA 4MPIA 5JVGF 3S17J 2KRCA 2P6FA 5GP9A 2J8NA 3CDLA 2E5ZA 4V2FA 1BR2A 3R0JA 2DJIA 3QODA 5H86A 1FMWA 1R57A 3D7HA 2P7CB 5EMIA 3S8PA 2L3DA 5F0HA 2NMTA 1KA8A 3KASA 4W97A 4KOTA 4RN7A 1SGEI 2KJBA 4LLNA 1YX3A 2R7HA 2MABA 1YO5C 5CCLA 5HLGA 4XONA 1NE9A 3L7WA 1OCZH 1BOBA 3LSKA 1RKWA 3EUHC 3BTCA 3LSMA 1OR7C 1ZGWA 2PJ3A 4FD7A 2DO7A 5AG7A 4RLFA 1LFUP 4PGHA 5A2QK 2E1OA 1HDLA 1S29A 4PK3A 1XSDA 3OXFA 1MMGA 2XRLA 4LOCA 4C2ZA 2QGUA 2A61A 3LA2A 3FEDA 2VQYA 3JRGA 3GKRA 2HVQA 1JE8A 4JD6A 4XL9A 4K3NA 2Z33A 1M4DA 1VHEA 3MVPA 3GVAA 1YS7A 1KGSA 1XSVA 2M5WA 4Z6YA 4NHJA 2CW7A 4OIQF 4GFBA 2CTBA 1BL0A 2DW4A 4L5EA 2WUUA 3OWCA 3LFUA 2ISYA 3F8MA 3HTUA 5TRDA 3F8KA 4NCZA 4NXYA 2CY2A 3K4BA 4WWVA 4U88A 5K7HA 3OYJA 1TQIA 5K5QA 2IJZA 4CAVA 1J2XA 2LNBA 4KMUX 4AIHA 1ARLA 3S32A 1K78B 1ETVA 5BPDA 5D8NA 3S93A 4UVBA 3T5XA 3E6CC 2PJ4A 4EWTA 2CQQA 1B59A 7CPAA 3CESA 1X3UA 2WC2A 1ODDA 1IXCA 3RCOA 5JHWC 5JR3A 1X1BA 3NH4A 4A3LJ 3RPUD 2E2JJ 2IAIA 2ZXVA 4PFOA 2VKDA 3ZCOA 4X0GA 3BTLA 2QVPA 4NDLA 1N25A 4ESJA 3OYGA 4BL0B 3PQJA 4PDKA 2VE8A 1U5TC 3A02A 4LB5A 3HLPA 3KR5A 4CYCB 2ABZA 3GMEA 2DA4A 3QYBA 1VHSA 2NVXJ 3VFZA 5F64A 1IDYA 3JAMZ 3QPSA 1OCOH 3DFGA 1IIDA 4GO1A 1TXRA 4XN3A 5IYDJ 4PSWA 2GREA 3IWZA 5C4XJ 2L02A 5EEHA 2GOXB 3OL3A 2LBFB 3FBIB 1BPNA 1ARMA 4UXJA 2XAFA 2K9SA 4MFZA 3KP5A 3DTEA 1PUFA 1ELLP 2D4PA 4KOWA 3CMMA 2W24A 4A94A 1YSJA 2GM4A 4ZDPA 1OCTC 1R43A 2G0EA 4Q47A 3RIRA 2DK8A 2XGXA 2ELKA 4UHTA 3BJ6A 3KX2A 1IV8A 4ANJA 4L9NA 1TWAJ 3CXLA 1J0RA 4I7HA 2JUCA 4BINA 4CA0A 2IP2A 4G12A 4LK0F 3RPQA 2X1CA 2PEXA 2O4HA 4YFXF 2FRHA 4OC4A 3FMSA 4CO8A 2FOKA 3MD2A 2VJJA 1AYEA 4A3IJ 1S7FA 3V8LA 1IYLA 3HIFA 2GU2A 3IWEA 3TT2A 3H36A 3O3KA 2UVOA 4UFVA 2GXAA 3R0AA 2E36A 3ECOA 2WTEA 1MMNA 2F48A 3ONQA 1K7TA 1YTPA 2ZEEA 3H4QA 2XAUA 2Y0SA 4XKBA 2Q04A 2ZBKA 3BJAA 4U7DA 3MAJA 3ZMVA 1WJDA 4AUXA 2HQNA 3DKWA 3KGQA 1Z21A 2CIJA 1TBRR 4XNHB 5E79C 3GXOA 4CYQA 5FGMA 2J9RA 3IKTA 1YU6C 3VYRB 2YGWA 4PPZA 3OXLA 2E73A 4TV7A 1F36A 2MH2A 5IP7J 4HSTA 5LD2C 1UHAA 2J5OA 3Q9SA 2M8EA 4MQ9F 3R5BA 4ZX8A 4CICA 3FXOA 4JZ0A 2B5GA 3R4KA 2JDDA 4M71A 1YW9A 3UEYA 3PP9A 3WABA 2DQRA 2GLOA 4NGTA 1N77A 3G6EI 1X4SA 2LKSA 1ZGJA 3FMQA 3HSFA 2BY0A 2P0WA 2PBIA 4I98B 3HOYJ 4KVXA 3R96A 1QNTA 5HVGA 1STZA 2FBKA 4UEEA 3TBIA 1T0FC 2JPBA 3IHUA 1UWYA 2K40A 2NS7A 2FA5A 5CYVA 5EGOB 4RB3C 1YW7A 1S7LA 3DSBA 1MJAA 1GV5A 2PCUA 1ORKA 4C2UA 4IHXA 4HGUA 2V6EA 3H3UA 3BROA 3K69A 2P7VB 4F92B 1MSEC 3S1QJ 3L2RA 4OMEA 3NAUA 2P81A 3M1CA 5L3CA 3LSTA 2ATRA 2QQAA 1IF1A 4CYPA 5DUKA 3WHCA 4X1EA 1X10A 4B5PA 2D45A 1S3ZA 4HQEA 4E7KA 3TO7A 2M3AA 2BE5F 2CYYA 1TWCJ 1XCVA 1XD7A 1Z6TA 3BDDA 3DU6A 3LA3A 5ILUA 3G4SI 4IAVA 3R95A 3V7CA 1JKQC 2KMUA 3MMYB 5K7ZA 3L1PA 3ZXSA 4MGRA 4P96A 4EJWA 2HB6A 2D2WA 4RM2A 4YELA 1FLIA 3H3ZA 1EH7A 3DWLE 2QEXI 4EMEA 4RGUA 1FJLA 3BJIA 5ILSA 2L7XA 2EWNA 2HQAA 1LNWA 5BWAB 3CUQC 2DN0A 3JVNA 2KIQA 3I4NJ 2NXNB 2POKA 2NSMA 1ZHFA 2P5LC 3RDIA 1H9TA 3GY9A 2IGOA 2Q4ZA 1W5CC 1Z7KB 3VE5A 1V1IA 4E8OA 5FD5A 2AQFA 1FY7A 2IRFG 5E3RA 1RRJA 1J9IA 2FSRA 4UCMA 1YW8A 4KA4A 1WI9A 3DKXA 1TBQR 2EK5A 1WGXA 3GO5A 2PVVA 3E1SA 1B72A 2XB5A 3I64A 4S0HB 5HODA 5J1QA 3ZJ0A 2ZMEA 5HDGA 3S1MJ 2F2EA 1ETQA 1CPSA 4G8XA 5IV0A 3B35A 2M30A 2F8HA 2CFXA 2LB7A 2HWVA 4OP4A 3GUDA 4YWYA 1MBKA 1TBXA 2DFEA 2JZMA 2X6WA 1MNMC 5M3FJ 3PJRA 3EYYA 4UUSB 1S7KA 4A3MJ 1TBOA 5JI6A 3DU5A 1JUSA 1YW4A 5CJ9A 2CWGA 1QZEA 4HF0A 5BS6A 1S72I 1PJUA 3DLJA 1SMYF 3T90A 1K6YA 2IW5A 2DPUA 5FUYA 2PRQA 4LQGA 1HDUA 3CC7I 4QTRA 5ICEA 1TIQA 1T6SA 2LF8A 1M4IA 4KIGA 1BR1A 1MBGA 1Y56A 3KLOA 1YJWI 3FB3A 2EH3A 1LANA 2ZELA 4MHZA 2VB6A 2M87A 5I0CA 2A07F 4LLGF 4MFKA 2XHKA 1LE8B 1HQCA 3CF5F 1HDQA 1Y8RB 3LSIA 1LDJA 2REFA 4KOXA 4KT5C 2BBYA 2A3SA 5E96A 1WSUA 3U1KA 2L7FP 4A3EJ 3ZN0A 4GDFA 2EQRA 2DBBA 1SFEA 2CRGA 2ELJA 3PO3J 1XJOA 2EUIA 5B3SH 4KOSA 4F91B 2VXKA 2Z1DA 2IVMA 4RS2A 1U5TB 3OYLA 4DBQA 1KU9A 3HSEA 2Q4YA 3S3MA 2GLJA 3D66A 3DPLC 1Z2IA 4HPSA 1P4WA 5KAFC 2Z3OA 4EQQA 2YS9A 1RI7A 5A28A 4EEFG 2NU3I 3H8FA 4A3KJ 2H5MA 2QYVA 2STTA 1SQHA 4NFRA 4JX6A 1K78A 2K86A 2B9SA 4H6UA 4HNYB 4UF4A 5IP9J 2ZEFA 3RI4A 3SEZA 5CQGA 2EV5A 1CP6A 1AWCA 4YGOA 1VQ7I 4MTDA 2Z0ZA 3LODA 4C9YA 3S6KA 2Y0SN 1U6GA 2UV1A 2FBHA 5FKLA 2R93J 1I6HJ 1FOKA 5F04A 3FXUA 1ZREA 2E7WA 2X85A 1UG2A 4G6DA 3A2KA 3PRTA 2W85A 1IZ1A 2K4JA 3LSGA 4OAZA 5D5VB 1VDDA 5F46A 4PJLA 4JBAA 1Y0UA 5M5WJ 2HNHA 1ZLHA 5CVVA 4IF5A 3L00A 4CYCA 4PJJA 3OXGA 1E3HA 5EZGA 4MHDA 2L9SA 3RO0A 2QKLB 4M6IA 1Z3XA 4CCMA 3H8GA 1TWGJ 3HRTA 3FKIJ 3EETA 3F8BA 5K5OA 1GVDA 2VKVA 1IOFA 1QSNA 2YUSA 1FEXA 2XKPA 1Y1VJ 3KL9A 3J7AO 2AO9A 1XS9A 2CSOA 5J4VA 2NVQJ 1LQ1A 4P4BA 3KQZA 4B12A 3AAFA 1NTCA 2NS0A 4HLYA 4ENJA 4LD5A 2NOJB 5EDNA 4HG2A 1FOYA 1LFPA 1HJAI 3BR6A 3VSKA 3FIXA 3BR2A 1XOVA 4BACA 1WZ2A 2QSFX 4LX9A 2I79A 3G3SA 3WE2A 2PJ6A 1R5HA 4P45A 1FARA 3OIPA 4MIMA 1TGSI 3J7YJ 2CW8A 4PZJA 3OL4A 3E0JB 3ABMH 3RNZA 5IB0A 1SGPI 4BMHA 1D0XA 1D0YA 1WQ2A 3L9FA 1X3ZB 3RKQA 4CAEA 2P5KA 5FKMA 2ENZA 3HOZJ 3I4MJ 1QSMA 1IO2A 4P55A 1DQUA 2FCKA 4CGNA 2DT6A 3QB8A 4C3IJ 1F2PA 3LSPA 2COMA 2DMPA 4KN4X 3M3YJ 2DEAA 1O3SA 4KLVA 1V5FA 2X1DA 3FXMA 2EZIA 3JCUC 3SQNA 1JKPC 4SGBI 2WAQN 2X6XA 5DAEA 2ECBA 4KN7X 1BJZA 3A9LA 2VL8A 1BJAA 1G3YA 4A3GJ 3V7ZA 3BXMA 2HDDA 5EEGA 1VHOA 2C6YA 1WPKA 3TTHA 4DJAA 4QPQA 3PO2J 5H6QA 2IGNA 1FYBA 1YIJI 2HR3A 4BEHA 3CDHA 3IAM2 4BH9A 2VLAA 3C2BA 3FDYA 2BW3A 2FIWA 2O8KA 1BI1A 1Z67A 2DJNA 3CZ6A 2K9QA 2PLYA 2PJPA 1DE4C 4UWIA 1MBFA 4A31A 5DD4A 2XPVA 2QSHX 4AMLA 4XPDB 3A01A 2MC4A 3COAC 3BCAA 2XB0X 4FETA 4ZYDA 3BLYA 5HLIA 5FUWA 2PRBA 2A20A 4M9SA 2RAEA 2DXIA 5LRJA 2D1HA 4E0AA 1ULKA 3EC4A 2BHYA 2R7ZJ 1D3YA 4DGWB 5FLVA 3JSOA 2KIMA 3PM1A 1YRNA 1RFHA 5G21A 4CSWA 3F72A 3SGBI 3CXQA 1JQGA 3FSXA 2EB7A 4WJBA 1E3PA 6PAXA 2OCEA 2OV7A 2BY3A 4Q38A 3S9LA 4BUPA 5BNGA 1P4XA 3BP8A 3DBLB 4BAYA 2K85A 3PBEA 2CWEA 4A69C 2IS4A 3HUVA 1X12A 5DCFA 3QWLA 2C6PA 3JRDA 4U87A 4XRFA 4EVIA 2GOMA 5JPHA 4I99C 3IUOA 4E6KG 2AFOA 3R1KA 1NUBA 2L7ZA 4NUBA 4FX0A 1XGMA 1QU3A 1ZK8A 5GPAA 4P1WA 3HEFA 2PJ9A 3VATA 2VPRA 3FSYA 1SD7A 3LQRA 2L7MP 4B5OA 1UZCA 3OYIA 3UFFA 4P10A 4I49A 3FXJA 1P2FA 3A0HC 3HSRA 5J8CA 1IRGA 1KU2A 1DU0A 3PB4X 3PZJA 4OAEA 4OC3A 5C88A 1R5GA 4AYBN 3O8HA 3BG3A 2XIGA 2EVNA 3FVLA 3OOUA 3K70C 2ARHA 1Z77A 3NFZA 1BW6A 3AG1H 2QQ9A 2CXAA 4F0YA 3JRFA 1YQAA 1MBHA 3HH2C 2ZXHA 4KUAA 1L0CA 4XQFA 4EJTA 2V7FA 1IN7A 2VBQA 5DYMA 3FZVA 3LWFA 4RB0A 2O3FA 2XASA 2JUGA 2O8XA 4P4DA 4XM3A 1IAWA 2BSWA 3B2YA 3HM5A 2LF7A 4ZYQA 1B8IB 3OYFA 1T8IA 1NXUA 2IA1A 2N8GA 2Z5UA 3TP0A 1T39A 3ZPLA 1XMBA 2GQQA 1RR7A 3GTQJ 1Y0NA 3H8EA 4IHYA 1FYKA 3KZIC 4H4KC 4LIVA 4IHVA 2HZDA 1HOMA 2BOAA 4WF2A 1SD6A 1MNEA 4UXHA 2EFOA 4G7OF 3N97A 1A31A 3E0KA 5IPAA 1AN1I 1Q7LA 5IT9Z 2YSRA 4HQMA 2ESNA 3T8RA 1C0WA 2E35A 1CGJI 4UIAA 4QC6A 2OJED 3MZYA 4HNTA 2JJ7A 4LJZF 1SGYI 1YJ9I 4WP4A 3UGDA 4IHSA 4IUSA 5B1BH 2Q2EB 3BG7A 4EGYA 3NH8A 2CGPA 4BHPA 4KFCA 1SGDI 2PJRB 2Y30A 3P2FA 3TQNA 4WXCA 4OC0A 4II3A 1R9TJ 4NEXA 4FWUA 4BDZA 3IRRA 4ENMA 2L0KA 1CG2A 4XKWA 2DLLA 2FQ4A 1J59A 3HOVJ 2JA1A 2P6GA 2VJ4A 2XGCA 3PNVA 4J01A 1U9OA 2OQGA 3R60A 4ZDOA 2CQXA 3ZRGA 1O3TA 2JEWA 1K7VA 4RM3A 5GPCA 3G73A 4L0YB 1K7UA 4YRHA 1PPFI 1Y0RA 4RBOA 3LMMA 5IOYA 3GB0A 5DWNA 3TMOA 2V4JC 1VNDA 5CKTA 1Y7RA 2FSWA 5JVTA 2VQHA 1EJ9A 4RB2C 2H1KA 1NG6A 3M8EA 5KAIC 1RZ4A 2DPDA 2YQPA 1CM0A 1Z9UA 2FD5A 3IAS2 3IWFA 3TO6A 3J81Z 3JRIA 2NVTJ 1G8XA 2BXZA 5EYRA 4H6ZA 2CFOA 3KP2A 5DDGA 2NYXA 3FIWA 1W5TA 4HV6A 3ZGKA 1ENHA 3I9SA 2N1AB 4QUSA 2FX0A 1ZRDA 4BD9A 4XSZF 2WY7Q 4PJ0C 2AFXA 3B3CA 2Y31A 1TW2A 2BUEA 3ZOBA 4YIRX 4PJNA 3FXLA 2IQ6A 2Z2SB 3P9IA 1XN7A 4I09A 4R9MA 3EQLF 4ZY2A 3LQQA 3C1DA
chains in the Genus database with same CATH topology
3WTWC 1XSXA 1KUYA 2H6BA 2PDOA 4L5IA 3MZHA 2PG4A 3W6SA 2PQ8A 1TNTA 3KLNA 3QU6A 1XGNA 1MZBA 2XAHA 4GGGA 4OMZA 2OD5A 2A4NA 1WKMA 5D5UB 1ZG1A 1I6XA 3FM5A 3LD2A 5HOOA 5D6FA 4QVTA 4JJXA 3K9UA 3K1PA 2OA4A 3SXOA 3KZZA 4PV6A 3BPXA 1LDDA 1XMAA 2DPTA 2FXFA 5AG4A 4JXRA 4FD6A 4QB9A 2JSCA 3ZMTA 3HHHA 5DD8A 2FEZA 3CUOA 2W84A 2YNCC 3IRQA 1ZN2A 1J4JA 1XCBA 2KIFA 3VB2A 4U9YA 5CVUA 3F0AA 3G8WA 1H9GA 2EFNA 1UCRA 4Y13A 5LEKA 1JHFA 2P6SA 4G94A 2RC4A 2WSAA 2NRAC 4R3LA 3R9FA 2UZKA 4G9YA 1S3JA 4KVME 4O6JA 3DR8A 4CAWA 3JSPA 2RGVA 1W4MA 3V7RA 4L9TA 2R1IA 1TTYA 4KNYA 4CYOA 3FXTA 3QPTA 1ZG5A 1IICA 3P9KA 3F21A 1FBQA 4C2XA 4FX4A 2CNTA 4HNXB 5DCMA 1MJ9A 2VODA 1D8JA 1HSTA 4Y49C 3HUGA 5E17F 4A5NA 1UB9A 1F1ZA 4RGXA 5HDNA 3TOAA 4X5KA 1K79A 4RB1A 2HGCA 4B14A 3D2PA 4RS8A 3I0TA 2FL4A 4YIIA 3J81K 2QBYB 3NEUA 4IRHA 4UVCA 2Q0OA 2F5EA 3NQOA 4A12A 4LGWA 3ERED 3O2PE 1G3TA 4CS0B 1Z05A 1IN5A 1DPRA 3FF5A 5FFXA 3MWMA 5DV5A 1WWZA 2P4WA 5L3BA 2B3UA 3GZ5A 1EH8A 4AIKA 2QWWA 2Y75A 4WXHA 3W6JB 3I59A 1PDNC 3I58A 4KVOE 2OZ6A 2ACJA 1G3WA 3BPVA 1P6RA 5ED4A 2VZYA 5AG6A 5F49A 2PFBA 1XB4A 1YVKA 4BQAA 4CGOA 4FHTA 1Z9CA 2FS5A 3QRFF 1Q2CA 1YTYA 3FYNA 4MFPA 4C7HA 1ZYRF 5L3DA 4FT8A 2ETHA 4II9A 4EJOA 1USSA 4I01A 1MDMA 2QUFA 2JT1A 4M9XA 4U7BA 3C7JA 3LA7A 4YFNF 3O6BB 2Z99A 5EC4A 2IJLA 2EJRA 3V8IA 1XGOA 3H92A 2X4HA 2DFIA 4D0PA 3F8NA 1BIBA 4OADA 2B4DB 1QO0D 2B4BA 4M72A 1DDNA 4MJ8A 2Q8KA 4KUMA 2ZNYA 2HYFA 1XIXA 1Y9KA 1BC7C 1R1VA 3ZMDA 1CF7B 2MA3A 3E6BA 4BYYA 1N71A 5J6XA 1EV7A 1IXRC 1R22A 5D8LB 1UFHA