2OZUA

Crystal structure of human myst histone acetyltransferase 3 in complex with acetylcoenzyme a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
253
Chain Sequence
RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQSIKKLSKLTGICPQDITSTLHHLRMLIRREKLIQDHMAKLQLRPVDVDPECLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase MYST3
total genus 78
structure length 253
sequence length 270
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ozuA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2ozuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ozuA02
2CWEA 4EGYA 4HF1A 5E1XA 3FWEA 1MDMA 4CZZA 1B9MA 2CNMA 2UXNA 3S6HA 1RNLA 1J7KA 1MJAA 1SD4A 5LGUA 5TJJA 5DDGA 2P7VB 3TKYA 2D1HA 1I1GA 1J2XA 3FYNA 2JLMA 3IRQA 1HKQA 4HX8A 1S7FA 4KNYA 3MGDA 1FOKA 4MBUA 4YG2F 4WXHA 2IP2A 5EBVA 1FSEA 4XSXF 2FT0A 2RVCA 4Y17A 1KA8A 1XMTA 3V8IA 2DBBA 2M30A 5C88A 3HYIA 3K9TA 4KDPA 2X4HA 3N97A 3ZJ0A 1U5TA 4JXRA 2CNTA 2ESHA 4OINF 1H9GA 2P5LC 2VZZA 2FOKA 3RYOA 4CGZA 3C1DA 4ZBGA 3R95A 4LD5A 1TNTA 4A6EA 3VODA 3GVAA 4KOWA 2XGXA 1STZA 1TQPA 2A5YB 1PUAA 4KT5C 2LNBA 1I21A 1RXTA 3V7CA 2Y48A 3CXPA 3C7JA 4RGXA 4HOBA 2P7CB 2JPBA 3FHZA 4ENMA 1LRZA 2PLYA 4IJAA 1HSJA 1OYYA 1CF7B 5LRSA 2HFHA 2DXQA 2VC0A 3HSRA 4U7BA 3EC4A 2RQPA 5D8LB 2QENA 2G3TA 1XEBA 3HRTA 1FZPB 2Q4YA 4PV6A 3F8MA 1BC7C 2DLLA 1FWZA 2GA1A 1R5GA 5KVRA 2WC2A 3MZHA 3DNSA 3RDIA 2QLZA 2IL4A 5FD5A 2GE3A 3TDZC 1ZYRF 4UVBA 2ELHA 1P6RA 5BPDA 2CY2A 1ZGAA 4LFUA 4EVYA 2FBIA 3CJNA 2VXZA 4Y49B 2QVOA 1IICA 3GLXA 3IGRA 4YFNF 1U5TC 2A3SA 2O8XA 3HRSA 3L7WA 2HV2A 5FB2A 1OKRA 4J3GA 1QQIA 1OYWA 1ZG1A 1YLEA 2BYVE 2A6HF 2HYGD 2MLGA 4KVOE 3M7GA 5ICCA 4UXNA 3DSBA 3I0TA 3L2CA 2B58A 1IB1E 2JEVA 3R6SA 1R5HA 1UB9A 2C27A 2IA1A 5E1WA 2HS5A 2O28A 3HTSB 2RDPA 1W5SA 3M9AA 4AVBA 1G3SA 1NHAA 5D5WB 2PMHA 3FZVA 4Y15A 3E6BA 1TQMA 1EH8A 4KORA 2KIUA 5HS7A 4XNHB 4U9ZA 1BBYA 1ON2A 1LEAA 5ICEA 3QRFF 1IAWA 1B59A 5DEQA 1ZLKA 2D4OA 3E97A 2GWRA 2BEOA 2Z10A 3TTHA 5IX3A 4LLNA 1LVAA 3AAFA 4MGRA 4Q5SF 2XAFA 3Q5FA 2P5VA 3R60A 2CQKA 2XHKA 1SD6A 3GYHX 5H6QA 3MEXA 5AIPA 4Q4ZF 4B09A 3F23A 1P92A 4N9IA 3KP3A 3R1KA 2LSOA 3S2WA 4NSQA 3P2HA 2I79A 3FXTA 2IRFG 3RTRA 4CO8A 1I12A 2A68F 3KP7A 6PAXA 1JE8A 2JPCA 1A04A 2FIWA 2Y0MA 3GYAA 4RI1A 4MNUA 2QWWA 5CNPA 3V8LA 2MC3A 5D4SA 4E0AA 3F8KA 1N71A 1B6AA 2OZHA 4PZJA 2P6TA 1GXPA 5KTCA 2J8RA 1QSNA 1QGPA 2KKOA 3VEPA 5BOXA 1R23A 1DPRA 1MGTA 3FM3A 3KP5A 1YS6A 4QB9A 4AVAA 1IF1A 4QLCU 2I00A 3R0AA 5HS8A 1T98A 4HF2A 2NYXA 1R00A 3QOPA 2CSOA 4DQ2A 2W84A 3G3SA 2PR1A 3W6JB 5F1RA 4MY0A 1ZRFA 3HHGA 3KZYA 5D8KB 4IRIA 1QZZA 3PFIA 2AS5F 4YFJA 3Q9VA 4A0ZA 4P9FA 4OIOF 3B73A 3D3SA 2ZXJA 1UHWA 2CNSA 4RB2C 1WRJA 1R57A 3P2FA 2VE9A 4U0VA 3VWEA 1I6XA 2FEZA 2ISZA 2JRTA 4KOVA 4GO1A 2P6GA 3I59A 5HDGA 3KEOA 3F72A 3EETA 2D1VA 1PDNC 4IF5A 3VWDA 1MJBA 5H20A 4I98B 4G7OF 4XLNF 2A6EF 2PG4A 2EFNA 4NXYA 2DQLA 3WTTC 3I54A 1YS7A 3E5UA 4X5KA 3RYRA 2FS5A 3FNCA 3SXYA 3WTZA 4KA4A 3RIRA 1RI7A 3VOEA 4HV6A 3T90A 3ZMUA 2HQRA 4L89A 4RB0A 1YLFA 2VQYA 4TV7A 3SXNA 5DCMB 3P9IA 2VONA 3S6FA 4L9VA 4EJVA 1HW2A 4ETSA 3E5XA 2BBYA 5DWMA 3TE4A 1V4RA 2VODA 4L8AA 2WPXA 4CXFA 3BJOA 4O6JA 2KIMA 2G9WA 2QUFA 1IYLA 2FSRA 1IN7A 3RPQA 3K2ZA 4M72A 1SQHA 1IN5A 1ZREA 1Q2CA 3WE3A 3H4QA 4UVAA 3SQNA 1L3LA 5LRRA 4KUBA 2EFOA 5FFZA 2PR8A 2B5GA 3IWFA 3R0JA 1XD7A 2ZFWA 3E6MA 4QUSA 3TFYA 3WTWC 2VI7A 5F46A 1ODDA 1YK3A 2W85A 3GKRA 1USSA 5E8GA 1C0WA 1B4AA 2EFPA 1T6SA 3LODA 2XVCA 1IXCA 1KZFA 3FBUA 5JHUA 4CICA 1YTYA 3D8PA 3SZPA 1XIXA 4KIBA 3PZJA 1FBQA 2NRAC 3HOSA 4JJXA 3WTUC 4HZFA 2CGPA 3ZQ7A 1WQ2A 1O3QA 1BI0A 1FYMA 3EXNA 4PK3A 3LAJA 2GANA 1M1DA 4LMYA 4FD4A 1R1VA 3C3WA 2HUZA 3DEUA 3OV8A 3TO7A 3DDDA 4FX0A 5EEHA 3KCCA 1P2FA 2HKOA 1IZ1A 4U5YA 3RYPA 3GY9A 4R57A 2GIVA 4B5PA 5HLIA 3TO6A 2EFQA 2ISYA 2J5PA 1F4KA 2HEOA 1J5YA 4MTDA 4U9YA 2L54A 2LKPA 3GX4X 3QU6A 1XMKA 3D5LA 1KGSA 4PSWA 2ZW4A 5KK1A 4KOSA 3DKWA 3LSTA 1R36A 2OH1A 4L0YB 1JGSA 1FNNA 1XDSA 1LJ9A 3ERED 3E3VA 1ON0A 2IVMA 1IW7F 4GS4A 3G8WA 5LHGA 2NNNA 1ONVA 1W4MA 5E96A 2W57A 2B5GB 1SFUA 2AJ6A 4L9NA 5ED4A 3U1DA 2YR2A 1XSVA 3V4GA 3EYYA 5J6XA 3EUHA 4I2OA 3QPTA 1U5TB 2H27A 1OZPA 2R98A 4I0AA 5LHHA 3GWZA 2B4DB 1EV7A 3V7RA 2VBXA 2FNAA 2FNPA 1Z4RA 5JVTA 2V79A 5E8IA 1J59A 1WK4A 1ZRDA 2FL4A 1TW3A 4UV8A 4MEXF 1MK4A 3LA3A 3TOBA 5LEKA 1D8KA 2LF8A 2FMYA 4R87A 3U9GA 4L0ZB 2XIGA 4ESJA 4KOXA 4F7ZA 1OR7A 4ZYGA 5HMNA 3I5UA 1ZRCA 3J81K 1K4JA 3BPXA 1Z91A 2D2WA 4O5VA 4OOIA 2M5WA 3FM5A 2QQAA 4UUVA 5JPHA 4LLLA 2RNJA 3BLNA 1M4DA 4KICA 4WWCA 2ZKZA 2ESNA 1KU7A 3VFZA 3FIXA 5DCFA 4U0YA 2NS0A 1S3JA 1Q1HA 2B0LA 4ESFA 2P4WA 2V1XA 3LA2A 1PP8F 4O3MA 1K79A 4G7ZF 3J81Z 3EQLF 3I59B 2O0YA 2O3FA 4M6XA 4PSXA 2BE5F 1XDUA 4MI4A 1IN4A 2X0LA 1B6BA 2F5IA 5F48A 3QP5A 2MH9A 4L5IA 4KVXA 3BY6A 2ZW7A 3ML6A 2Q0YA 3K69A 4M71A 3P9KA 4HX7A 5DUIA 4CAXA 3JVNA 3CXSA 2ZBKA 2E7WA 2YSRA 3D2PA 1CM0A 4QC6A 4GYIA 4BHPA 2Y75A 3EO4A 4EJOA 1RO5A 3FMRA 3PP9A 2P6SA 2ZXVA 3HHHA 4I02A 1Z7UA 1OYIA 4BYYA 2ACJA 1BOBA 4G6DA 2IT0A 3LQRA 2OA4A 4IVNA 2ZNYA 4HYEA 2Z5UA 2QBYA 2Z99A 4HBLA 3ZPLA 3KP2A 1I27A 5K5OA 4A0YA 3CUOA 3T1BA 5JQ4A 4HQMA 3B8GA 3TT2A 1ZLJA 2F5CA 2DPDA 5TRDA 4LLGF 3GEZA 2QM3A 2PN6A 1Y0UA 1Z6RA 1XGNA 1TIQA 2L02A 3ABUA 1XE4A 2V9VA 4AVPA 1P4NA 4CAVA 4JK1X 4PGGA 1QZYA 3T8TA 3CO7C 2PI0A 4QBJA 1KU3A 2DK8A 3R9EA 5J8CA 4MJ8A 4QVTA 1SD5A 2OZUA 3F5BA 4K30A 3ECOA 2CYYA 3FXQA 2MH2A 3OWCA 2FXAA 2K7LA 4KIGA 5AONA 5HDKA 2WWYA 2OQGA 4M9SA 2XRNA 1KU2A 2Z3YA 4UBRA 2FCKA 1XCVA 4B5PB 4PK2A 4B5OA 1GHCA 4IHTA 1BIAA 1J4JA 2HWVA 3SZTA 4HDUA 3TDUC 2WTEA 3J80Z 2VOOA 2PBIA 2OZ6A 5A2QZ 3KEQA 1IRFA 2BSWA 2VBYA 3EYIA 1IUYA 2QYOA 1BI1A 3JSPA 2M45A 4M9ZA 2IPQX 2HGCA 2BEIA 1BC8C 1SMTA 2LDUA 1IXSB 2Q8KA 2K4BA 5ILUA 2FQ3A 1QBJA 1V0CA 1J9IA 1R1TA 4RS2A 3D0SA 3BJ7A 4PCQA 3V8JA 2H6CA 2DI3A 5HVQC 1YW7A 1P4AA 4MTEA 4ON0A 4HKFA 1V3FA 1I5ZA 1SFXA 2HOEA 1CJWA 2K5TA 3F8NA 4M6YA 2QIRA 5FD6A 4HW0A 5JFRA 2VBQA 3WU0A 3VB2A 3GZ6A 1YVOA 3CUQC 4CYDA 1QPMA 5H84A 1BM9A 4IF4A 2DPUA 1J0RA 3ISPA 1UFMA 1NSLA 2G7UA 2JTVA 1GVJA 1HQCA 5CVIA 3F3XA 2AE6A 3I9SA 2EWNA 4KLWA 3K1PA 3ZMDA 1LQ1A 4S05A 2ZNZA 1W5TA 1I1SA 5EC4A 1ZGJA 2W25A 1YYVA 4KLVA 2NNYA 2O03A 2FMLA 2ETHA 3I71A 4E8OA 3WU1B 4HLYA 5E20A 4MQ9F 1R1UA 3LA7A 3W6XA 3MCZA 4KYWA 3GZ5A 1IXRC 2DK5A 2XAHA 2ZO4A 2EUIA 3GFLA 3TCVA 4RGUA 4PDKA 1B1BA 2V1UA 2CO5A 4MEYF 3H92A 1M4GA 2OBPA 1Z6TA 3DF8A 2B3UA 2R8VA 1ZG3A 1P4WA 3IKTA 2VXKA 4OMYA 2AXLA 2HQYA 4ENJA 1T38A 1S7NA 1Y7RA 2MLKA 5D4RA 5LHIA 5D5XB 3NE7A 1L0OC 1UFHA 4P5OA 1QSTA 1Z1DA 1DP7P 4UWJA 2J8NA 3GF2A 1S7LA 1NMTA 2KCWA 3IWZA 1U6GA 1YR0A 2COMA 3EY5A 4H0EA 2H6BA 1I1DA 5DCMA 2Z9OA 3K0LA 3ZMTA 4R3LA 3R9GA 2OAZA 3DR6A 2RC4A 2FIAA 4P9UA 2JZYA 4HDVA 4JBAA 5HLGA 4EJWA 5IT3A 2VBZA 2VBWA 3S6GA 2PEXA 2RV8A 2PDOA 2R7FA 2G0BA 1BO4A 2JDDA 4E2AA 2Z11A 5HOOA 5L3GA 5H86A 2K02A 5DV5A 1FPQA 3W6SA 5K5RA 2EA4A 3D2MA 5DUKA 4BXUA 1YVKA 2P0WA 1Q2DA 4N0BA 3JAMZ 4H6ZA 5E17F 4MY3A 1M4IA 3BZ6A 5BPIA 4MQVA 2R7HA 4P96A 3ECHA 2PRBA 5F49A 4A5NA 1BIBA 2KIFA 1B9NA 3NQOA 4RB1A 1YX0A 1KYWA 5J8FA 3UY5A 4LX9A 1FLIA 4JXQA 1S29A 2R1IA 4A5MA 5ILSA 5KTDA 1G4DA 3QB8A 4M74A 4UNOA 2W24A 1YREA 1U3EM 3QU3A 2QQBA 2CFXA 5IT9Z 1W7PD 3MQ0A 4HNWB 4KN4X 5AIQA 3I64A 3Q9SA 1U6MA 3ELKA 4LUAA 4G6QA 1OPCA 4NHJA 4UV9A 3KFWX 2PC1A 3RJPA 3DR8A 4OADA 2ZW5A 2OB0A 4WXDA 3QP6A 4AIKA 2FU4A 5KTAA 1BN5A 4I0BA 4LGWA 2TDXA 2P8TA 5FO5A 1XCBA 3P9CA 2B4DA 4JQFA 3ZMVA 1K78B 1BOAA 3F8FA 4ZZDA 4U0WA 1S5KA 4YGOA 3HUGA 1S60A 3FB3A 1YG2A 3DP7A 2EFWA 4OAEA 1U78A 3BJAA 2STWA 5CYVA 1HW1A 4RAYA 2WPWA 3IKVA 2XAQA 3FF5A 1XGSA 2IJLA 3TO9A 3GW2A 4XPDB 3KE2A 4CS0B 1TQIA 3M8EA 2JSCA 3BOQA 1FBUA 2B3VA 2NAZA 1KU9A 4KOUA 3R4KA 1S7AA 2M1BA 2Z0ZA 2F5DA 1IRGA 1AOYA 3I3GA 1QO0D 5DYMA 4I49A 4AIJA 2GQQA 4ORFA 4S04A 4R79A 2D45A 1WWXA 2KJCA 2OD5A 4UHTA 2BL1A 1VHSA 2DTRA 3BPVA 5L3CA 4G94A 1HBXG 3E6CC 2M87A 3F0AA 4OU0A 4HF0A 2OU2A 1E17A 1DPUA 2FE7A 5GCNA 3N4MA 1NE9A 2RKHA 4LB5A 1IIDA 3MFKA 2EJRA 2P5KA 3L09A 3LQQA 3OOPA 3M8FA 4GYGA 2HYFA 1R58A 5IB0A 1XGOA 4NQWA 2F2EA 2QMLA 4PGHA 2FBHA 4CRYB 5CLSA 3JW4A 4I09A 1HXDA 4LB6B 3KETA 2MA3A 2J5OA 5JI6A 5L3BA 4OIQF 4KN7X 1LDJA 2L4AA 4R3KA 2RGVA 2DQRA 3ZZIA 2E7XA 3WGIA 2P6FA 2K27A 4L9TA 1KQ8A 2HQNA 3SHFA 1L0CA 1GXQA 1FP2A 5CVJA 4EJTA 4LJZF 2M8EA 2XV4S 1E2XA 4YIFA 2D4PA 2K86A 1VTNC 3ZMZA 3F22A 2BGCA 4RB3C 5D6EA 1QSRA 4KZTA 3FXUA 1O3RA 1YGHA 2CG4A 2G3AA 2J8MA 5BQTA 1LEBA 4HLXA 2XUBA 5F6FA 4KOYA 3KZZA 1S8NA 4JWPA 4YRHA 5HS9A 4ENKA 4Z2YA 1U2WA 2REFA 3BJ6A 4NF1A 5FLXK 2XASA 1Z9CA 1Z9UA 4AG9A 4BHCA 2HR3A 2FF4A 3DQVC 5ISVA 4AWXB 1TTYA 3E6DA 2XROA 3F21A 4CRZB 1YO5C 4ESBA 4M3SA 5E18F 3MWMA 4XPDC 2QBYB 4H6UA 4XLPF 3PGPA 1JHFA 5L3FA 3GUDA 1MD0A 3HRUA 4ENNA 1S7OA 3FMSA 2YPRA 3SXOA 2XKPA 5IT9K 2RN7A 3BJ8A 2HDCA 4AG7A 1RUNA 2V6CA 2GA2A 4HA8A 1LB2A 5DD4A 2XAJA 2PQ8A 3WGHA 1LDKB 3RKWA 1FY7A 2LF7A 1SAXA 4NCZA 3KP6A 4G9YA 4Y49C 4BH9A 4U88A 1SFEA 3FX3A 4NEXA 4RGRA 5FVJA 3U2RA 1XSDA 2EV6A 3RI4A 2A69F 1SMYF 2NMTA 3HIFA 3GFJA 2JDCA 3I4PA 3QAHA 4BQAA 4BAYA 4FD5A 3PQJA 1ZARA 1KUVA 1USTA 3V8KA 3SFZA 3PQKA 1R22A 2ZCWA 1HW5A 3CLOA 1FC3A 4ONUA 1J75A 2OQRA 3W6KB 1HKSA 3NEUA 1XMAA 2PFBA 1EH7A 2OZGA 4L5JA 3HOTA 2QZ8A 1P0HA 3LD2A 2VOPA 5L3EA 1CF7A 2GAUA 2HTJA 5D6FA 3WTSC 3BROA 4D0PA 5K1YA 1O3TA 4ZYDA 1F5TA 2Q44A 1K78A 3IWGA 4IPAA 4KFCA 4XPLA 3H3UA 2DW4A 4F0YA 3GO5A 2VC1A 5H6RA 3B02A 2A61A 5F47A 3ZP5A 1ZG5A 1VKCA 1R7JA 3I58A 4H89A 1Z05A 4QWQA 1K6OA 4AVCA 1B87A 2FSWA 4ZZLA 1KYZA 2UZKA 4RS8A 2GXGA 4UVCA 4EGZA 4BMHA 2ZPAA 4FHTA 3T0YA 4EM2A 1IN8A 4AD9A 3WTVC 3MZYA 1Z4EA 4IHSA 3KLNA 1AWCA 1ZN2A 4XPKA 4FD6A 4EMSA 5D5UB 3JTHA 1YW8A 5CVRA 2CW0F 5CVUA 2FBKA 4NB5A 5C82A 3FMQA 3P7NA 4R9MA 3O2PE 1YW9A 3G3ZA 4EM0B 4LG0A 2STTA 1UHMA 2UXXA 3ABTA 1TW2A 3T9YA 3L00A 3DFGA 2MBFA 2IA2A 2VT3A 4FD7A 1XSXA 1RUOA 2EV0A 1YFHA 5LGNA 3W91A 1Y9WA 3DV8A 4M9XA 2PSWA 2GXBA 4A12A 5F64A 5LLQA 4OMZA 4KUMA 1WI9A 3FXRA 3F8BA 1RIOH 1XN7A 3LWFA 4A6DA 3LFKA 4ASNA 5FGMA 5CJ9A 3R61A 3G73A 1OMIA 1FX7A 1FSHA 3JSOA 2ZMEB 2XAGA 2V1DA 3HTUA 4AB7A 5FLXZ 2EV5A 4FT8A 2FRHA 4XRFA 2PJPA 1XB4A 2HKXA 4UWIA 1O3SA 4HQEA 3RKXA 4EV0A 3F6OA 2H5MA 1JHHA 3IC7A 4WXCA 4G8XA 2EK5A 3WGGA 1QSOA 1WWZA 1MZBA 2ARHA 1W7PA 1W7PB 4XNHC 5IV0A 1JXSA 1D8JA 2DO7A 4R1HA 2VN2A 3BDDA 5HLHA 4F6AA 4Q47A 1T2KA 3CTAA 3E0KA 2A4NA 4GGGA 4CAWA 4HNXB 4EQQA 4ZH4F 3WE2A 3WODF 4AIHA 4U7DA 4IRHA 5ILVA 2B4BA 2X7BA 3EDPA 5LEJA 4WF2A 4JD6A 2L4MA 2MD5A 2YU3A 5HH1A 4B8XA 4OLLA 1QNTA 2A07F 2REEA 5K5QA 1G3YA 3KLOA 4HAMA 1ON1A 2QQ9A 4A0XA 4RGSA 4OIPF 2DFIA 3COAC 1REPC 2VT2A 4BNCA 1YQAA 2F5EA 1T0FA 1S6LA 1O7LA 1S3ZA 3RKYA 1G3TA 1ZAOA 4L18B 5CVVA 1XF8A 5JR3A 5A2QK 4WCGA 2VE8A 1FYLA 4UA3A 5LBQA 1MKMA 2XKOA 4II9A 1RZ4A 1SD7A 2DU9A 3I53A 4R8HA 4A2UA 3R9FA 1Y9KA 5L3DA 3J7AO 4HNYB 3C18A 3GFIA 4LG0B 1IYKA 4LK1F 3CUQB 1DDNA 3CUQA 1BI2A 1IN6A 4IUSA 5DWNA 1Q2YA 3JAMK 1FT9A 2DT5A 4M73A 4Y13A 3K1MA 3TOAA 3NRVA 1TBXA 4YIIA 3IHUA 2ADUA 3CO6C 3QPHA 2IW5A 1KQ9A 2FE3A 4GCVA 4I7HA 1S7KA 2EVNA 4KMUX 3FRMA 4HX4A 2KJBA 2F5FA 1UCRA 5ICGA 2K4JA 2ZW6A 2ZMEA 4MHGA 2Q4VA 4N9HA 1HKTA 1BJAA 3C26A 3IRRA 5D5VB 4EVIA 1KUYA 4DNCA 5EEGA 3GXOA 4IRGA 3BWGA 3WG9A 4WX9A 3S6KA 4K2EA 1FBSA 1GHEA 4KOTA 1D3YA 1DUXC 4XBFA 1TNSA 3ZMSA 4YFXF 2O61A 4YFKF 3JTGA 3BP8A 4CHUA 3ULQB 3CXQA 1ZH5A 1P4XA 3K9UA 3KKWA 4M85A 2H94A 4LK0F 2GZWA 2EB7A 4L9JA 2Q2EA 1F9NA 2PMUA 3H3ZA 2ZJ2A 3EFAA 3R96A 4WK8F 4JLYA 3O6BB 4ZYEA 4FX4A 2G7HA 3L9FA 2H09A 3DXJF 4IXAA 2QECA 1PUEE 1D5VA 1PP7U 1HSTA 5I0CA 1FYKA 4KVME 1FP1D 4HV5A 3TGNA 3HSFA 1O57A 4I01A 4G7HF 3T5XA 1BI3A 1X3UA 3MAJA 2VEZA 4MHDA 1KQ0A 2Q7BA 3ZN0A 1T39A 3DPLC 2EA2A 2E1CA 5LGTA 2Z33A 3E5QA 3SHPA 1ULYA 2IA0A 4P55A 1QSMA 4RAZA 2UWMA 2HTSA 3KP4A 4EJUA 1M44A 3JUWA 3CDHA 1PU9A 3RPUA 2YX4A 3DPTA 2YX7A 3K1NA 3TQNA 2FXFA 3LAPA 1G6NA 1KUXA 4EM1A 3HRMA 2P6EA 1CGPA 4Q48A 3GFMA 5HDNA 3V7SA 5ERIA 1G3WA 3REOA 3O3KA 4OIRF 3F8CA 2BV6A 1EH6A 1XGMA 4XSZF 2R7DA 2O6GE 2DAOA 4KMFA 2E1NA 2C6YA 1MDMB 1MJ9A 3N7ZA 2Q0OA 1U8RA 2HZTA 5DD8A 3ZN1A 1LDDA 3WTYC 3J80K 5E1ZB 1H9TA 3WTXC 2FA5A 1ZHFA 2ATRA 4BHBA 5BS6A 2KRFA 4GXOA 3F6VA 3ROUA 3WR7A 1WSUA 1F1ZA 3M1EA 2JT1A 2WV0A 1K7AA 2L3DA 1WKMA 2L01A 1H0MA 1TLHB 5BMZA 4CDGA 4ZYHA 3HSEA 5FFXA 2BUEA 4KUAA 1O7FA 4KIFA 2VZYA 2R3SA 3T8RA 1LNWA 4E70A 3IL2A 2Q04A 5ICFA 1YIOA
chains in the Genus database with same CATH superfamily
5IYDJ 2CWEA 4EGYA 1WPKA 2HVQA 2OV7A 4B3AA 5E1XA 4HF1A 3FWEA 1OYVI 2DN0A 1R4NB 1MDMA 4CZZA 4FCYA 1B9MA 1X4PA 4EATA 2DYRH 2UXNA 2CNMA 1ZLIA 3S6HA 3CXLA 1VQ6I 1RNLA 1J7KA 1MJAA 1SD4A 5LGUA 5TJJA 1FARA 1XX5A 5DDGA 5CQEA 1VQLI 2P7VB 3TKYA 4CGMA 1FIPA 2D1HA 1I1GA 4IEJA 3SDGA 1HJAI 4IHWA 1J2XA 3FYNA 2JLMA 3IRQA 2JA6J 4B47A 1HKQA 2X52A 1A2ZA 2QQEA 3BXMA 4HX8A 1S7FA 4P4EA 3EUAA 4KNYA 3MGDA 3CCVI 1FOKA 3KYCB 4MBUA 4UEFA 4YG2F 4WXHA 2IP2A 5EBVA 1FSEA 4XSXF 5FKNA 2FT0A 3NAUA 4R6TA 2RVCA 4Y17A 1KA8A 1OMUA 1XMTA 3V8IA 2EBJA 2DBBA 1XX6A 2M30A 2HXOA 1Y39A 5IYBJ 1VQ9I 5C88A 3HYIA 3K9TA 3LFUA 2R93J 2M34A 3GTOJ 4KDPA 3BTIA 2X4HA 3PNTA 2R7XA 1K7VA 2PJ1A 1ZR2A 1V54H 2V26A 3N97A 2OTLI 3ZJ0A 1U5TA 4JXRA 1R0RI 3TBIA 2CNTA 2ESHA 4CUGA 4LITA 3R5BA 2M5XA 5EF6A 4OINF 1H9GA 1N13A 2GLFA 4C2MJ 2P5LC 2VZZA 2E35A 1WH7A 2QQCA 2FOKA 3RYOA 4M3BA 3UGLA 2EWBA 4CGZA 3C1DA 3JCUC 3SI0A 4ZBGA 4YRVA 3ABKH 1BJZA 3R95A 4LD5A 1TNTA 4A6EA 4N4NB 2HZDA 4A3LJ 3VODA 3CCUI 4OAYA 3GVAA 3PEIA 4KOWA 4PXBA 2XGXA 1STZA 1TQPA 3OVOA 2E60A 1T08B 1PTQA 2R7ZJ 1AKHA 2O53A 3JRBA 1P9GA 2A5YB 2Z3KA 5GADJ 5FUVA 1PUAA 4KT5C 2LNBA 1I21A 3GTGJ 3VWBA 3MKYB 1ULNA 2DFEA 1RXTA 3V7CA 3UEYA 2Y48A 1K4SA 3HXLA 5G22A 4A38A 5KNLA 2ERWA 4A69C 1LANA 3CXPA 3C7JA 4RGXA 2XDVA 4HOBA 2P7CB 2JPBA 1KMAA 4P4IA 3FHZA 4ENMA 2DEAA 5TGTA 2DPSA 4C2YA 1LRZA 4XMYA 3L2WA 2PLYA 4IJAA 2N8GA 1HSJA 2DF5A 3NH5A 1OYYA 1CF7B 1HA8A 4ZGYB 3FKJA 2KRCA 3OYFA 1T0FC 3DEEA 5LRSA 2HFHA 3A01B 5J40A 2WUUA 2YNEA 3DLJA 2DXQA 3PB9X 2VC0A 3HSRA 4U7BA 3EC4A 2RQPA 5FUYA 5D8LB 2QENA 2EO8A 2G3TA 5GAHJ 1X4SA 4MFJA 4M6GA 4EEFG 1XEBA 4KITB 3KI9A 8CPAA 4XK4A 1S9HA 3HRTA 1FZPB 4FQGA 2ROWA 2Q4YA 3PL8A 2M2EA 4PV6A 3F8MA 1BC7C 2DLLA 1LVKA 2JA5J 1I39A 3D5RC 1FWZA 2CUFA 1JT6A 4UFXA 2GA1A 1R5GA 5KVRA 5JGFA 2COBA 3TW7A 2XEGA 3KX2A 3H5AA 1KZHA 2AFMA 4V2FA 4C7HA 2DJNA 2WC2A 3MZHA 1R79A 3DNSA 4BQQA 4XN0A 3RDIA 2IMOA 2R7RA 3S1NJ 5HODA 2QLZA 1TL8A 2IL4A 5FD5A 2GE3A 3TDZC 1ZYRF 4UVBA 4NJQA 2ELHA 1P6RA 5BPDA 2QYVA 1T33A 2CY2A 3HKZA 1ZGAA 1X3WB 3AFHA 4LFUA 4EVYA 2FBIA 3CJNA 3FK7A 2VXZA 4JX6A 2QVOA 1IICA 4Y49B 3B35A 3GLXA 3IGRA 4YFNF 1U5TC 2A3SA 2O8XA 3HRSA 3L7WA 5B1AH 2HV2A 2SGEI 5FB2A 2JXDA 1Y0YA 4OC5A 1OKRA 4J3GA 2KDOA 1Y8QB 5F08A 1QQIA 3A0HC 1SEUA 1QHHD 1OYWA 1ZG1A 1YLEA 1NTCA 2BHYA 2WZNA 2BYVE 3LSKA 4L9MA 1YI2I 2A6HF 2HYGD 2MLGA 5FROA 1HC8A 2NU1I 4KVOE 3JRAA 3M7GA 2QA4I 2BOLA 2N71A 3QPLA 1A35A 3B6CA 5ICCA 3RZDJ 4UXNA 1JJ8C 3DSBA 3I0TA 3L2CA 3M3YJ 2PCUA 3KQXA 2AQEA 4F93B 1LE8B 1V5GA 3PDNA 1OR7C 4HG2A 3SI2A 4C2XA 5F04A 2B58A 1IB1E 2JEVA 3R6SA 3VSLA 3S9NA 2R5ZA 1IDYA 1R5HA 3OYBA 4CCNA 2R7UA 1UB9A 2K85A 1KONA 1VHOA 2IA1A 2C27A 5E1WA 1W36D 1X1BA 4ZX9A 2HS5A 2Q1ZB 2O28A 4C2ZA 3W6VA 3HTSB 4GI3C 2Y69H 1MH4A 2RDPA 1B8IA 1W5SA 2QKMB 3M9AA 4AVBA 1G3SA 1NHAA 5D5WB 2K5CA 1ULMA 4D5CA 2I10A 2PMHA 3FZVA 4Y15A 3E6BA 1TQMA 2EILH 5LRJA 3BG3A 2QQDA 1EH8A 1SGQI 4KORA 3SJXA 2KIUA 2CFOA 5HS7A 3ESWB 3DGVA 3PB6X 4XNHB 4U9ZA 1BBYA 2PE3A 1GVDA 2VQLA 3K6GA 7WGAA 2ODFA 1ON2A 4BGDA 1LEAA 4P4FA 2ENZA 5E3OA 5ICEA 3QRFF 2WB1N 1IAWA 1B59A 3QNVA 3BQYA 3BR5A 5LRKA 3FECA 5DEQA 1ZLKA 1F36A 2VXDA 2D4OA 2IGMA 3E97A 2GWRA 2BEOA 2Z10A 4GDFA 1ZO0A 3TTHA 4E7SA 2DFHA 3DBLB 2PJRA 3B3WA 4LLNA 4RAGA 4UFVA 5IX3A 1LVAA 3AAFA 4MGRA 1JT0A 4IZZA 4Q5SF 3JRGA 3DBRB 2HXIA 2DA7A 2XAFA 2LP0A 3ERMA 3Q5FA 1ZQ3P 2P5VA 5IP7J 2GKTI 3R60A 2CQKA 4XONA 4NC6A 1CG2A 2XHKA 3M4OJ 1SD6A 1J09A 1CSOI 4BQOA 2ID3A 5H6QA 3GYHX 3S1MJ 3CPAA 3MEXA 5AIPA 4Q4ZF 4B09A 5FRMA 2DA4A 3F23A 1P92A 4F3QA 4N9IA 1NK3P 4RN7A 3KP3A 1XPXA 1JKQC 5E3NA 3R1KA 2LSOA 3C2GA 3S2WA 4NSQA 4UB8C 4A3JJ 3P2HA 2I79A 4V19K 2N17A 3WHCA 3FXTA 2IRFG 3RTRA 4PJJA 4CO8A 4JCVE 1I12A 4AMLA 2A68F 1M4LA 2W48A 3HKZN 3KP7A 6PAXA 1JE8A 4MHZA 2JPCA 1A04A 2L9RA 2V9PA 2FIWA 2CS3A 2Y0MA 3GYAA 4MFLA 4RI1A 4MNUA 2QWWA 4U87A 3QYEA 3IWWA 5TISC 3TEDA 3VSKA 2HOAA 3PBEA 5CNPA 3BI1A 1ETXA 3V8LA 1AHDP 2JA1A 2MC3A 5D4SA 4E0AA 2X1CA 3F8KA 1N71A 1B6AA 4WWVA 5JH9A 3RQIA 4PZJA 1CT2I 2P6TA 5KAIC 2OZHA 3L2NA 5M5WJ 2Q43A 4GXHA 4ONWA 1GXPA 4R76A 1MNEA 2OUMA 4C9YA 3CP2A 2DMPA 5K7HA 2J8RA 5KTCA 5DM7F 2AHQA 3ZQGA 2W1OA 1QSNA 2JEWA 3VH9A 1QGPA 2KKOA 3VEPA 5BOXA 1CP7A 1ZLHA 1R23A 1D5YA 4XKCA 3S9MA 1DPRA 1MGTA 3FM3A 3V42A 5M5XJ 3KP5A 1M8BA 5CBMA 1YS6A 3HOWJ 4JYWA 4QB9A 4AVAA 1IF1A 4QLCU 2I00A 3R0AA 3CPXA 3JTKA 4XOPA 2D5VA 5HS8A 2G0EA 1T98A 4HF2A 1CT0I 2NYXA 1R00A 3QOPA 4UUSB 1TF9A 2CSOA 2FD5A 3TGNA 4HNVA 4AYBN 4GFBA 2HOTA 4DQ2A 2W84A 1BPNA 3G3SA 3HZJA 2F8HA 2PR1A 3W6JB 5F1RA 1GYTA 4MY0A 3RCOA 1ZRFA 3H8EA 1N77A 2VL8A 3HHGA 3H8GA 3KZYA 3Q0VA 3K4CA 3E59A 4Q7AA 5G21A 5D8KB 2BW3A 4IRIA 4HSRA 1QZZA 1JTXA 3A1YA 3PFIA 2AS5F 4C68A 4YFJA 2XGCA 3BCAA 3Q9VA 4A0ZA 4IHMA 1Q7LA 4NGMA 4P9FA 4OIOF 2Y2ZA 3B73A 3H9GA 2WY7Q 4FTHA 3PRTA 3D3SA 2ZXJA 1UHWA 4I6ZA 2EZIA 2CNSA 4RB2C 5EZGA 3KEYA 1WRJA 3KZWA 1R57A 3P2FA 5EGOA 5GP9A 2VE9A 4U0VA 3VWEA 1I6XA 1U9NA 2FEZA 2UVOA 2ISZA 3S3NA 2JRTA 3ISZA 4DYQA 1MBKA 4KOVA 4GO1A 1YJNI 2P6GA 3FEDA 1X58A 4RUHA 3I59A 5HDGA 2GLJA 5M5YJ 3KEOA 2K9QA 1OCCH 3F72A 3EETA 2D1VA 1PDNC 4IF5A 3VWDA 3LSIA 1MJBA 3QYBA 5H20A 1CPSA 3RO0A 2EPFA 4I98B 4G7OF 4XLNF 4UXJA 2A6EF 2OC6A 2PG4A 3W2VA 2EFNA 5C44J 1VQNI 4NXYA 2DQLA 1CGJI 3I54A 3WTTC 1YS7A 1H0ZA 4MRIA 2K3PA 3E5UA 4E7IA 3RYRA 4A3GJ 2FS5A 3FNCA 3NH4A 3SXYA 4X5KA 2XGDA 2CIJA 4FAIA 1R6RA 3CP8A 1WJCA 4UFWA 4FWUA 3WTZA 4KA4A 3RIRA 3P5JA 1RI7A 3VOEA 4HV6A 3T90A 4M6IA 1X4OA 3ZMUA 1QVUA 4G6TB 2WAQA 2HQRA 2HQAA 3DTEA 4L89A 3PB4X 4RB0A 1YLFA 2VQYA 2K9MA 2AFOA 4TV7A 2I8DA 2BXYA 3QWLA 3SXNA 5DCMB 3P9IA 1UHSA 3Q3SA 2X48A 2DDBA 1ZR4A 2VONA 3S6FA 4L9VA 4EJVA 4ETSA 1HW2A 4OMEA 3E5XA 1IY5A 2BBYA 1MMDA 2GOMA 4LOCA 2WA0A 5DWMA 3H36A 1V4RA 1IGBA 5IB9A 3TE4A 5C4JJ 1UMQA 5EMIA 4YU9A 4CCOA 2VODA 1W0UA 1WKXA 4B4CA 1CT4I 4BE1A 3IU2A 4NBQA 2WPXA 4L8AA 2Z3OA 4CXFA 2J87A 3J7ZI 3BJOA 4O6JA 2KIMA 3Q0UA 2G9WA 2QUFA 3HPHA 1I6HJ 1IYLA 2FSRA 4Z6YA 2W0TA 1HLVA 4H4KC 2E19A 1IN7A 3RPQA 1X1CA 3K2ZA 4M72A 1SQHA 1IN5A 2VASA 3H9JA 1ZREA 4DJAA 1Q2CA 1E3HA 4Q38A 2ARPF 3WE3A 4UIAA 3H4QA 4P44A 4UVAA 3SQNA 4CZCA 1L3LA 2LG4A 3CDIA 5LRRA 3CCEI 4KUBA 2EFOA 5FFZA 2PR8A 2Q7SA 3IU1A 2B5GA 1OVOA 2PJ9A 4IL6C 2YUUA 3IWFA 3R0JA 2PVWA 4M3FA 1XD7A 2ZFWA 1X2NA 4YELA 3L2VA 2NVTJ 4WP4A 4OVOA 3E6MA 4NNJA 4QPOA 1Y7RA 4QUSA 3TFYA 5J4VA 1FMWA 1DTDA 3GZNB 3WTWC 2VI7A 4DJLA 1ODDA 4NGRA 2XEIA 4F9VA 5F46A 2PJBA 1YK3A 2W85A 1D1CA 2VL1A 3GKRA 1USSA 4BY1J 5JVGF 5E8GA 1C0WA 1B4AA 2H1KA 2EFPA 1T6SA 3BG6A 3LODA 4CSWA 1R9TJ 3MZ8A 2XVCA 4IHXA 1K6YA 1P7JA 2Y0SA 1IXCA 1EF4A 1KZFA 2JVHA 1YIJI 1R43A 2CWHA 4MFPA 4FETA 3U21A 3FBUA 4V2GA 5JHUA 1P9ZA 4CICA 3HL2A 1YTYA 3SZPA 2HOSA 3D8PA 1W36C 1WJBA 2MC4A 2OVOA 1XIXA 4MCRA 4KIBA 3PZJA 1FBQA 3SEZA 2NRAC 4MCPA 4B6ZA 3HOSA 4JJXA 3CD6I 3WTUC 4HZFA 4BJTA 2CGPA 3ZQ7A 3QAYA 1WQ2A 5FLVA 2YNDA 1O3QA 1BI0A 4DUKA 1FYMA 1TWCJ 3J7YJ 3EXNA 1GV5A 1TKJA 4PK3A 3LAJA 2GANA 1M1DA 2DOFA 3K4LA 1OCOH 4LMYA 4A3IJ 4A31A 1ARMA 4FD4A 1R1VA 4BBHA 4BXXJ 3C3WA 2HUZA 1PCAA 2R92J 2FX0A 3DEUA 3OV8A 3TO7A 3GTMJ 3DDDA 4WJBA 4FX0A 5EEHA 3D4UA 3KCCA 4CCMA 4AC0A 2QQ0A 1P2FA 2HKOA 1CQTA 1IZ1A 1XFOA 2EBIA 4U5YA 2XSDC 3RYPA 3GY9A 4R57A 2GIVA 4KSAA 1RR7A 4B5PA 3AG3H 5HLIA 3G1OA 2EFQA 2ISYA 5F0FA 4M3DA 3TO6A 2J5PA 2AFZA 1F4KA 2HEOA 5AG4A 1ULKA 2KL4A 1J5YA 2E1MB 2PX9A 5GAEJ 4MTDA 2KPMA 3LL7A 4U9YA 3D1NI 2L54A 2LKPA 4BKXA 3GX4X 1R4MB 4E6KG 3GTLJ 3QU6A 3S3MA 1XMKA 3D5LA 3IP4B 4MMOA 4RLQA 3BC8A 5HXDA 2PJCA 1KGSA 2QGUA 2EQRA 4PSWA 2ZW4A 3OSFA 5KK1A 4KOSA 3GBGA 1CPXA 1QMUA 3T8WA 3DKWA 3LSTA 1XA6A 4A30A 4BJ6C 5E3LA 1R36A 1X1DA 3LSPA 2OH1A 3L2UA 4L0YB 1I3QJ 3TW6A 1U5KA 1JGSA 1FNNA 1MT1A 3I4MJ 2GLOA 4XM3A 3UKGA 1ZG7A 1XDSA 2HQ5A 1LJ9A 2CW8A 2OCCH 3IAS2 2X6YA 3DU5A 1XBTA 3ERED 1LAPA 2ABZA 3E3VA 4B44A 1ON0A 4Y3OA 2DB6A 5HVHA 2IVMA 3BCBA 4CGLA 3FDYA 3KHZA 1IW7F 3GLLA 2O4HA 4GS4A 3G8WA 3HC7A 2J9RA 4IQJA 3S17J 4OC4A 5LHGA 2NNNA 1ONVA 1V5EA 3IWEA 1WJFA 1W4MA 5E96A 5CKTA 1ELMP 2W57A 3DEWA 3S3OA 2JQ7A 1Z5RA 2B5GB 3OYDA 2OOTA 1SFUA 2SGPI 4G12A 2AJ6A 1UELB 3BZCA 1SANA 2X6XA 4L9NA 5ED4A 1IO2A 3U1DA 2YR2A 1XSVA 2FJ1A 2X1DA 3V4GA 4E4HA 3EYYA 3A2KA 2DFFA 3EUHA 5J6XA 3CCQI 3K10A 4I2OA 3IAM2 2L9NA 3QPTA 1U5TB 2KRHA 2VKDA 2BZTA 2H27A 2DIPA 4O23A 1OZPA 2R98A 3G1MA 3H0DA 4I0AA 3BT9A 5LHHA 1AYEA 3GWZA 4OC1A 1LR7A 2B4DB 2NXNB 1EV7A 1Z3YA 2XB5A 3V7RA 2VBXA 2FNAA 2FNPA 1Z4RA 5JVTA 2V79A 5E8IA 5H2FC 1J59A 1WK4A 3HUGB 1ZRDA 1CE3A 1UZCA 2FL4A 3LWUA 5EX0A 2NS8A 1G59A 5A27A 1TW3A 4LG3A 4X8IA 2QCOA 1CGII 4UV8A 5K8OA 1BR2A 1YHQI 4MEXF 4OC3A 1MK4A 3LA3A 3TOBA 5LEKA 1D8KA 4UUTA 3ONQA 1VQOI 2LF8A 2FMYA 5HI7A 4R87A 3U9GA 2CU7A 2PJ8A 4L0ZB 2XIGA 1RESA 2DMUA 4ESJA 2ZMEC 2DJIA 4F7ZA 1OR7A 4ZYGA 3FH4A 4KOXA 5HMNA 4CGNA 1VQMI 3I5UA 2KMOA 2Y9YA 1ZRCA 3J81K 1K4JA 4DW6A 3PSIA 3U1KA 2GU2A 5B3SH 2DT7B 3BPXA 1TWFJ 1Z91A 2D2WA 2VLAA 3CJQB 4A32A 4O5VA 4OOIA 4OKOA 3WU2C 3DKXA 2M5WA 3FM5A 1TZLA 2QQAA 4HPSA 2F48A 4UUVA 3SJEA 5JPHA 2VIXA 1ZELA 4LLLA 3OS2A 2RNJA 2WBMA 3LSRA 1LFUP 3TJQA 3BLNA 1M4DA 4KICA 4WWCA 3S16J 2ZKZA 3L1PA 5DS0A 2ESNA 1KU7A 3FIWA 3VFZA 5DCFA 2FNFX 3FIXA 1OQYA 3BR3A 2B8TA 4U0YA 2NS0A 3CCLI 3TX8A 1X19A 1S3JA 1Q1HA 4NC7A 2BO9A 2BY2A 2B0LA 4ESFA 2P4WA 5K8PA 2V1XA 3LA2A 1PP8F 3GTQJ 1PPFI 4AXVA 2FUG2 5JHWC 2EINH 1K79A 4O3MA 5JM6A 1BW6A 2QVPA 1XMXA 4G7ZF 3EQLF 3J81Z 3I59B 3UEJA 2O0YA 2CQXA 2O3FA 4R8FA 5JLXA 2WADA 4M6XA 3W2AA 4PSXA 2QKLB 1NXUA 2BE5F 3WABA 3B2YA 1XDUA 2R4GA 4MI4A 1IN4A 2X0LA 1B6BA 1D0ZA 3CCMI 2F5IA 5FRNA 4HEA2 3OS1A 5F48A 3QP5A 2MH9A 4D1QA 4L5IA 1N25A 4KVXA 3BY6A 1OFCX 2NU3I 2Q4ZA 2ZW7A 3M8JA 5F0CA 3ML6A 2UZ3A 2Z2SB 2Q0YA 3K69A 4M71A 2JN6A 4A24A 3P9KA 4HX7A 1X1PA 3I56I 5DUIA 4CAXA 4X3RA 3JVNA 3BI0A 3CXSA 3A4CA 3FX6A 5LYFA 3ZGKA 2ELKA 2CV2A 1ORKA 2GM4A 3CDXA 4ZTJA 3GUXA 4RM3A 2ZBKA 3ZQFA 3FJUA 1S7EA 2E7WA 2YSRA 4LIUA 1NH3A 1FOWA 1TBRR 5FKKA 3D2PA 4MCQA 3H3VK 1YSJA 1V5FA 5LYDA 1CM0A 4QC6A 3FBIB 3I55I 1ETKA 4GYIA 4BHPA 1Y56A 2Y75A 1W4RA 1ERDA 1V55H 3EO4A 2CQNA 2WY8Q 4EJOA 3HOZJ 3FMRA 3RPUD 1RO5A 3PP9A 2DA1A 2P6SA 1VIXA 1IGNA 3IC1A 2ZXVA 2VRWB 3SGBI 2KISA 5FJ8J 3HHHA 4I02A 1Z7UA 1OYIA 4ZJZA 1WJDA 3MKLA 2F7VA 2VKHA 4D9JA 4P45A 5HVFA 1BOBA 4BYYA 2RQQA 5DS9A 4G6DA 2ACJA 2IT0A 3MN8A 3LQRA 2OA4A 1X3ZB 3DCFA 3OR1C 3ASNH 4IVNA 3PM1A 4Y52J 2QSFX 3S1RJ 1JKRC 2ZNYA 4UEZA 1PYVA 4HYEA 1JKOC 4QPQA 2OF7A 2Z5UA 2QBYA 4NGSA 2Z99A 4E7LA 4HBLA 2VPLA 1PUFA 3ZPLA 1JUPA 3KP2A 1I27A 2VJ4A 4PJNA 5K5OA 3D7HA 4A0YA 1OISA 4W9YA 3CUOA 3T1BA 5JQ4A 4HQMA 5K8MA 5GAGJ 1JQGA 4DZPA 3B8GA 4H2KA 3TT2A 5LYLA 3I3LA 4CPAA 1ZLJA 3OS0A 2F5CA 3WG7H 2DPDA 5TRDA 4C7IA 4LLGF 3GEZA 4ZY0A 2QM3A 1S20A 3FXLA 1DU0A 2XGEA 2PN6A 2KP6A 3B7IA 3TP0A 1Y0UA 1Z6RA 2LOOA 2M3AA 1XGNA 1FEXA 2L02A 3FSXA 1TIQA 2CTCA 3ABUA 2QF7A 4X1EA 3S93A 4E1RA 1XE4A 2WAFA 2V9VA 4AVPA 1P4NA 2HNHA 4CAVA 1ENHA 4JK1X 3CZXA 4PGGA 1GT0C 1N78A 1QZYA 2ZFUA 3T8TA 3CO7C 2PI0A 4QBJA 1IV6A 1KU3A 2DK8A 5FKMA 1KBEA 1UG0A 2Z3MA 3A9LA 3ABMH 3R9EA 5J8CA 4MJ8A 4QVTA 4A39A 2LB7A 4HGUA 2LC2A 1MIJA 1SD5A 1Z8TA 4X6AJ 3M1CA 2OZUA 1BUSA 3F5BA 4K30A 1YMEA 1Z2LA 3ECOA 3C2BA 2CYYA 2BVMA 3FXQA 2MH2A 1ETOA 2CJSC 3OWCA 2FXAA 5GTHC 1PJRA 2K7LA 4KIGA 3CF2A 1BR1A 2CUJA 5AONA 4UXIA 1FT7A 4MXUA 4A94A 1GV2A 1IY6A 5HDKA 3I4NJ 4NGTA 1P7IA 2WWYA 3QTLD 3H5RA 2OQGA 2N1AB 2HPIA 4EFDA 4M9SA 1QZEA 2XRNA 1KU2A 2Z3YA 4D7NA 1M1EB 2M9HA 1AA7A 1WCMJ 5J1RA 3MMYB 4UBRA 2KMUA 4AYBA 2FCKA 2OR4A 3OR2C 1XCVA 4B5PB 4PK2A 4F91B 3OYCA 1DE4C 4B5OA 2LFBA 1GHCA 2CJJA 1BIAA 4IHTA 1J4JA 2HWVA 3IH3A 2LK2A 4W1UA 2X1EA 3H5NA 3SZTA 4BS9A 1SGNI 4HDUA 2KLOA 3TDUC 4DYRA 2WTEA 3J80Z 2VOOA 4CCLA 2O8KA 2PBIA 4S0HB 3JRFA 2OZ6A 3BTLA 5A2QZ 3KEQA 1O4XA 1IRFA 5K7FA 1JGGA 2BSWA 2VBYA 1HDDC 3EYIA 3PFOA 2KIQA 1IUYA 2V1CA 2QYOA 3FF3A 1BI1A 3JSPA 4XOTA 4ZY2A 5FUXA 4A3KJ 1RPWA 2M45A 2WCYA 3GCMA 4M9ZA 4B6DA 4DYOA 2NS7A 5FKOA 2IPQX 1A5JA 4II2A 5BWAB 2HGCA 2BEIA 1BC8C 4Q36A 2I5UA 1SMTA 2LDUA 1HOMA 3LACA 1IXSB 3VDUA 3MRUA 2Q8KA 2DPTA 2X51A 2KZVA 2K4BA 5ILUA 4CCJA 3S15J 5EYRA 4C3IJ 2FQ3A 1QBJA 4JZ0A 1V0CA 4HRIA 1J9IA 1R1TA 1BW5A 1BA5A 4RS2A 3D0SA 3BJ7A 4PCQA 3V8JA 2H6CA 2DI3A 5HVQC 1ETVA 4TNUA 1YW7A 1P4AA 4MTEA 4ON0A 4HKFA 1CBXA 3RKQA 1V3FA 1TWAJ 4F55A 1I5ZA 1SFXA 2HOEA 1CJWA 2K5TA 3F8NA 4M6YA 5LRGA 2XSJC 4BD9A 2QIRA 2E36A 4HW0A 5FD6A 2L7XA 5JFRA 2EIKH 2GVIA 2VBQA 4F9UA 2CW7A 3WU0A 3VB2A 1YQEA 4BBRJ 3HGYA 3GZ6A 2XF6A 1MNMC 1YVOA 1U9OA 1YITI 3CUQC 2E73A 4CYDA 1QPMA 1S5LC 3VYSB 5H84A 1BM9A 4IF4A 2DPUA 2LBFA 1J0RA 2XPVA 2JA8J 3ISPA 4MFQA 1UFMA 4BBSJ 1UUCA 2WAQN 2V77A 2V1NA 2JBJA 1NSLA 2G7UA 2XAUA 3BQZA 2JTVA 1GVJA 3LSJA 3VPRA 1HQCA 3K4JA 1H88C 5CVIA 1YTPA 3F3XA 2AE6A 1WJAA 5B5EC 1AU7A 3I9SA 2EWNA 3HG9A 3K1PA 3ZMDA 4KLWA 4RMNA 1LQ1A 4S05A 3K2AA 3S9LA 2E1MC 2ZNZA 1W5TA 2NYQA 1I1SA 4XORA 2RB7A 2JZMA 2IS4A 5EC4A 4I99C 1ZGJA 3CMEI 2W25A 2LREA 1YYVA 5B66C 1TURA 2CRGA 1MSEC 3DBHB 4KLVA 1TUSA 2KZGA 2NNYA 2O03A 2FMLA 2ETHA 3I71A 1A36A 2Y0SN 2Z3PA 4E8OA 5EEAA 4F8ZA 1X2MA 3WU1B 1K61A 4HLYA 5E20A 4MQ9F 1WVRA 2LTPA 2L9VA 1R1UA 2CTBA 5HVGA 3BG9A 3LA7A 3PIOF 1E3OC 3W6XA 3MCZA 3BG5A 2UV1A 4KYWA 3GZ5A 1IXRC 2DK5A 1TXRA 1HDPA 3CC7I 3RU0A 2GBYA 2A05A 2M4KA 4MIMA 2A5WA 2XAHA 4B3XA 2M0MA 2ZO4A 4FASD 2WAEA 2EUIA 4IAVA 3GFLA 4BY7J 4RGUA 3TCVA 3KHXA 1Y1WJ 4PDKA 1B1BA 1ETQA 2E2IJ 2PJAA 3HJEA 2V1UA 4A3BJ 2CO5A 3N05A 1WJEA 3PSFA 2Y31A 4MEYF 3G6EI 1IY7A 1JWQA 3H92A 2IGKA 5DTDA 4KSIA 3K70D 2JBKA 1WZ2A 1APLC 1M4GA 3GOXA 4FE4A 3VDXA 2LY2A 2F6CA 1Z6TA 2OBPA 1VGYA 2Z3NA 4HSTA 3DF8A 4BXFA 1Y1CA 2B3UA 2R8VA 3IH2A 1VDDA 1ZG3A 1P4WA 3IKTA 2VXKA 2KQRA 4OMYA 4ZI6A 2AXLA 2ZSIB 2HQYA 4ENJA 1T38A 2SGDI 1S7NA 4BE2A 2MLKA 5D4RA 1X12A 5LHIA 2VQHA 2Z3LA 2BY3A 3H0GJ 5D5XB 5FUWA 2ECCA 3J7AY 3NE7A 3BTJA 1L0OC 1MMNA 2RAEA 1UFHA 1Y0NA 4P5OA 1BMOA 1QSTA 1K4TA 2GFQA 1Z1DA 1BL0A 1DP7P 4D7MA 3VDPA 4UWJA 2J8NA 1I50J 3GF2A 1S7LA 2E2HJ 1NMTA 2SGQI 4CYCA 2KCWA 2M7AA 3IWZA 3C2HA 3L2QA 3CT9A 4B13A 1U6GA 1YR0A 2COMA 2MFZA 3EY5A 4H0EA 5I4MA 2H6BA 5CPAA 1RRJA 2ORWA 3HM5A 1I1DA 5KCMA 7CPAA 1WFXA 5DCMA 4NC8A 4A3FJ 3DU6A 2Z9OA 1SGRI 1TC3C 3K0LA 1NSAA 1EJ9A 3ZMTA 2V8GA 4LQGA 2ZEHA 3E1SA 2X3TA 4R3LA 2OAZA 3R9GA 3DR6A 2E34A 3GIUA 2FOWA 3GTJJ 2RC4A 3TL4X 2FIAA 4P9UA 2R7WA 2CH0A 2JZYA 1RKWA 4HDVA 3EUKL 4JBAA 3HGGA 5E79C 5HLGA 4EJWA 4YIRX 4CAFA 3CDLA 2DMNA 3PJRA 5IT3A 2VBZA 3FXJA 2VBWA 3S6GA 5CCMA 2PEXA 2RV8A 2V6EA 2PDOA 1POGA 1RKTA 2R7FA 1B8IB 2G0BA 1BO4A 5D29A 2VQGA 3G4SI 2PMZN 2JDDA 2HU9A 3PO3J 4E2AA 1HEEA 2AFSA 4NDLA 1CP6A 5HOOA 5L3GA 2Z11A 5H86A 4MFEA 1IOFA 1R71A 2K02A 5DV5A 1MH3A 1FPQA 3W6SA 5K5RA 5EX3A 3UR3C 2EA4A 3DTKA 1TT0A 1MW7A 3RZOJ 3D66A 2NOGA 5BNGA 3D2MA 2ZELA 5DUKA 3D67A 4BXUA 3VARA 1YVKA 5AG5A 2KHMA 2P0WA 1Q2DA 3OYJA 1Z8LA 3OMYA 4N0BA 3JAMZ 4H6ZA 1F43A 2H8RA 3PUBA 4YEJA 5E17F 2FVGA 4MY3A 2HPMA 1M4IA 3BZ6A 3DWLE 4MQVA 5BPIA 2R7HA 4MFZA 1A6QA 4P96A 3E0JB 3ECHA 2PRBA 2CXAA 2XC7A 3SYTA 1TIHA 3D7FA 5ICFA 5J3LA 4A5NA 1YOVB 1VI0A 5F49A 4UXHA 2E5RA 1BIBA 2KIFA 1B9NA 3NQOA 4CA0A 4RB1A 4F0XA 1YX0A 1KYWA 5J8FA 3W3CA 1Z2IA 4LX9A 3UY5A 1FLIA 4JXQA 1SVOA 4BINA 1VQKI 1S29A 2EIMH 2R1IA 4A5MA 5IYCJ 5ILSA 4XKVA 4NJRA 5KTDA 4XLAA 3ABLH 4J19A 4A93J 1G4DA 3QB8A 4M74A 2ANPA 1UAAA 3B3CA 4QTRA 4UNOA 4XKBA 2W24A 1YREA 1U3EM 3FMCA 3KASA 3QU3A 2QQBA 2CFXA 1BAVA 4EWTA 3DLLF 5IT9Z 1W3SA 2R7OA 1OLTA 1W7PD 3MQ0A 3I1UA 2VUMJ 3CC4I 4P4JA 2LMDA 4HNWB 4KN4X 3BTCA 5AIQA 2P6AC 3ZR8X 3I64A 3Q9SA 1R49A 1U6MA 3ELKA 1TT5B 3JRCA 4G6QA 3KYLA 2ZOFA 2VJ5A 4LUAA 1VQ7I 1ZK8A 1OPCA 4NHJA 2IQ6A 3MD2A 4ZDPA 3OYAA 1FAQA 4UV9A 3KFWX 2H8WA 2PC1A 3RJPA 3DR8A 4OADA 1YX5A 4RA2A 2ZW5A 2OB0A 4WXDA 3QP6A 5JLWA 4AIKA 2FU4A 4LQ6A 1BN5A 5KTAA 4I0BA 4LGWA 3OSGA 1SVMA 5KHDA 2TDXA 2P8TA 2NVUB 4E7ZA 1A31A 5FO5A 1TKFA 1XCBA 2BUSA 4P1WA 2DXIA 2YNCA 1XJOA 3D7DA 1T95A 1W1WE 2ME0A 3P9CA 2B4DA 3S2DJ 4JQFA 3ZMVA 2C1CA 3GB0A 1K83J 1MBHA 1K78B 1BOAA 3F8FA 3S14J 3MKZA 4ZZDA 4GM5A 1QQ9A 4U0WA 2B7EA 1S5KA 4YGOA 2K3FA 3JRUA 3KPHA 1LE8A 3HUGA 2RIJA 1S60A 3FB3A 3DP7A 1FOYA 1YG2A 2L2OA 2L7ZA 2EFWA 2HI3A 2JWTA 3FBNB 4FBEA 4OAEA 1U78A 3BJAA 2STWA 5CYVA 1HW1A 4RAYA 2X85A 4F92B 1OCTC 2WPWA 3IKVA 2XAQA 2OTJI 1TGSI 3FF5A 1GUUA 1XGSA 2IJLA 3TO9A 3GW2A 1VQ5I 4XPDB 3KE2A 3R5AA 1OJLA 3ZQQA 4CH7A 2CF4A 4CS0B 4I76A 1TQIA 1OCZH 1MBJA 2PJ7A 3K4NA 1OCPA 3M8EA 1H8AC 1V1IA 5E3QA 2JSCA 3BOQA 1FBUA 4PPZA 4PXDA 2B3VA 2NAZA 1AN1I 1KU9A 2QSHX 3R5CA 2PJ3A 3OYNA 4KOUA 2VI6A 3R4KA 1Y7EA 4PJ0C 2CQ7A 1H8LA 5J1UA 1JI8A 3FEEA 2JYYA 5HNHA 4CYQA 1S7AA 2X6OA 2AFXA 1TBQR 2M1BA 3D5SC 4BACA 2Z0ZA 2F5DA 1A6IA 1IRGA 4EMEA 4IO9F 2VPRA 2Q2EB 1D0YA 1AOYA 3I3GA 5J1QA 1AMPA 1QO0D 5DYMA 4I49A 5J47A 4AIJA 5M3FJ 2GQQA 3PB8X 4ORFA 4S04A 4R79A 2D45A 1WWXA 2KJCA 2OD5A 4UHTA 2VJJA 2POKA 5C3EJ 2K9SA 2IS2A 2ID6A 4PJMA 1Z7LA 2BL1A 1VHSA 2DTRA 3BPVA 5L3CA 4G94A 4DOZA 1HBXG 3E6CC 2M87A 4AG7A 2DOEA 3F0AA 4OU0A 4A3CJ 4HF0A 2OU2A 3OYEA 3S8PA 1E17A 1DPUA 2FE7A 5GCNA 3EUHC 1VF9A 2LY1A 3V38A 3N4MA 1CHOI 1NE9A 2RKHA 2HDDA 4LB5A 2DOAA 1IIDA 2A6TA 2E2JJ 3BG7A 3ZOBA 3MFKA 3BJIA 4M3GA 2EJRA 2DA2A 2P5KA 2R5YB 3L09A 3LQQA 1SVLA 3OOPA 3M8FA 4GYGA 2NU2I 2HYFA 4CYCB 1R58A 5IB0A 1XGOA 4NQWA 4XR6A 2F2EA 2QMLA 1Z77A 2ZXIA 4PGHA 3VYRB 1IW4A 2FBHA 2E5NA 3KGQA 5G1ZA 2JSPA 4CRYB 1LOKA 3DTIA 1IG7A 3LSMA 1OBRA 2L8EA 1DQUA 5CLSA 3JW4A 4I09A 5EG0B 1HXDA 3A01A 4LB6B 3KETA 2DYSH 3CMAI 4JYKA 1FOXA 4YWYA 2MA3A 2PJ2A 3OYKA 1LFPA 2J5OA 5JI6A 1TF8A 5L3BA 3CF5F 4OIQF 2C6GA 4KN7X 5D8NA 1OMTA 1LDJA 4ZDOA 4ANJA 2K9NA 2L4AA 1ITYA 3MEKA 2ENNA 4R3KA 3S1QJ 2RGVA 2DQRA 2VKVA 5E3PA 3ZZIA 2E7XA 3IUOA 3WGIA 4NGQA 4C3HJ 2JUGA 1BLLE 2P6FA 1YJ9I 1LPQA 1EKEA 3SZGA 4CGPA 2K27A 3PB7X 4L9TA 3VE5A 2ZXWH 1KQ8A 2QSGX 1UWYA 3CZ6A 3LMSA 5CPRB 1H89C 1XTAA 1WGXA 2HQNA 1B72A 3SHFA 3PO2J 4P4DA 2J9AA 5GPCA 2ZB9A 1Z7KB 2LKXA 1L0CA 1GXQA 4Z65A 1FP2A 5CVJA 1G2HA 4EJTA 4CGOA 4LJZF 1AKHB 2OPTA 2M8EA 3H5ZA 5A28A 2XV4S 3B6AA 1E2XA 2O9LA 4Y4RA 1TBOA 4R7MA 3IO1A 4YIFA 2D4PA 1JJ6C 2K86A 4RDUA 3ZMZA 1VTNC 3F22A 1YX3A 5C4XJ 1FJLA 4ZC3A 2BGCA 4RB3C 2ZEDA 1QA6A 3JRDA 1RR8C 4MHNA 5D6EA 1QSRA 4KZTA 3FXUA 3LSGA 2KCXA 1O3RA 3OXFA 2BY1A 1YGHA 3BZKA 3DLAA 2CG4A 2W4SA 2G3AA 2LEOA 3VYUB 2J8MA 2AFUA 2YS9A 4HNUA 5BQTA 2LBFB 1LEBA 4HLXA 2XUBA 1XRYA 2JRMA 3MN2A 5F6FA 4E7KA 1W5CC 3KZZA 4KOYA 3D68A 4OAZA 1R5ID 1S8NA 3NARA 4JWPA 5HS9A 4YRHA 4ENKA 4Z2YA 3ZQCA 2DCEA 2AO9A 1Q9BA 1SC7A 2KMPA 3ZQLA 4OP4A 1U2WA 2REFA 3BJ6A 4NF1A 3H1CA 5FLXK 2XASA 1Z21A 3DKYA 1MBEA 3K4MA 1Z9CA 2AXTC 2NVXJ 1Z9UA 2GREA 1MBFA 4AIDA 4BHCA 2IGOA 4AG9A 4DIQA 4BL0B 2HR3A 2FF4A 3W2WA 3DQVC 1DGWY 3E7LA 1CX8A 1LAMA 5ISVA 4AWXB 1TTYA 3E6DA 1WGCA 2XROA 3F21A 3RSNA 4DZJA 3UGIA 4CRZB 1YO5C 4ESBA 3RZAA 3K4KA 4M3SA 2ZEEA 3QQAA 5E18F 1S72I 1MMSA 3MWMA 4XPDC 2QBYB 4H6UA 4P4BA 4XLPF 1Z8WA 3PGPA 5F1JA 1JHFA 5L3FA 3GUDA 1MD0A 3AG4H 3HRUA 4ENNA 2TRTA 1M8CA 3OL0A 2PRQA 1S7OA 3FMSA 4XLFA 2YPRA 3SFIA 1BPMA 3SXOA 2JK3A 2XKPA 4NQWB 5IT9K 3FXMA 1FIAA 2RN7A 3ZQIA 4ZYQA 1JTYA 4CYPA 2ELIA 3BJ8A 1WJ5A 2HDCA 1ELLP 1RUNA 4P6YA 2V6CA 1V1HA 1JUMA 2GA2A 4HA8A 3TP3A 1LB2A 5DD4A 2XAJA 1X10A 3MVPA 4OIDA 3LMMA 3K70C 2DMTA 2PQ8A 3WGHA 4E7JA 3UNGC 2CV1A 2KMQA 1LDKB 1WHUA 3RKWA 1JUSA 1FY7A 2H1LA 2ZJRF 3RAMA 4QSHA 2LF7A 2OJED 4XQFA 1SAXA 4NCZA 3KP6A 3OIQA 4KT6A 3PNYA 4G9YA 4KISA 4BH9A 2WYRA 2LR8A 4U88A 3IFEA 4Y49C 4B10A 1SFEA 3FX3A 3ZRGA 3NH8A 1IJWC 2NOJB 4NEXA 4DBRA 4RGRA 1EA3A 3FC3A 5FVJA 2DA6A 3U2RA 1XSDA 1DS3I 5KAFC 1HDQA 2EV6A 3RI4A 2JW6A 2A69F 1SMYF 3CESA 3IV5A 5G20A 2MYSA 3HIFA 2BCOA 2NMTA 4XRSG 3GFJA 2DKVA 1DS2I 5EJCA 2JDCA 3I4PA 3FHNA 3QAHA 4PJLA 4BQAA 2M4GA 4BAYA 3JR9A 2MW8A 4FD5A 3PQJA 2G9DA 1ZARA 5FLMJ 1KUVA 2FQ4A 5DM6F 1USTA 3V8KA 1LUJB 3SFZA 2YUSA 3PQKA 2QQ8A 3NA6A 1HEVA 4K3NA 1R22A 4A3EJ 2ZCWA 1HW5A 3CLOA 1FC3A 2YNCC 4ONUA 1SGYI 3OIOA 1UJ8A 2OQRA 1J75A 2ZXHA 2Q51A 2TCTA 3W6KB 4A3MJ 1HKSA 3NEUA 1XMAA 2PFBA 3FISA 5LYIA 3A03A 3QODA 3JRIA 2CWGA 1EH7A 4ZYAA 2OZGA 4L5JA 3HOTA 3H8FA 3GLJA 4GRIA 2DA3A 2LLKA 2QZ8A 6CPAA 2HVRA 1HF0A 1P0HA 3LD2A 1D1AA 2WV1A 4UUSA 2VOPA 5CCLA 4E7HA 5L3EA 2JJ7A 1CF7A 3A02A 1MNDA 2GAUA 2HTJA 5D6FA 4BUPA 3WTSC 3BROA 4D0PA 1EE3P 5K1YA 2BW3B 1O3TA 4ZYDA 1F57A 1F5TA 2WGCA 2PIZA 2Q44A 4UCNA 2IXSA 1K78A 3IWGA 4IPAA 3OYGA 1VFCA 2O7OA 4KFCA 1VNDA 4X0GA 5B1BH 1Z8XA 4XPLA 1IU8A 3H3UA 2DW4A 3SDBA 1U8BA 2ZEMA 3E2IA 1GDTA 4F0YA 3GO5A 4XRSA 2VC1A 5GPAA 3B02A 5H6RA 2A61A 5F47A 2LD5A 2JMWA 1TBNA 1X1AA 4IX7A 3ZP5A 1FTZA 1ZG5A 1VKCA 1R7JA 3I58A 4H89A 1Z0XA 3ISXA 3G1LA 3KY9A 1Z05A 4QWQA 4AVZA 1K6OA 2PJ6A 1B87A 2YGWA 1PTRA 2FSWA 4AVCA 4ZZLA 4NGPA 1Y8FA 1KYZA 1TOTA 4UIBA 2UZKA 2ELJA 4RS8A 3JRHA 2GXGA 1OCRH 2ZC2A 4UVCA 4EGZA 1PYTB 3NWTA 4M6HA 4PQAA 4BMHA 3CQZJ 3QWPA 2Z1DA 2QEXI 5ELYA 2JVGA 1NUBA 2ZPAA 4FHTA 1P9QC 3T0YA 4EM2A 1IN8A 4AD9A 4PUSA 2XPWA 4JX4A 1TP4A 2LUYA 2AFWA 3WTVC 3MZYA 1SFKA 4BEHB 1Z4EA 3AL0C 4IHSA 3KLNA 1AWCA 3PUFA 1ZN2A 4M3EA 4XPKA 1XG1A 3GTPJ 2XPUA 4EMSA 4FD6A 2ZSHB 2YU9J 2VKEA 5D5UB 2LY9A 2EK8A 5IOYA 3JTHA 4Y7NJ 4XICA 1TWHJ 2JUCA 2X9DA 1AUGA 1YW8A 2HDWA 5CVRA 5EG0A 1QHGA 2CW0F 5CVUA 1Y1BA 1R3NA 4IOCF 2FBKA 4NB5A 1LR9A 5C82A 3CC2I 3FMQA 3NE8A 3CCRI 3P7NA 4R9MA 5HNFA 4B1RA 4RBOA 3O2PE 1YW9A 3QYFA 3K4BA 2ZJPF 3G3ZA 2ORVA 4EM0B 4LG0A 2STTA 1UHMA 5DAEA 2UXXA 3ABTA 1TW2A 3T9YA 3L00A 2LVSA 4UCMA 3DFGA 4D5FA 2OD1A 3WC6A 1F2OA 1Y1VJ 4DBQA 2MBFA 3VATA 2IA2A 4MPIA 4KJZA 2VT3A 4FD7A 1XSXA 1RUOA 2EV0A 1YFHA 5LGNA 2XEFA 4E1PA 2F3CI 1Y9WA 3W91A 1K7UA 3DV8A 3IEHA 2CWFA 1B72B 4M9XA 3UOEA 3KR5A 1LFBA 4UCPA 4B48A 2MD0A 3FKIJ 2PSWA 2XF5A 4KSFA 2GXBA 4A12A 4FUUA 4C30A 4FE7A 5F64A 5LLQA 4OMZA 4KUMA 4ITVA 4CAEA 1WI9A 3FXRA 3F8BA 1RIOH 2GIZA 2CUEA 3SJGA 1XN7A 2K9LA 2V1CC 3LWFA 2V7FA 3LFKA 3OL3A 4A6DA 3Q0WA 4ASNA 2EZKA 2C6CA 3CJRB 5FGMA 5J1YA 3GMEA 4IHVA 5CJ9A 1RTQA 3R61A 3G73A 1OMIA 4FISA 3CCJI 3OXGA 1FX7A 3G71I 2CV0A 3OXLA 1FSHA 3JSOA 2ZMEB 3QOEA 2XAGA 2EIJH 2V1DA 2XF7A 3HTUA 2HVSA 4AB7A 5FLXZ 2NVQJ 4DYCA 2EV5A 4FT8A 2RREA 1VQ4I 1IRZA 2JA2A 2FRHA 4G1PA 9WGAA 5F09A 4XRFA 2PJPA 1MBGA 1XB4A 2HKXA 3DPUA 3I9V2 1E0EA 2ZOGA 4UWIA 2V4JC 5EDNA 1O3SA 4HQEA 3OYMA 3RKXA 2M0CA 4EV0A 3F6OA 2H5MA 3RNZA 3CCYA 1JHHA 3IC7A 1XC5A 4WXCA 3O8HA 3SEQA 2C6PA 4G8XA 4XIDA 4N4OB 4RLFA 4NFRA 4II3A 5K7ZA 1QPIA 2EK5A 3A0BC 5AGEA 3WGGA 1QSOA 1XMBA 1WWZA 3IH4A 3B3VA 1MZBA 3CJTB 4M6VA 3UFFA 2ARHA 1W7PA 2M7BA 4BJ5C 4BEHA 3KZIC 1W7PB 3FK6A 2BOAA 4XNHC 5IV0A 3HOVJ 4QIWN 3M07A 1QU3A 2LKSA 3D7GA 1DGRM 5IY5H 4A33A 1JXSA 5F0HA 4PXEA 1D8JA 1UVGA 1PJUA 1Q1VA 2DO7A 4R1HA 1NK2P 2VN2A 3BDDA 5HLHA 4F6AA 2PMZA 3SJFA 4Q47A 1T2KA 1IOIA 4XLCA 3HOUJ 3CTAA 2V9KA 4NUBA 3E0KA 1WGTA 2A4NA 4GGGA 4AUXA 4CAWA 4HNXB 4EQQA 4ZH4F 2PJRB 1WI3A 3WE2A 3B3TA 3L2RA 3IIBA 4ZX8A 3WODF 4AIHA 2CMPA 4BU2A 4U7DA 4IRHA 5ILVA 2JA7J 1MSFC 2B4BA 3EDPA 5JHFA 5LEJA 2X7BA 4OIWA 4WF2A 4C2UA 4C2TA 4JD6A 4DGWB 2L4MA 2E5ZA 2MD5A 2ECBA 1LCPA 2YU3A 2A20A 5HH1A 2Z16A 4B8XA 4OLLA 1DU6A 3FXOA 2B9SA 1LFWA 1QNTA 2A07F 1IUFA 1IRXA 2REEA 3AL0B 2PVVA 2VB6A 3QPSA 1UVFA 3FVLA 2F4MB 1FYBA 3NWSA 1G3YA 5K5QA 3KLOA 4HAMA 1ON1A 3SGQI 2F5VA 2QQ9A 4A0XA 4RGSA 4J00A 3GTKJ 4BDYA 3LSHA 4OIPF 2DFIA 2Y30A 5J4YA 3COAC 2AQFA 3BR2A 3JREA 1REPC 2VT2A 4BNCA 1YQAA 2CQQA 3BR6A 2F5EA 3F9KA 3ZXSA 4XL9A 4BDZA 1T0FA 1S6LA 4A95A 1LKXA 1O7LA 1YE9A 1S3ZA 1Y0RA 3RKYA 3PBBA 1G3TA 2M8GX 3AG1H 1XOVA 4UF4A 3S2HJ 3KR4A 1ZAOA 4L18B 5CVVA 1RC9A 4J01A 1XF8A 5JR3A 3H35A 5A2QK 4PK4A 3B3SA 4WCGA 2VE8A 3OOUA 3RQ4A 1FYLA 4MCSA 4LIVA 1VQPI 2ZEPA 4UA3A 5LBQA 2ZEFA 4ZY1A 1MKMA 4PFOA 3BR0A 2XKOA 2R7TA 3R5DA 1Z67A 4FKDA 1SGPI 1YRNB 4HNTA 1LR8A 4II9A 5HQ8A 1RZ4A 1SD7A 2DA5A 2DU9A 3I53A 4R8HA 4A2UA 2QPOA 1ETWA 3R9FA 1Y9KA 5L3DA 3J7AO 4BQNA 4HNYB 3C18A 3GFIA 4LG0B 1X74A 1IYKA 4LK1F 3CUQB 1G8XA 1IV8A 3K7AJ 3HOXJ 1DDNA 3WT4A 3CUQA 4AU7A 1BI2A 2DMQA 3H9QA 1IN6A 3LNQA 3PFEA 4IUSA 2W00A 2WSAA 1Q2YA 5DWNA 2R5YA 1GLNA 1DP3A 3HLPA 4P10A 4UEEA 3JAMK 1HDUA 3B4VC 2R5ZB 1I3AA 1FT9A 3WC5A 3HH2C 1E3PA 2DT5A 2MABA 4M73A 4Y13A 1FTTA 3KQZA 5AG7A 3K1MA 3TOAA 3NRVA 1TBXA 3PIPF 1Y6IA 4OWRB 3HDDA 1D1BA 4YIIA 2XRLA 3IHUA 5IP9J 1KWMA 3BLYA 2ADUA 4ZDLA 3CO6C 3TC8A 3QPHA 2IW5A 1KQ9A 2UUZA 2FE3A 5IP6A 4GCVA 2IS1A 1TKHA 2IAIA 4I7HA 4IKFA 1SGEI 1NG7A 3G2BA 3OYIA 1S7KA 4TWEA 2EVNA 3HB9A 2ZEGA 4KMUX 3BR1A 5F27A 2IJZA 3SEKC 2K9HA 3FRMA 4HX4A 2KJBA 2F5FA 1HPTA 1UCRA 1Y8RB 2L7KA 3CCSI 3BHXA 5E3RA 5ICGA 2K4JA 2ZW6A 4B14A 2BY0A 2ZMEA 4MHGA 3FSYA 2Q4VA 4MLOA 4N9HA 5M3MJ 1HKTA 1BJAA 2E1OA 3OWTA 3C26A 3IRRA 2LH9A 4HPQA 4MFDA 3OYHA 2DDAA 5D5VB 2NVYJ 4EVIA 5EGOB 1KUYA 1ZG9A 2L9SA 4DNCA 3RBUA 2OCEA 5EEGA 4B11A 3GXOA 4IRGA 2HC9A 4CYNA 3BWGA 3HEFA 3WG9A 2X6WA 3CMYA 4CYOA 4WX9A 3S6KA 1N75A 4K2EA 1FBSA 2P81A 3O8GA 1GHEA 4KOTA 1D3YA 3V7ZA 1DUXC 1TWGJ 4XBFA 5HLTA 1TNSA 3CLQA 3ZMSA 4UB6C 4YFXF 2O61A 2IBDA 4YFKF 3PFYA 2WB1A 3JTGA 2NU4I 3BP8A 2KMRA 2N52A 3UGDA 4CHUA 4IOAF 1T56A 5AG6A 3ULQB 3OY9A 1BR4A 4SGBI 1XS9A 1RFHA 3CXQA 3HPGA 1ZH5A 4A2ZA 1YJWI 1P4XA 1ARLA 2MG4A 2V8HA 4C3JJ 3K9UA 3KKWA 1T8IA 4M85A 2SGFI 2H94A 2KDZA 2LRDA 2GOXB 4OC2A 2NU0I 1PVEA 4LK0F 2GZWA 2BVLA 2EB7A 4XLHA 4L9JA 5IPAA 1HDLA 2MSYA 2Q2EA 1F9NA 2PMUA 3H3ZA 2ZJ2A 3EFAA 2IEKA 1ZKGA 3R96A 3NFZA 5E3MA 4WK8F 1IDZA 2B0UC 2L0KA 3O6BB 4JLYA 4ZYEA 5LFAA 1RETA 1VQ8I 1U0JA 4FX4A 1ETYA 2GXAA 1WTJA 2L7FP 4MHYA 2G7HA 3L9FA 2H09A 5FKLA 4JP0A 3DXJF 4IXAA 3SJMA 4ZTFA 2BHZA 2V53A 3CMMA 2V8VA 2QECA 4BE0A 1PUEE 1PP7U 2BXZA 1D5VA 2XEJA 1HSTA 5I0CA 2Y9ZA 2HYJA 1FYKA 1YU6C 4KVME 2W7NA 3WC7A 2RFHA 3VYTB 1FP1D 3KIOA 4HV5A 3HSFA 1O57A 1NG6A 2VJIA 3EPZA 3KYDB 4I01A 4XNFA 3T5XA 1BI3A 4G7HF 4IHYA 1X3UA 1ZTRA 3ZCOA 1MMGA 3MAJA 2VEZA 1QVTA 3FXKA 2EH3A 4MHDA 1KQ0A 2Q7BA 3X2QH 2K40A 3ZN0A 3DPLC 1T39A 2EA2A 2MGQA 1YW6A 2E1CA 2EK9A 2RNGA 4Y33A 5LGTA 2R7SA 2Z33A 3ZQHA 2KT0A 3E5QA 2NSMA 2PJ4A 1ULYA 3SHPA 4XLEA 2R0QC 2IA0A 4P55A 1UG2A 5GTIC 1PUFB 3HOYJ 1W0TA 1YLOA 5THWA 2DODA 1QSMA 4JOMA 2R7VA 1MMAA 2IGNA 4RAZA 2HTSA 2UWMA 3SI1A 3KP4A 4EJUA 2ODDA 1M44A 2ZEOA 3JUWA 3HUVA 2W82A 4A3DJ 1YW4A 2I3CA 2WVJA 2DT6A 2L5QA 3PNVA 2CUZA 3CDHA 2PJ5A 3KL9A 3N5FA 2F4IA 2XB0X 4UY8I 1PU9A 3RPUA 2YX4A 3DPTA 2YX7A 3K1NA 2VQCA 3TQNA 3LAPA 2FXFA 1ZG8A 1IC8A 3IJ3A 4A37A 1G6NA 2E71A 1PCEA 1KUXA 4NGNA 4EM1A 1KBFA 4IK2A 3HRMA 5K8NA 2P6EA 4AM3A 4ABZA 4RM2A 1CGPA 2EZHA 2EZLA 4Q48A 3GFMA 1D0XA 9ANTA 2KFDA 4IQ4A 2XRCA 5HDNA 2QJ8A 3V7SA 5ERIA 1G3WA 3REOA 1VZ0A 4XKWA 1FNOA 3O3KA 5EZHA 4OIRF 4RAFA 4XRMA 3F8CA 1HCRA 4X2TA 2BV6A 2GKVA 3TMOA 1SFOJ 1SAUA 2F4OB 1EH6A 1XGMA 2ICWG 3ASOH 4XSZF 2R7DA 2O6GE 2DAOA 4KMFA 3MKWB 1ZGWA 2E1NA 3AG2H 4XN3A 3WHBA 5IOZA 1MDMB 2C6YA 3D00A 1MJ9A 1F2PA 1VHEA 2PJ0A 3N7ZA 2Q0OA 1U8RA 2HZTA 2LYCA 5DD8A 3HBLA 3ZN1A 1LDDA 4PFPA 3WTYC 2YQPA 3J80K 4JX5A 5E1ZB 1H9TA 4PXCA 3WTXC 2FA5A 1ZHFA 1SGDI 2ATRA 4BHBA 2ZENA 3K2KA 3OL4A 3S32A 3AKZA 5BS6A 2O5RA 4OC0A 4B43A 2B63J 2V8DA 4MHPA 2KRFA 2R7QA 4B12A 4GXOA 2L7MP 3F6VA 4W97A 4KS9A 3ROUA 1ACIA 1QRYA 4MO7A 4F52A 3WR7A 4CCKA 2ME6A 1WSUA 2HB6A 1F1ZA 3M1EA 5LD2C 2JT1A 2GKRI 2WV0A 2IS6A 1K7AA 2L3DA 1WKMA 1UHAA 2L01A 1H0MA 1TLHB 5BMZA 4MFKA 4CDGA 5CQGA 3LOCA 4ZYHA 3HSEA 5FFXA 3OYLA 1JKPC 1O7FA 1FMVA 2BUEA 4KUAA 3OIPA 4KIFA 2ZJQF 1WH5A 2VZYA 2R3SA 3T8RA 1XBUA 1K7TA 1LNWA 3F0CA 2DTZA 4E70A 3IL2A 1YRNA 2PIYA 2Q04A 1Z3XA 4L5EA 1YIOA
chains in the Genus database with same CATH topology
2CWEA 4EGYA 4HF1A 5E1XA 3FWEA 1MDMA 4CZZA 1B9MA 2CNMA 2UXNA 3S6HA 1RNLA 1J7KA 1MJAA 1SD4A 5LGUA 5TJJA 5DDGA 2P7VB 3TKYA 4CGMA 2D1HA 1I1GA 1J2XA 3FYNA 2JLMA 3IRQA 1HKQA 4HX8A 1S7FA 4KNYA 3MGDA 1FOKA 4MBUA 4YG2F 4WXHA 2IP2A 5EBVA 1FSEA 4XSXF 2FT0A 2RVCA 4Y17A 1KA8A 1XMTA 3V8IA 2DBBA 2M30A 5C88A 3HYIA 3K9TA 4KDPA 2X4HA 3N97A 3ZJ0A 1U5TA 4JXRA 2CNTA 2ESHA 4OINF 1H9GA 2P5LC 2VZZA 2FOKA 3RYOA 4CGZA 3C1DA 4ZBGA 3R95A 4LD5A 1TNTA 4A6EA 3VODA 3GVAA 4KOWA 2XGXA 1STZA 1TQPA 2Z3KA 2A5YB 1PUAA 4KT5C 2LNBA 1I21A 1RXTA 3V7CA 2Y48A 5G22A 3CXPA 3C7JA 4RGXA 4HOBA 2P7CB 2JPBA 3FHZA 4ENMA 2DPSA 4C2YA 1LRZA 2PLYA 4IJAA 1HSJA 1OYYA 1CF7B 4ZGYB 5LRSA 2HFHA 2WUUA 2YNEA 2DXQA 2VC0A 3HSRA 4U7BA 3EC4A 2RQPA 5D8LB 2QENA 2G3TA 4MFJA 1XEBA 3HRTA 1FZPB 2Q4YA 4PV6A 3F8MA 1BC7C 2DLLA 1FWZA 4UFXA 2GA1A 1R5GA 5KVRA 4C7HA 2WC2A 3MZHA 3DNSA 3RDIA 2QLZA 2IL4A 5FD5A 2GE3A 3TDZC 1ZYRF 4UVBA 2ELHA 1P6RA 5BPDA 2CY2A 1ZGAA 4LFUA 4EVYA 2FBIA 3CJNA 2VXZA 4Y49B 2QVOA 1IICA 3GLXA 3IGRA 4YFNF 1U5TC 2A3SA 2O8XA 3HRSA 3L7WA 2HV2A 5FB2A 1OKRA 4J3GA 1QQIA 1OYWA 1ZG1A 1YLEA 2BYVE 2A6HF 2HYGD 2MLGA 4KVOE 3M7GA 5ICCA 4UXNA 3DSBA 3I0TA 3L2CA 4C2XA 2B58A 1IB1E 2JEVA 3R6SA 1R5HA 1UB9A 2C27A 2IA1A 5E1WA 2HS5A 2O28A 4C2ZA 3HTSB 2RDPA 1W5SA 3M9AA 4AVBA 1G3SA 1NHAA 5D5WB 2PMHA 3FZVA 4Y15A 3E6BA 1TQMA 1EH8A 4KORA 2KIUA 5HS7A 4XNHB 4U9ZA 1BBYA 1ON2A 1LEAA 5ICEA 3QRFF 1IAWA 1B59A 5DEQA 1ZLKA 2D4OA 3E97A 2GWRA 2BEOA 2Z10A 1ZO0A 3TTHA 4UFVA 5IX3A 4LLNA 1LVAA 3AAFA 4MGRA 4Q5SF 2XAFA 3Q5FA 2P5VA