2OZUA

Crystal structure of human myst histone acetyltransferase 3 in complex with acetylcoenzyme a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
253
Chain Sequence
RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQSIKKLSKLTGICPQDITSTLHHLRMLIRREKLIQDHMAKLQLRPVDVDPECLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase MYST3
publication title The crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 253
sequence length 270
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ozuA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2ozuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ozuA02
3GVAA 3MQ0A 2LKPA 4ZH4F 3CO6C 1SMTA 1H9GA 4U88A 1XSDA 3HIFA 4QLCU 2EFPA 1YS7A 1BI3A 1I1SA 2VC1A 2A6HF 4HDVA 4P9FA 1P0HA 4I02A 5FD5A 3GYHX 2XAGA 3B73A 2HKXA 4I09A 3QAHA 2PR1A 2EFQA 3QP5A 1USSA 2DU9A 2TDXA 3RIRA 1IN5A 1IN6A 2VE8A 4AIHA 3R96A 5CVJA 5FLXK 1BI1A 2DQLA 4JK1X 5JHUA 4FHTA 3BDDA 2KKOA 2G7HA 5D4RA 1MDMA 4M9SA 1Z05A 3LD2A 2JZYA 3IKTA 1Y9KA 2QQBA 2CG4A 1XN7A 5CVIA 2JDCA 1TLHB 2K86A 4EVYA 2CQKA 1D3YA 1YLFA 2JT1A 4JQFA 3FYNA 2HQNA 3ZMSA 5H6QA 1BOBA 4DQ2A 2PQ8A 5EEGA 5HOOA 1HKTA 2EWNA 1F9NA 4MEXF 2KCWA 3PZJA 5HH1A 1ZLKA 4WCGA 2DW4A 5DWNA 4LX9A 3FM3A 3IWZA 4M6YA 1TW3A 5DD8A 3GYAA 5F48A 3K1MA 1Q2YA 3F23A 3RKXA 4II9A 2OA4A 2FIAA 2BYVE 6PAXA 3SQNA 3E6CC 1W7PD 1FYMA 5FFZA 4ESBA 4BAYA 4G7HF 2D4OA 3WTSC 1IRGA 5BMZA 1KUXA 4U0YA 4AVAA 5ICFA 4LK0F 4CAWA 1UHWA 3HHGA 3TO9A 3I5UA 2ZJ2A 4E2AA 4UV8A 1H0MA 1WK4A 1Z9UA 2Z5UA 4EJTA 4RGRA 4G94A 2DK5A 4KA4A 1JGSA 4ZYGA 5GCNA 2OBPA 2M8EA 3E6DA 3C7JA 3SXNA 3VFZA 2B58A 1ON0A 3ML6A 3BJ8A 1S7NA 3G3ZA 2Q8KA 5CLSA 2ZMEB 4F6AA 2HQRA 1YO5C 5HDNA 3JSPA 1T39A 1YLEA 1TNTA 4KOSA 3M8EA 1I5ZA 1R5GA 2M45A 3I59A 5JPHA 1GHEA 2DXQA 1K78A 1YREA 1MJ9A 4UVAA 1VTNC 3F8FA 5JI6A 1YVKA 2Q0YA 2DK8A 2NNNA 4AD9A 5L3BA 2HTSA 4R3LA 2DPUA 2I00A 2MC3A 5FVJA 1FSEA 1TIQA 1XGMA 2KIMA 3JAMZ 3BP8A 2FBKA 3EO4A 3E6BA 1U6MA 2CY2A 3J80Z 4L89A 5BQTA 2PJPA 2VBXA 4MJ8A 3P9CA 1FYKA 1HXDA 2RC4A 2IW5A 3MWMA 2FMLA 2MBFA 1RI7A 5AIQA 3ZMUA 2WC2A 4CGZA 2PI0A 2ESNA 2K4BA 4HX8A 1NSLA 1MJBA 4HQMA 4LLNA 4OADA 4EV0A 1ZN2A 4B5PB 3DFGA 1XSXA 1PP7U 1SD5A 1NMTA 3GLXA 3S6HA 1H9TA 4L0YB 4ZYEA 2PLYA 1OYYA 4KOVA 1S5KA 3F21A 3R60A 1Y0UA 4CO8A 2RQPA 1J0RA 2EJRA 1J59A 2OB0A 1Y9WA 3CUOA 3V7RA 1XEBA 1WWXA 3SFZA 4OAEA 3ECOA 3GKRA 1K4JA 4I01A 3QRFF 3P2HA 2IL4A 1LJ9A 5HDGA 2BSWA 3DPLC 2Y48A 1Q2CA 3FX3A 3ZN1A 3KP2A 2ZCWA 3FMSA 3M7GA 4U0VA 1V3FA 1LEAA 1R1TA 2L01A 4CICA 1KUVA 2VBQA 1MGTA 5K1YA 1U2WA 2HYFA 4HV6A 5ILVA 2WWYA 1W7PA 2GXBA 1LQ1A 2BV6A 3T5XA 1J5YA 4HW0A 4XSZF 3IL2A 4HYEA 2HZTA 2GANA 4OINF 1L0OC 4JXRA 4EM0B 3WTXC 2F2EA 4EM2A 5C82A 2FU4A 2A68F 1IXRC 5HDKA 3VB2A 1ZG5A 3N7ZA 3KCCA 3HRSA 3K1NA 5J8CA 3FXQA 4LK1F 3FHZA 1DPUA 1TBXA 1R1VA 3EDPA 4K2EA 2EFWA 1YVOA 4XPKA 4M9ZA 1U3EM 1G6NA 3BJ7A 1Z4RA 1XMKA 1YTYA 4KVME 2CWEA 1W5SA 2LSOA 4PZJA 1KU3A 3E5XA 2PG4A 1FBSA 4MTDA 3EETA 4L0ZB 5IV0A 3QOPA 5LGNA 4Z2YA 4EVIA 1T2KA 3FWEA 1YX0A 1Z4EA 2E1NA 1CF7A 4QBJA 4B5OA 2R3SA 5CVUA 4MY0A 2J5OA 5DCMA 1SFXA 5HS7A 1RXTA 1YW7A 4GXOA 3LAPA 4PGHA 5DUKA 4IXAA 4UV9A 2L3DA 2BEIA 3TQNA 4OIRF 3WTZA 4HV5A 3TFYA 4HOBA 3WU0A 3FXTA 4NHJA 1DDNA 1W4MA 4NF1A 3BROA 3RYPA 4N0BA 4R79A 4OIQF 2L4MA 2JTVA 2D1VA 5CVVA 4PSWA 1KA8A 2GAUA 3V8JA 3SZTA 3V8LA 2XKOA 2OD5A 3GXOA 2Q44A 4YFXF 4LJZF 1REPC 2DLLA 5E18F 4KFCA 4KOTA 2REFA 3E97A 1VKCA 1Q2DA 1BBYA 3IC7A 4IJAA 4A12A 4XBFA 3F6VA 4FT8A 1O3RA 4F7ZA 2HFHA 4YFKF 1M4GA 2GA2A 3RTRA 4O5VA 4A6DA 5LBQA 2PDOA 1ZGAA 1HKQA 2IT0A 5E17F 4PK2A 2AXLA 3RKWA 3FBUA 1O7FA 2F5EA 3MZHA 1X3UA 3SZPA 4KIGA 3D2MA 1FX7A 2QMLA 4HX4A 3T8TA 2A5YB 1T6SA 4LG0A 2QECA 3GZ5A 2B3UA 2YX4A 1C0WA 1KYWA 2G9WA 3K9UA 2RKHA 1BJAA 3JUWA 3G3SA 1WKMA 2WTEA 3WODF 3AAFA 2A3SA 2OQRA 3TT2A 3R95A 2Q04A 2QYOA 1XCBA 3MCZA 2H6CA 4WXCA 4M9XA 1Z1DA 2VONA 3E5QA 2BBYA 1ZGJA 1B9MA 3KZZA 3WGIA 4A0XA 4A0ZA 3GFIA 1TTYA 2CFXA 2COMA 3DV8A 4MQVA 5HS8A 2Z9OA 1FBQA 2R98A 2XKPA 1UFHA 3F8BA 5A2QZ 3SXOA 2LF8A 4M3SA 2NNYA 2VODA 5ILSA 3DR8A 3OWCA 3L7WA 3NE7A 2K4JA 3NEUA 4WXDA 1FYLA 2Z99A 1USTA 2OAZA 3T0YA 5E8IA 3RI4A 3U2RA 1QZYA 2ZW7A 2VOPA 1LDDA 1G3TA 3LA2A 5H84A 2IPQX 2O6GE 4G9YA 2B4DB 2QBYB 2VXZA 4H6UA 1HBXG 2IA1A 2PRBA 1QSMA 1Z7UA 3CXSA 2Z3YA 2FSRA 3REOA 5DUIA 3KE2A 2UXNA 4GS4A 4PCQA 1S7FA 3DNSA 3IKVA 3KP4A 3V8KA 4IF5A 2LDUA 3R9EA 2DTRA 3IRQA 2DPDA 2HQYA 4MHDA 3I64A 1V0CA 4FD7A 4LB6B 1OZPA 3WG9A 5DYMA 1F4KA 2FE3A 1BN5A 2HUZA 1LDJA 4QUSA 5ILUA 1BI0A 4EJVA 2C27A 1U8RA 5L3EA 1P4AA 1SD4A 1QSNA 4ENNA 4ASNA 1IIDA 3L2CA 2EV0A 3NRVA 2BUEA 2HS5A 3T8RA 2CNMA 2D1HA 1K6OA 2DAOA 2XV4S 3TDUC 3WE3A 2HTJA 1P92A 4H0EA 3CUQC 4HF2A 4OMYA 2WV0A 5F47A 2G3TA 3ZQ7A 1J75A 4LMYA 2OZUA 1ON1A 2M5WA 2VE9A 2W25A 3CUQA 3E0KA 1YGHA 1ZRFA 1E17A 2P6EA 3GW2A 3T9YA 1G3YA 5L3CA 5J6XA 1OMIA 3LODA 2KRFA 4WX9A 3RKYA 2B5GA 3J81Z 1XDSA 4ZZLA 4U9ZA 3MZYA 3R0AA 4Y15A 3LA3A 2BEOA 1FOKA 2K02A 4NCZA 3F72A 4I0BA 1YW9A 4KMUX 2K5TA 4BQAA 1ON2A 1F5TA 3K69A 5AONA 2CO5A 4I7HA 2ESHA 4IRHA 4MHGA 3TOBA 4YIFA 4S05A 3HTUA 2QENA 5IB0A 1ZREA 3K1PA 2JEVA 1XDUA 1EH8A 4KIFA 3RPUA 1QNTA 3G8WA 2RN7A 1WI9A 4I49A 4QC6A 1PU9A 3Q5FA 4KZTA 4HBLA 3B8GA 2HOEA 1WWZA 2FEZA 4AG9A 4YFJA 5DCFA 2H09A 1D5VA 1I21A 3UY5A 3BJ6A 4RGXA 4KUBA 5EC4A 4UVCA 4QVTA 2FBHA 1HQCA 2ZW6A 3ZZIA 3TDZC 2A69F 5EEHA 4IVNA 2ZFWA 3FMRA 2V9VA 4EJWA 5E1WA 4LLGF 1P6RA 2UXXA 3R4KA 1XCVA 1MDMB 2NMTA 5C88A 2VN2A 1UFMA 3HSRA 2HWVA 4O6JA 2KIUA 3WGHA 1B6BA 2GE3A 2XIGA 1BIAA 5FFXA 3EFAA 4AVCA 1Z6TA 1U5TC 4YRHA 4CAVA 3HTSB 5H86A 3IRRA 2XVCA 5DWMA 1U5TA 3WTWC 2IP2A 1S29A 5E1ZB 4LGWA 3N97A 1I1GA 5D5VB 4XNHC 3BY6A 4EGYA 3VWEA 1SAXA 4ZBGA 4YIIA 2ZBKA 3P2FA 3S6GA 5LGTA 1KQ8A 5HLGA 4JXQA 5D5UB 4ENMA 4HAMA 1XGNA 4Q48A 5LHHA 2P6TA 4EM1A 4E8OA 4P5OA 4WXHA 1I12A 3DPTA 3GFLA 4OLLA 3D3SA 2Z11A 2Y75A 4M71A 1IN7A 2P7CB 4RGSA 2XAQA 3V7SA 5LEJA 1S3ZA 3GFJA 2GA1A 3QU6A 3W6KB 3W6SA 4ETSA 2FNPA 4MNUA 2XAJA 2P0WA 2P6FA 5FB2A 1KQ9A 1STZA 1XGSA 3GFMA 4XPDC 2Y0MA 2BL1A 3KP6A 4UVBA 3HOTA 4FX4A 2VZZA 2FRHA 1CM0A 1PUEE 2V79A 4CDGA 4WWCA 5L3FA 3ISPA 4ENJA 3IHUA 4KUAA 1G4DA 2FIWA 2LF7A 5BOXA 3K0LA 2OQGA 2VT2A 4U7DA 2UZKA 4M72A 2PBIA 1KYZA 1RZ4A 4KOUA 2VT3A 2FL4A 3I59B 4FD5A 2RNJA 3ZP5A 1K78B 4M85A 3JW4A 1RUNA 2GQQA 2MLGA 2JRTA 1IICA 4BHCA 2VZYA 2CGPA 3I0TA 2QQ9A 4PV6A 4E0AA 1OYWA 1HKSA 1S60A 1S3JA 3ZMVA 3V8IA 1M44A 1L3LA 3E6MA 1ZARA 2FMYA 1EV7A 5F64A 1RUOA 2QM3A 3JAMK 2EUIA 1GXQA 1FT9A 3GX4X 4UBRA 3ZJ0A 3J80K 1TQPA 1Z6RA 2EVNA 4N9HA 2EFNA 1BOAA 2H5MA 3C18A 2YX7A 1DP7P 3TOAA 4PK3A 2EA2A 4BNCA 2IJLA 2M30A 3R6SA 2A6EF 2CW0F 1IRFA 4P9UA 5KK1A 2ETHA 4S04A 2R7DA 4U0WA 3RJPA 2ARHA 3KP7A 2VQYA 2XRNA 4KIBA 3CTAA 1I1DA 3W6XA 4IPAA 1I27A 3WTVC 2OZGA 3H92A 2Z0ZA 4FX0A 3DXJF 2DFIA 3F0AA 1XGOA 2XASA 2ZW4A 3U1DA 1YFHA 4HNYB 4UA3A 4KICA 2W57A 3HHHA 1FP1D 1L0CA 2R1IA 4R1HA 2HKOA 1R22A 2CSOA 3MGDA 3CO7C 2B4BA 2CNSA 1R23A 3FF5A 1AOYA 3R9FA 4HF1A 4HX7A 4Q47A 5HVQC 2XHKA 2MH9A 1O3SA 1FWZA 2L54A 2QVOA 2EB7A 1ZLJA 1CGPA 4UNOA 4B8XA 2FA5A 2G7UA 1WSUA 1KU2A 4B09A 5JFRA 1W7PB 2Q2EA 3ZMZA 4RS2A 1OYIA 1FZPB 1ZH5A 4KUMA 2X7BA 2REEA 4I2OA 1J9IA 2O0YA 3HRUA 4ZYHA 1Z91A 2PMHA 3RYRA 2NAZA 5K5OA 4EGZA 2FS5A 1VHSA 2FQ3A 4UUVA 3QU3A 1YQAA 2D4PA 2JDDA 2MD5A 2O03A 1BO4A 2PR8A 3H3UA 4RS8A 1UB9A 2R7HA 3W91A 4KOWA 1CJWA 5D8LB 1LEBA 2IRFG 1R00A 2XUBA 4AB7A 2YSRA 3WTUC 2E1CA 3IWFA 4RB3C 4UHTA 4AWXB 1YK3A 1B59A 3QP6A 4O3MA 1U6GA 2WPWA 2ISYA 2VBYA 3KEOA 1T0FA 3LQRA 2O61A 1MD0A 2A4NA 2NS0A 1QSRA 3TO7A 1IYLA 3JSOA 1XMAA 1CF7B 2NRAC 5LRRA 4D0PA 3KP3A 3ABTA 3O6BB 3P7NA 1B6AA 5LHIA 2Q4VA 2E7XA 5HLHA 4GYGA 4U7BA 5DCMB 1KUYA 3WU1B 4AG7A 5JVTA 5IT9Z 3ABUA 3HRMA 2B4DA 2ATRA 3T1BA 2VBWA 5EBVA 1SD7A 1IXSB 3K2ZA 4J3GA 3IGRA 3RYOA 2PEXA 1D8KA 1QPMA 3TE4A 4A5NA 2D45A 3M1EA 5KVRA 2EA4A 3M8FA 1FBUA 5L3GA 1XIXA 2FXFA 2FSWA 4GCVA 2J8RA 4NSQA 3GF2A 5ISVA 1K7AA 3BPVA 3R9GA 2UWMA 3Q9SA 4RAZA 2XROA 2K27A 2X0LA 5FO5A 3BOQA 3DEUA 4MEYF 3PFIA 1U78A 3FZVA 3FNCA 1MK4A 2AE6A 1QSTA 4PDKA 4LLLA 4R9MA 4BHPA 1T98A 1NHAA 1MZBA 3BLNA 5KTCA 3GZ6A 1YW8A 5FGMA 1HW1A 2CYYA 3QPTA 5HS9A 5IX3A 3LA7A 3EUHA 2HR3A 2C6YA 1KU7A 3B02A 1T38A 3JTGA 4IF4A 3K9TA 2ZNYA 5FLXZ 2JLMA 1BC8C 2GXGA 3HSEA 3WE2A 2RGVA 3DSBA 1B87A 3WTYC 4CXFA 2P4WA 3M9AA 1B9NA 1HW5A 1S7KA 4KOXA 4WF2A 1YR0A 2E7WA 2J8NA 4R87A 1YS6A 2STTA 4UWJA 1FY7A 5D5WB 4G6QA 1ONVA 3I54A 2QUFA 1QGPA 4ORFA 4H6ZA 3VOEA 1SFEA 3CXPA 1MKMA 5E96A 4ON0A 2BE5F 5J8FA 3EYYA 4I98B 4LB5A 4N9IA 3GWZA 5BPDA 2OZ6A 4KDPA 2W24A 4RI1A 3L00A 3ZMTA 1FC3A 3TO6A 1BI2A 3L09A 1IF1A 2VEZA 2RVCA 4E70A 1G3WA 1OR7A 4UWIA 2J5PA 5A2QK 1G3SA 4NQWA 4EQQA 4JJXA 4R3KA 4LFUA 2P6SA 2XAHA 5HLIA 2JPCA 2EK5A 2F5CA 2IVMA 1O3TA 2ZW5A 2H27A 1XD7A 1S7AA 2X4HA 4KMFA 4Y49C 1KQ0A 5TJJA 1PDNC 3QB8A 3R0JA 4ONUA 4H89A 3C1DA 3E3VA 3I53A 4L9TA 3NQOA 1FPQA 1TQIA 3I71A 3CXQA 3LAJA 2KJBA 3KZYA 3ULQB 1LDKB 4GYIA 4BMHA 2VOOA 4M74A 1J2XA 1A04A 2HGCA 2A07F 1RO5A 2M87A 2L02A 2RDPA 2ZMEA 2ISZA 5TRDA 2HYGD 3GUDA 1QQIA 4F0YA 3DKWA 3BZ6A 2D2WA 2ZXVA 2XAFA 5ED4A 1WRJA 4TV7A 2F5FA 4L8AA 2EV5A 3ZPLA 2FNAA 1M4DA 2MH2A 4RGUA 5KTDA 1XE4A 3LSTA 1IB1E 3ERED 4Y17A 4KVXA 3KLOA 4YGOA 1ODDA 3P9KA 4BYYA 3ELKA 2H94A 4QWQA 5E8GA 3FB3A 1YG2A 2PMUA 4RB0A 2O28A 2FE7A 2PC1A 2F5DA 3LFKA 4IHSA 1QBJA 3COAC 4AVBA 1IN8A 3L9FA 4KLWA 4A5MA 1HSJA 3H4QA 4EJOA 3J7AO 1QSOA 4XLNF 5DV5A 1LNWA 5HMNA 1Y7RA 3CUQB 1I6XA 4LUAA 1UHMA 1OPCA 1FP2A 4PGGA 4Y49B 2ZO4A 2DI3A 5BS6A 2W85A 4PSXA 5LLQA 4NXYA 4B5PA 1XMTA 2B5GB 3BWGA 1LRZA 1RNLA 4MGRA 5DDGA 4I0AA 3RPQA 3J81K 1BM9A 5D6FA 1SD6A 5E20A 4L5JA 4DNCA 4ENKA 2VXKA 4M73A 5D8KB 1RIOH 2HV2A 1B4AA 1Q1HA 1JHHA 3QPHA 4G7ZF 1GXPA 1TW2A 2V1DA 5AIPA 3DF8A 1AWCA 2B3VA 1R5HA 1FSHA 5LHGA 4IHTA 5CNPA 1JE8A 3W6JB 3TCVA 2GZWA 1LVAA 5K5RA 2J8MA 4EMSA 2IA2A 5LRSA 2ELHA 2VBZA 1S7LA 3TKYA 5F49A 1TQMA 2EV6A 1PUAA 3VEPA 2WPXA 4P55A 2RV8A 1IZ1A 1HSTA 1YYVA 2F5IA 5BPIA 5ICGA 3T90A 1D8JA 3U9GA 4ZZDA 2ACJA 4NEXA 5E1XA 3F6OA 3KLNA 4HKFA 3EYIA 1XB4A 3CDHA 4X5KA 2HDCA 1IN4A 2P6GA 1FLIA 2FXAA 3PGPA 2IA0A 3WTTC 1ZYRF 4U5YA 2Q7BA 1GHCA 3LWFA 3F8KA 5KTAA 2OH1A 1BC7C 4GGGA 1JXSA 4MBUA 4NB5A 1UCRA 4AIKA 1R57A 1EH7A 1U5TB 3EQLF 2G3AA 2FF4A 5ERIA 3JTHA 1R7JA 4L9JA 3C3WA 4OOIA 4MQ9F 3I58A 2EFOA 4K30A 4JLYA 4IUSA 2O3FA 3OV8A 3IWGA 4XNHB 4AVPA 2GWRA 3ZMDA 4EJUA 3FXUA 3D8PA 2NYXA 3WGGA 4L18B 4L9NA 2ZXJA 2XGXA 5FD6A 2K7LA 2W84A 3HYIA 3C26A 1P4XA 2Z10A 4BXUA 2PN6A 4BHBA 3ROUA 3SHPA 2CNTA 1QZZA 3F8CA 3Q9VA 4BH9A 3LQQA 4KOYA 1V4RA 1IAWA 4XRFA 3EY5A 4L5IA 3I3GA 4G6DA 4XPDB 3HOSA 3MFKA 1ZG1A 3MEXA 4R57A 3ZN0A 2R7FA 3O3KA 1FNNA 3WR7A 3O2PE 1IW7F 4ESJA 2VC0A 1R1UA 3FMQA 1F1ZA 1O7LA 3RDIA 4HLYA 4CRZB 2PSWA 4HA8A 4KLVA 2HEOA 3FIXA 2GIVA 1O57A 5H20A 3F8NA 1DPRA 5CYVA 2STWA 4CHUA 4CAXA 1P4WA 2B0LA 2O8XA 4OU0A 3R1KA 2DT5A 2V6CA 2H6BA 1SMYF 4ZYDA 3PQKA 2P8TA 2LNBA 5F46A 3TTHA 3F5BA 4KVOE 4QB9A 4XPLA 1R36A 4L9VA 4KN4X 1ZRCA 3P9IA 3SXYA 4MY3A 1KZFA 1IUYA 1B1BA 1BIBA 5D5XB 3KETA 5K5QA 1KU9A 2AS5F 4AIJA 1P2FA 5D6EA 1ZG3A 3R61A 4A2UA 3FM5A 4KYWA 3I9SA 3PQJA 1NE9A 5I0CA 2FT0A 1O3QA 5JR3A 5D4SA 2ZPAA 3ECHA 3KEQA 5ICCA 3KP5A 3E5UA 1P4NA 1N71A 1ULYA 4OMZA 3GY9A 1TNSA 2YR2A 2JSCA 3DP7A 4HLXA 2P5KA 3S6KA 3G73A 1SQHA 1K79A 1W5TA 2QZ8A 1WQ2A 2KJCA 2YU3A 4XSXF 3GEZA 4IRIA 4JWPA 1SFUA 3BPXA 1M1DA 2Z33A 3S6FA 5DEQA 5F6FA 2MLKA 2M1BA 4HF0A 2YPRA 1EH6A 4XLPF 2AJ6A 3TGNA 4HZFA 1XSVA 1MJAA 4IRGA 4KNYA 2JPBA 1KGSA 3D0SA 4MTEA 2DO7A 4KORA 3EXNA 4RB2C 2FOKA 3VODA 1ZHFA 2L4AA 3HUGA 4OIOF 3MAJA 2FCKA 2QBYA 3EC4A 1OKRA 5LGUA 3F3XA 2VI7A 2P5VA 2QWWA 3SHFA 1J4JA 5DD4A 2OU2A 1LB2A 3V4GA 1Z9CA 4R8HA 2Q4YA 1ZAOA 2PFBA 4U9YA 4CRYB 5ICEA 4Y13A 4GO1A 1J7KA 3F22A 1M4IA 5L3DA 4M6XA 3OOPA 3V7CA 3VWDA 3JVNA 5JQ4A 2A61A 2I79A 3DQVC 3HRTA 2DBBA 4FD4A 3H3ZA 4JBAA 5CVRA 5H6RA 3KFWX 2OZHA 2ZKZA 3FXRA 4HNXB 4FD6A 1HW2A 2QIRA 4YFNF 5F1RA 3KKWA 2ZNZA 3HSFA 2Q0OA 3F8MA 2P7VB 4RB1A 1PP8F 4P96A 5CJ9A 4A0YA 3BJAA 1GVJA 3BJOA 1S6LA 3PP9A 3N4MA 1JHFA 4OIPF 1QO0D 3D5LA 2V1UA 2QQAA 4G8XA 4Q4ZF 4A6EA 4RAYA 4HQEA 4LG0B 2DQRA 4KN7X 1S7OA 1IYKA 4CZZA 5IT9K 4HNWB 4MI4A 4Q5SF 1YIOA 3DR6A 4LD5A 4KT5C 2V1XA 2P5LC 1XF8A 3S2WA 2R8VA 1E2XA 2ADUA 3I4PA 4YG2F 2QLZA 1DUXC 4WK8F 2KIFA 3GO5A 1S8NA 2MA3A 1IXCA 5LEKA 5IT3A 4UXNA 4CYDA 4JD6A 3CLOA 3FRMA 3D2PA 2G0BA 2BGCA 1ZRDA 4ESFA 4G7OF 2FBIA 1R58A 3DDDA 4CS0B 3CJNA 4HDUA
chains in the Genus database with same CATH superfamily
3GVAA 3T8WA 3MQ0A 2LKPA 1PYVA 1Y1BA 4ZH4F 3CO6C 1SMTA 3UGDA 1IGBA 5G22A 1H9GA 4U88A 1XSDA 3HIFA 4M6GA 3CCMI 2KDZA 2M34A 3LFUA 1FIPA 2DMNA 2EFPA 4QLCU 3OSFA 3FC3A 1YS7A 1H0ZA 4FBEA 1BI3A 2EPFA 2QQ8A 2WA0A 3ZQGA 1T8IA 3S1MJ 1I1SA 2VC1A 3FK6A 2A6HF 2DA3A 2X6YA 4P9FA 4HDVA 1P0HA 4A39A 4I02A 5EEAA 3TJQA 5EYRA 5FD5A 3Q0VA 3GYHX 2X3TA 1FOXA 2GLFA 2E34A 2XAGA 3B73A 2HKXA 2L9VA 2R7QA 2BHYA 4I09A 1ETWA 5AG5A 3V38A 4P4EA 3QAHA 4P4FA 3PDNA 2NU1I 2PR1A 2EFQA 2MW8A 3QP5A 1USSA 3JRUA 2VQLA 5K7FA 2A05A 2DU9A 2M7AA 2TDXA 5B1BH 1IN5A 3RIRA 3OYDA 2N71A 1IN6A 3D67A 2VE8A 4AIHA 3KX2A 3R96A 5KAFC 2HQ5A 5B1AH 4J01A 5CVJA 2CW7A 5FLXK 1BI1A 2DQLA 4JK1X 5FJ8J 3B35A 3DBLB 5JHUA 1AUGA 4FHTA 2DKVA 3CCVI 4CYQA 2W48A 3BDDA 3HJEA 2M4GA 1Q9BA 2KRCA 1IDYA 2KKOA 2G7HA 4HSTA 3UEJA 3LSKA 1R0RI 5D4RA 3KZWA 1MDMA 4M9SA 1Z05A 3LD2A 2JZYA 2CUEA 3CLQA 1UJ8A 2CQQA 3IKTA 1Y9KA 2QQBA 1XN7A 2CG4A 5CVIA 1Z8LA 2JDCA 2ZEOA 1TLHB 2K86A 4C3JJ 5EG0B 4EVYA 2CMPA 2O8KA 3DEWA 1D3YA 2CQKA 1YLFA 2JT1A 2N17A 2Q51A 2QYVA 2CUJA 3QTLD 4JQFA 4TWEA 2EIJH 1W5CC 4ZC3A 2POKA 3FYNA 2HQNA 3ZMSA 1NG6A 5H6QA 5FROA 1BOBA 4DQ2A 2R5YB 2RB7A 5HLTA 2KMRA 4UCPA 4IAVA 4O23A 1XMBA 2PQ8A 4NDLA 5EEGA 5HOOA 3ZRGA 3IO1A 1HKTA 4XN3A 2EWNA 2GM4A 1CT2I 1F9NA 4MEXF 1QHHD 2KCWA 3PZJA 5HH1A 1ZLKA 1UVGA 4D9JA 4Y33A 5F0CA 2DW4A 3FXMA 5EJCA 3SEQA 4WCGA 4LX9A 3FM3A 3IWZA 4M6YA 1TW3A 5DD8A 3OYBA 3GYAA 4D7NA 5LRJA 5F48A 3K1MA 5IYBJ 4FTHA 1Q2YA 3F23A 4UUSA 3RKXA 4MHNA 4II9A 3KYDB 5KCMA 2OA4A 4UXJA 1HCRA 2FIAA 2BYVE 1SC7A 3SQNA 6PAXA 3E6CC 1W7PD 1FYMA 2CRGA 5FFZA 4ESBA 4BAYA 4G7HF 2D4OA 4NGRA 1ZLHA 2E35A 2ZOGA 3JREA 3WTSC 2NVTJ 2SGEI 1IRGA 2AHQA 5BMZA 4P4DA 4NQWB 5CQEA 1KUXA 4U0YA 1CBXA 4CCJA 2ZXHA 4AVAA 5ICFA 4LK0F 5FKLA 4CAWA 1UHWA 3HHGA 4P4JA 4R8FA 1XC5A 3TO9A 2WCYA 1OBRA 3ISXA 2OCEA 2R7UA 1TWHJ 2IQ6A 2JBJA 3I5UA 2KP6A 4AM3A 2ZEMA 2ZJ2A 3KR5A 4E2AA 4IEJA 4UV8A 1H0MA 4CSWA 4HPQA 4Q38A 4F91B 1WK4A 1Z9UA 2Z5UA 2GLOA 4AMLA 4EJTA 4RGRA 3D7FA 3RCOA 3CMMA 4G94A 3VE5A 2DK5A 4KA4A 1JGSA 4ZYGA 3HC7A 2Y31A 2OBPA 5J40A 1ULNA 1BLLE 2M8EA 2DOFA 1I39A 2VJ5A 2C6GA 4B4CA 3E6DA 2ZEGA 2LOOA 3C7JA 2I8DA 3SXNA 3VFZA 4BE1A 1PTRA 2PJRB 2B58A 1ON0A 1B8IA 4OKOA 2IEKA 4Y3OA 3ML6A 1WKXA 3I9V2 3BJ8A 3SJFA 3S9MA 2HVQA 1S72I 1S7NA 4IHYA 3G3ZA 4M3EA 2Q8KA 3LSMA 5CLSA 2ZMEB 2QQCA 4GFBA 4F6AA 3L2QA 2HQRA 1YO5C 2PMZN 1KONA 5HDNA 4JP0A 3KASA 1VQ9I 2SGDI 3JRDA 3JSPA 1T39A 2BW3B 1YLEA 1LVKA 1TNTA 4KOSA 3HOYJ 4AVZA 2VQCA 3BR0A 4BQQA 3OYFA 1QQ9A 4OIDA 4A3KJ 3M8EA 1I5ZA 1R5GA 2M45A 3I59A 1VQPI 1BW5A 2ELIA 1GHEA 5JPHA 2DXQA 1K78A 4YU9A 3CXLA 4C2TA 1YREA 1MJ9A 4UVAA 1VTNC 3F8FA 5JI6A 1T33A 1Z7LA 1YJWI 1YVKA 2DK8A 2NNNA 3VDUA 4AD9A 2Q0YA 4V2GA 4D7MA 2A20A 2GIZA 5L3BA 3ERMA 4AYBN 4QTRA 5FKMA 1E3OC 3NH5A 3SGBI 2CFOA 2HTSA 4R3LA 2DPUA 2I00A 2MC3A 5FVJA 1R4NB 2BZTA 1FSEA 4KITB 1TIQA 1Z5RA 3WC7A 2N1AB 3B4VC 3FX6A 1FMVA 1XGMA 2KIMA 3JAMZ 4GM5A 1ULKA 3BP8A 2GKVA 4A38A 2FBKA 1ENHA 3E6BA 5J3LA 4KJZA 1FARA 3EO4A 4MFLA 3ZGKA 1U6MA 4XLAA 2L7FP 5K8PA 2CY2A 1HDLA 3J80Z 1A2ZA 4L89A 5BQTA 1VQKI 2N52A 3B3SA 1WPKA 4ZYAA 2PJPA 2JVGA 2VBXA 1YJ9I 3LSPA 4MJ8A 1JT6A 3P9CA 1FYKA 5E3PA 2ID6A 5CBMA 4U87A 4A3JJ 2O7OA 1HXDA 4A3CJ 2RC4A 2IW5A 3QPLA 5AG4A 2IBDA 2ECBA 3W2AA 3MWMA 4BL0B 2FMLA 2MBFA 1RI7A 1R9TJ 4CGLA 1N13A 1CT0I 2PJ6A 2MC4A 1ETKA 5AIQA 3K70D 1OQYA 2E73A 4OC3A 3SZGA 2BY0A 3BCAA 2VKVA 3VH9A 1X3WB 2QEXI 2DA4A 1QZEA 2WC2A 3ZMUA 4XOPA 1FTTA 1NXUA 4B13A 4P10A 4ZJZA 4CGZA 1ETYA 2PI0A 2ESNA 3PFOA 1Z77A 2K4BA 4HX8A 2R5ZA 1NSLA 1MJBA 4HQMA 4LLNA 4OADA 4EV0A 1EKEA 1ZN2A 2M0MA 3LNQA 4B5PB 3DFGA 1MH3A 1GV2A 1XSXA 1PP7U 3QPSA 1SD5A 5KNLA 1WFXA 2Y9YA 1NMTA 3GLXA 5FUVA 3S6HA 1H9TA 1ZK8A 5IV0A 4N4OB 4L0YB 2KMUA 2JA2A 2B7EA 2CQNA 2QGUA 3MKLA 4PJ0C 1D0ZA 4ZYEA 4GDFA 3AL0B 1A5JA 3B2YA 3I1UA 4FWUA 2PLYA 1OYYA 4NC6A 4DBQA 3SGQI 1S5KA 2K9SA 4KOVA 3A02A 3F21A 3KIOA 2YUUA 1D0XA 3R60A 1AMPA 1TF8A 1Y0UA 1CP6A 1LR9A 1WZ2A 4CO8A 2WAEA 3FK7A 4OC1A 2RQPA 1J0RA 1Y1CA 2EJRA 1J59A 2OB0A 2CU7A 1Y9WA 3BT9A 4B10A 3CUOA 3K2AA 3S2HJ 5CCMA 3W3CA 3V7RA 1XEBA 2C1CA 2K85A 2EK9A 4IK2A 1WWXA 1WJAA 3SFZA 3D7GA 3NH4A 4C3IJ 4OAEA 3ECOA 5E3NA 3GKRA 1K4JA 2W7NA 1Z3YA 4I01A 2NU4I 2BVMA 2JA8J 3QRFF 3P2HA 2IL4A 1LJ9A 5EZGA 2V53A 3JCUC 2HI3A 2E1MB 3FISA 5HDGA 2BSWA 2WYRA 3DPLC 2Y48A 3DWLE 4MXUA 4MO7A 1Q2CA 4X3RA 3FX3A 3ZN1A 3KP2A 2ZCWA 3NARA 4A37A 3FMSA 2Y30A 3M7GA 4U0VA 4JX5A 1V3FA 2DT6A 2KRHA 4ZI6A 1SGEI 1LEAA 1R1TA 2L01A 4CICA 1KUVA 2RNGA 3OYAA 2VBQA 1MGTA 5CQGA 1U2WA 2HYFA 4HV6A 5ILVA 5K1YA 3S17J 4A3DJ 3B6CA 2DMPA 3PEIA 2NVXJ 3ZQLA 2WWYA 1RR8C 1MMNA 2ID3A 2XSJC 2R7RA 2QJ8A 1GLNA 1FOYA 4YELA 1POGA 1W7PA 2GXBA 2KLOA 2KMPA 2JUCA 1LQ1A 2BV6A 4WWVA 3T5XA 1J5YA 1LAPA 4HW0A 4XSZF 4DBRA 3IL2A 4A94A 4HYEA 4I99C 2HZTA 2ELKA 3ZOBA 1CPXA 2GANA 4OINF 1L0OC 3C2HA 4X8IA 5GPAA 4JXRA 4EM0B 3WTXC 3IH2A 2F2EA 3GB0A 2HDDA 2P81A 4EM2A 5C82A 5GADJ 2FU4A 2A68F 2XF7A 3MMYB 3D1NI 1IXRC 5HDKA 3VB2A 4BE2A 1ZG5A 3L2UA 2PJBA 1YW4A 1RTQA 4EEFG 2AQEA 2Z3OA 3N7ZA 4ZX9A 1RKTA 2LY9A 2ORVA 3KCCA 3HRSA 1XA6A 3K1NA 2MSYA 2A5WA 1X58A 3FXQA 5J8CA 1AYEA 4LK1F 3FHZA 1TKFA 1DPUA 2NSMA 4I76A 1TBXA 1R1VA 3EDPA 1ITYA 3LMMA 2PMZA 1N25A 1X4OA 2DB6A 4K2EA 2EFWA 1YVOA 4XPKA 4M9ZA 1U3EM 2Y2ZA 4D5CA 1G6NA 1VQOI 3BJ7A 2JA7J 1Z4RA 3PSFA 1XMKA 1RR7A 4MCRA 1YTYA 2AFOA 6CPAA 1UELB 4KVME 3DLAA 2CWEA 2ZC2A 1W5SA 2LSOA 3EUKL 4PZJA 5M5YJ 3QWPA 2L7XA 1KU3A 2G0EA 3E5XA 5LYLA 3CCQI 2PG4A 4B11A 1FBSA 3FBIB 2XB0X 3BC8A 2CW8A 4R6TA 3CMEI 4MFQA 3FHNA 4BEHA 2VKHA 3BR1A 3EETA 4MTDA 4L0ZB 2LTPA 3GTQJ 1XRYA 1XBTA 1BW6A 3HXLA 2AFSA 5FRMA 5J1RA 3H8GA 3PB9X 1N77A 3QOPA 4A3IJ 3SYTA 5LGNA 3JTKA 4Z2YA 4EVIA 3QOEA 3FWEA 1T2KA 1K61A 1YX0A 1Z4EA 2L7ZA 2E1NA 1FTZA 2LFBA 1CF7A 1NK3P 1VHOA 4QBJA 4B5OA 2R3SA 5CVUA 1ZLIA 1WH5A 1VNDA 4MY0A 4DGWB 1XX6A 2OH1A 1XTAA 2VL8A 2J5OA 5DCMA 1SFXA 3DU5A 5HS7A 3OL3A 1RXTA 4UF4A 1IV6A 1YW7A 3BI0A 4GXHA 4GXOA 2FX0A 4BS9A 2AFWA 3KHZA 3H0GJ 3LAPA 3LSJA 4PPZA 4FISA 2JYYA 3VDXA 1HDUA 4K3NA 4PGHA 3VDPA 3WU2C 5DUKA 2LRDA 1D1BA 4IXAA 4UV9A 2L3DA 2BEIA 3TQNA 4OIRF 3WTZA 4NJRA 1G2HA 3K70C 3OIOA 3BG9A 4HV5A 4HOBA 3WU0A 3FXTA 4D5FA 4NHJA 1DDNA 3TFYA 1W4MA 4JOMA 4IL6C 3FJUA 4NF1A 3ABLH 3BROA 3RYPA 4N0BA 2LG4A 2H8RA 4HGUA 4R79A 4OIQF 5D8NA 3SJMA 2VUMJ 2DODA 1K7UA 3I4NJ 2IAIA 2L4MA 3OS0A 3VPRA 4Z65A 2LY1A 2JTVA 1WJEA 2D1VA 1MBFA 4XLFA 5CVVA 4PSWA 3V7ZA 4J00A 1H89C 3KQXA 1KA8A 2GAUA 3V8JA 2OTLI 3SZTA 4XORA 2XKOA 3LSIA 3V8LA 3KL9A 2OD5A 3CF5F 1TURA 2ECCA 3GXOA 1JI8A 2XEIA 2Q44A 4YFXF 4LJZF 1REPC 2DLLA 5E18F 3OSGA 4KFCA 4KOTA 2MG4A 2DEAA 2REFA 3E97A 2VASA 4B48A 2K3PA 1VKCA 4DYRA 1Q2DA 1BBYA 3VYTB 3S1RJ 1SVOA 3IC7A 4IJAA 3MN2A 4IQJA 4A12A 4XBFA 3F6VA 4A3FJ 4FT8A 5K8OA 3AFHA 1O3RA 4F7ZA 3VWBA 2HFHA 4MHPA 4YFKF 3S3NA 4A3LJ 3HM5A 1M4GA 2GA2A 3RTRA 4O5VA 2JWTA 4A6DA 5LBQA 5M5XJ 2PDOA 1ZGAA 1HKQA 4PUSA 1MW7A 2IT0A 4HPSA 5E17F 4PK2A 1ELMP 3Q3SA 2AXLA 4F3QA 3DPUA 1DS2I 3RKWA 3MKWB 3Q0UA 2K5CA 4CA0A 3FBUA 2DTZA 1Y0YA 3OIPA 1Z21A 5DS9A 1MNEA 3KR4A 5EF6A 1O7FA 2VQHA 2HYJA 5D29A 2F5EA 4F8ZA 1SGYI 3DTIA 2KFDA 3MZHA 1LKXA 1X3UA 3SZPA 4KIGA 1LFWA 4A2ZA 1Z2LA 5CCLA 3D2MA 5LFAA 1FX7A 2QMLA 2ME6A 4F0XA 1QHGA 4HX4A 4YIRX 1LR7A 4MIMA 2W1OA 3T8TA 5M5WJ 3W2VA 2HC9A 2A5YB 1T6SA 1OISA 4L5EA 4LG0A 3QNVA 5J47A 2QECA 1JUMA 3GZ5A 4KT6A 2YX4A 1C0WA 2B3UA 2MGQA 2L0KA 1KYWA 3ZQQA 3PNTA 2IS6A 4UXHA 5DM6F 3B3VA 2G9WA 3X2QH 4ZY1A 3K9UA 3CJTB 2RKHA 4FKDA 2KL4A 2UZ3A 1BJAA 3JUWA 4HSRA 3G3SA 2DXIA 5F0HA 1WKMA 1FEXA 5LYDA 4DIQA 2WTEA 3WODF 2F7VA 2CH0A 2X6WA 3AAFA 2B63J 2A3SA 2RFHA 5FLMJ 2OQRA 3TT2A 3R95A 5K7HA 2ORWA 3WABA 3HOXJ 2Q04A 1YRNA 3CMYA 2QYOA 5E3QA 2IGOA 3G71I 4C2ZA 1WJCA 1XCBA 3MCZA 2H6CA 4WXCA 3HUVA 1IJWC 3GTOJ 4M9XA 1Z1DA 3L2VA 3OYHA 3RPUD 3RO0A 1V5FA 2VONA 1OYVI 1F57A 1ZG9A 3E5QA 5JGFA 1X2NA 2BBYA 2PJ8A 4CGNA 1R4MB 1ZGJA 1B9MA 3KZZA 4A0XA 2L9SA 3WGIA 2EO8A 4A0ZA 5I4MA 3GFIA 1MBHA 1TTYA 2CFXA 3CQZJ 2K9MA 2COMA 3DV8A 1X1DA 2ICWG 4MQVA 5HS8A 1IRZA 1LFBA 2XEGA 3S9NA 2HQAA 2Z9OA 1FBQA 2EBIA 4M3DA 3JRGA 2R98A 2XKPA 2YUSA 2LY2A 1ULMA 1UFHA 3IP4B 3RZOJ 1PUFA 3F8BA 5A2QZ 1GDTA 3SXOA 2LF8A 3BTIA 4M3SA 2NNYA 4LG3A 5M3MJ 3G1LA 2OJED 2VODA 5GPCA 5ILSA 4NC8A 3DR8A 3OWCA 3L7WA 3NE7A 2K4JA 2W4SA 3NEUA 4WXDA 2DPSA 5C4XJ 1FYLA 2Z99A 1USTA 2OAZA 2DA1A 4M3GA 3T0YA 1ZKGA 5E8IA 4BY1J 2ODFA 3RI4A 3U2RA 1QZYA 2ZW7A 2VOPA 1JQGA 1MIJA 1LDDA 3PNVA 1G3TA 3LA2A 5H84A 5E3RA 2DPTA 2IPQX 2O6GE 4G9YA 2B4DB 5G20A 2QBYB 3KI9A 2VXZA 4H6UA 3VATA 3DCFA 1HBXG 2O5RA 1ETXA 2IA1A 2JVHA 2IS2A 3KYLA 2PRBA 3D5RC 2ZELA 1QSMA 1YQEA 1LE8B 3OYNA 3KY9A 1Z7UA 3LSHA 4LIVA 3CXSA 1WJBA 3VYSB 4UEZA 2Z3YA 1EA3A 3GTGJ 2FSRA 3REOA 3JRIA 5J1YA 5DUIA 3KE2A 4XONA 2UV1A 1LPQA 2LUYA 2UXNA 4GS4A 1UHSA 4XKCA 4PCQA 4N4NB 1P7IA 1LANA 2FJ1A 1S7FA 1B72A 5KHDA 1V1HA 2YNCC 3TMOA 3DNSA 3G1MA 3IKVA 3KP4A 3V8KA 4IF5A 2GXAA 4BJ6C 1D1CA 4E7SA 2LDUA 2QSFX 2DTRA 3R9EA 2AFMA 2YNCA 3R5BA 3IRQA 1AKHA 4CAFA 3JRCA 2DPDA 2HQYA 4MHDA 2M7BA 2JZMA 5EG0A 4D1QA 4IKFA 4HEA2 3IFEA 2NVUB 3I64A 4JYWA 1V0CA 2IXSA 1X1CA 4FD7A 4LB6B 1XFOA 3A01B 1Z8WA 1OZPA 3WG9A 5GCNA 2XB5A 5DYMA 1F4KA 3D7DA 2ZB9A 2FE3A 1BN5A 2FD5A 2Y9ZA 2HUZA 5E3MA 1LDJA 4QUSA 5ILUA 1BI0A 4EJVA 1Z2IA 4BD9A 3OYEA 2C27A 4LITA 1U8RA 4XNFA 3N5FA 2F48A 5M3FJ 4A31A 5L3EA 3OYIA 1N75A 1P4AA 1Z3XA 1SD4A 4FE4A 3FEEA 3CT9A 1QSNA 1BMOA 4ENNA 4ASNA 1IIDA 3J7YJ 3L2CA 3QYBA 1VQ6I 2EV0A 3NRVA 2VJIA 2BUEA 2HS5A 4CGMA 3T8RA 4IO9F 2CNMA 2CTCA 2D1HA 3H36A 3CDLA 2EWBA 1OJLA 1QVUA 1K6OA 4OIWA 2DAOA 2XV4S 3TDUC 3TW7A 3WE3A 4A69C 3I56I 2GOMA 2HTJA 1XG1A 3GTJJ 1JGGA 1Z7KB 4ZX8A 1P92A 4H0EA 3CUQC 4HF2A 1SGQI 4OMYA 3D7HA 2WV0A 3LSGA 3CP8A 5F47A 2M3AA 1ERDA 2G3TA 3VSLA 3AG3H 3TX8A 3ZQ7A 3OYLA 1J75A 2DOEA 4LMYA 4E7HA 2OZUA 4A3MJ 1R79A 1ON1A 4PFOA 2M5WA 2VE9A 4ZTFA 1JKRC 2R7SA 3OXGA 2W25A 3CUQA 3E0KA 1YGHA 1U0JA 4MCPA 3WG7H 1ZRFA 2VJ4A 1E17A 1I3AA 2P6EA 2AFZA 3H9JA 3F0CA 1VGYA 2XGEA 4ANJA 1UVFA 3HOZJ 2L2OA 3GW2A 4PXCA 2PJAA 3T9YA 1G3YA 1FT7A 5L3CA 2MFZA 1OMIA 5J6XA 2M2EA 3PB4X 3BI1A 4QC6A 1R43A 3LODA 2KRFA 3S14J 3K4KA 4GI3C 4WX9A 3RKYA 3SFIA 2KDOA 2B5GA 3J81Z 3DLJA 1TT5B 3BG5A 3PJRA 3RNZA 2DN0A 1XDSA 1RC9A 2X1EA 5CPRB 4E1PA 2OR4A 1ZO0A 4ZZLA 4U9ZA 3MZYA 3R0AA 4Y15A 5EGOB 2GKRI 3LA3A 2TRTA 2BEOA 2Q4ZA 1GUUA 2X6OA 4C30A 1FOKA 4XLHA 5EDNA 2K02A 4NCZA 3A1YA 1KBFA 2CIJA 1NTCA 1IUFA 3F72A 4I0BA 3TP0A 1TUSA 1YW9A 2SGFI 4KMUX 3D5SC 1TBNA 3UOEA 2K5TA 4BQAA 1ON2A 2M9HA 1F5TA 4NUBA 5BWAB 3K69A 2E2JJ 5AONA 1K6YA 2CO5A 4I7HA 2ESHA 4B43A 5A28A 3D68A 4IRHA 4MHGA 4F9UA 2EZHA 3TOBA 4YIFA 4S05A 1WHUA 3HTUA 2QENA 1LFUP 5IB0A 1ZREA 3K1PA 1OFCX 2JEVA 3OY9A 1XDUA 1H8AC 2WB1N 3BTCA 2HDWA 1EH8A 2JK3A 4KIFA 2BHZA 1QVTA 2ZEFA 3LSRA 4M6IA 3RPUA 2OCCH 1QNTA 3K6GA 3G8WA 3AG2H 3S1QJ 2CWFA 1ZG7A 2RN7A 2K9NA 1WI9A 2VLAA 3VSKA 3HOVJ 3PNYA 4MFDA 2JXDA 4I49A 1MMDA 1PU9A 3Q5FA 4KZTA 4HBLA 2NOJB 4RLFA 2PE3A 3B8GA 3L2RA 2HOEA 1WWZA 2FEZA 2QQEA 2PJ1A 4AG9A 5DCFA 4YFJA 4AXVA 4DZJA 2YS9A 3R5AA 5J1QA 2H09A 1OCRH 2L9RA 1D5VA 3HPHA 1I21A 3UY5A 3BJ6A 4RGXA 2NS8A 3G4SI 1TF9A 4J19A 1SAUA 4KUBA 5EC4A 4UVCA 2BOAA 4A32A 4QVTA 3KPHA 1IW4A 4E1RA 3FH4A 3HOUJ 2E36A 2FBHA 1HQCA 3H5AA 4BBSJ 3E1SA 5HNFA 2ZW6A 3ZZIA 3TDZC 3A0BC 2VL1A 2A69F 3CJQB 5EEHA 4IVNA 2ZFWA 2XAUA 1QMUA 4PXBA 2HOSA 3ZR8X 3JR9A 3FMRA 1PPFI 3OYCA 2VKDA 4UEEA 2V9VA 4EJWA 2ZOFA 5E1WA 4LLGF 3MN8A 1P6RA 2UXXA 4BKXA 3R4KA 1AHDP 1MSEC 1XCVA 3HGYA 1MDMB 3GTPJ 2NMTA 3IEHA 5C88A 1SANA 2QCOA 2VN2A 3HOWJ 4QIWN 1UFMA 3AG4H 2X48A 3HSRA 4SGBI 2HWVA 4O6JA 2M4KA 2KIUA 3RKQA 3OMYA 2AO9A 1YU6C 5FKNA 3WGHA 1B6BA 2GE3A 5IYCJ 2XIGA 1BIAA 4B12A 5FFXA 3EFAA 4XN0A 4OP4A 4AVCA 2KZGA 2W82A 1Z6TA 1LR8A 3S1NJ 3B3CA 1U5TC 2IGNA 4YRHA 1VQ5I 4CAVA 3HTSB 2MYSA 3HKZN 3CC2I 2LB7A 5H86A 2Z2SB 3IRRA 1R3NA 2VKEA 4MHYA 2XVCA 3IWWA 3MVPA 3A0HC 3O8GA 3A9LA 4Q36A 4BJTA 4MLOA 5DWMA 2OVOA 5K8NA 1U5TA 2VRWB 3WTWC 4G1PA 2IP2A 1S29A 2EILH 4LOCA 1Z8TA 5E1ZB 4LGWA 2Z1DA 5IP6A 4UUSB 3N97A 2JA6J 1I1GA 4Z6YA 5D5VB 3BY6A 4XNHC 2LK2A 4EGYA 2IGMA 1SAXA 2HPIA 4MMOA 4ZBGA 3VWEA 4YIIA 3J7ZI 2ZBKA 3P2FA 3S6GA 5LGTA 2PJ2A 1KQ8A 5AG7A 2PRQA 5HLGA 1IG7A 1A6IA 4E7JA 4JXQA 4CAEA 4RAFA 5D5UB 2LLKA 4HAMA 1XGNA 4ENMA 4Q48A 1X1PA 5LHHA 1CT4I 4PJNA 2CQ7A 2P6TA 2X52A 4EM1A 3PBBA 4E8OA 4FUUA 4RN7A 4P5OA 4WXHA 1I12A 5IP7J 2R7VA 2RQQA 7CPAA 1MMGA 3DPTA 1X1AA 4M3FA 3GFLA 4OLLA 3IIBA 9ANTA 3D3SA 1QU3A 3PRTA 4C68A 2Z11A 2Y75A 4M71A 1IN7A 1R49A 2P7CB 4RBOA 4RGSA 4BXFA 2CV0A 1SFOJ 2XAQA 3JRHA 3V7SA 5LEJA 3ZQIA 2WY7Q 4BQNA 3GFJA 4E7KA 2GA1A 1S3ZA 2WUUA 3QU6A 2VXDA 3W6KB 1LFPA 4FCYA 1NSAA 3W6SA 4ETSA 3ZCOA 2FNPA 4MNUA 2P0WA 2XAJA 2V6EA 2P6FA 3M4OJ 5FB2A 2I3CA 1KQ9A 1STZA 1XGSA 3GFMA 4YEJA 2Y0MA 2BL1A 4XPDC 1A36A 1BPMA 2NU3I 4L9MA 3KP6A 1HC8A 4UVBA 2V26A 3HOTA 1ARLA 4FX4A 1CPSA 1U5KA 2FUG2 2VZZA 3CCUI 2FRHA 4IZZA 1CM0A 1V5GA 3HEFA 1PUEE 2V79A 4CDGA 4WWCA 2EH3A 5L3FA 1B8IB 2ARPF 2JW6A 3ISPA 3M07A 2ZEHA 4ENJA 3IHUA 3BQZA 4KUAA 2L5QA 1G59A 1G4DA 2FIWA 2EINH 4ZY2A 2AFXA 4PK4A 2LF7A 5BOXA 3K0LA 2R7WA 2OQGA 4C2XA 2LH9A 2VT2A 4MFZA 1MBGA 1RPWA 3OL4A 3MZ8A 4U7DA 2NU2I 2M5XA 2UZKA 4ZYQA 4M72A 2PBIA 1KYZA 1RZ4A 5GAHJ 1ELLP 4KOUA 2LKXA 1W1WE 2VT3A 2Z16A 3TW6A 4C2UA 3K4JA 3I59B 4XL9A 2KHMA 2RNJA 3OIQA 1OLTA 4XKWA 3ZP5A 1K78B 1HJAI 3MRUA 2WY8Q 4M85A 1Y8FA 4IOAF 2C6CA 5EZHA 2V4JC 3JW4A 5LYIA 1RUNA 3M8JA 4NNJA 3LL7A 2GQQA 4MCSA 3ESWB 2MLGA 9WGAA 2VJJA 2JRTA 4M6HA 1RESA 1IICA 3K4LA 4BHCA 2VZYA 4UIBA 2CGPA 3I0TA 2JN6A 4BBRJ 2VIXA 2QQ9A 4PV6A 4TNUA 4E0AA 1OYWA 2HB6A 4B1RA 1HKSA 4XICA 3OXLA 1S60A 1S3JA 3ZMVA 2WB1A 3SI2A 3S15J 1M44A 4KSAA 3V8IA 1A31A 2HZDA 4CYOA 1L3LA 1NK2P 3E6MA 2ERWA 1ZARA 2DA6A 1EV7A 2FMYA 5F64A 2QM3A 3WHBA 3JAMK 1RUOA 1GXQA 2V1CC 2EUIA 2HU9A 2JA1A 2LBFB 2BXZA 4BXXJ 1M8BA 3BHXA 1FT9A 3GX4X 1S20A 1YTPA 1CQTA 2PIZA 4UBRA 3ZJ0A 3J80K 2NXNB 1TQPA 3L1PA 1Q1VA 3G1OA 2V1CA 1Z6RA 2EVNA 4N9HA 3L2NA 2EFNA 1BOAA 2JMWA 5C3EJ 2H5MA 3C18A 2YX7A 2LR8A 5DTDA 1DP7P 2HOAA 5FRNA 3S16J 4IHMA 5HODA 4JX4A 1YITI 5HVGA 5JM6A 2WV1A 3TOAA 4PK3A 1XMXA 1JUSA 2EA2A 1ZR4A 1G8XA 2IJLA 1D5YA 4BNCA 4X6AJ 3FECA 1ZELA 2M30A 3R6SA 2A6EF 2CW0F 3L2WA 1IRFA 4P9UA 4B6DA 5KK1A 2ETHA 1U8BA 4EWTA 1ZGWA 1IO2A 1Y6IA 2R5ZB 1TWGJ 4S04A 2R7DA 4U0WA 2X85A 1X12A 1V1IA 3RJPA 3HLPA 2ARHA 1OCOH 3KP7A 2VQYA 2XRNA 2NU0I 3C2BA 4KIBA 3CTAA 1I1DA 1Y56A 2ODDA 3W6XA 4IPAA 1I27A 3WTVC 2ZXWH 2OZGA 3H92A 5H2FC 2PJ9A 4FE7A 2R7XA 2Z0ZA 2WGCA 4FX0A 2F5VA 3DXJF 2DFIA 1OCCH 3F0AA 1XGOA 2XASA 3PM1A 2ZW4A 2HVSA 2ZSIB 1X3ZB 1CP7A 3U1DA 1UWYA 4HNTA 3C2GA 1IY5A 3FF3A 3QAYA 4G6TB 4NJQA 4OC4A 1YFHA 3B3TA 3HKZA 2R7TA 2LMDA 3PB6X 2CWHA 4AYBA 1MNDA 4HNYB 4UA3A 4KICA 2W57A 3HHHA 1FP1D 3ABMH 3CMAI 4MRIA 1Y7EA 1L0CA 4NGTA 4CYCA 2R1IA 4R1HA 1VQMI 3CCSI 2CXAA 1FAQA 1TT0A 3H9QA 2IS4A 2OOTA 2HKOA 1R22A 2CSOA 3MGDA 1W3SA 2V8DA 1YSJA 1M8CA 3CO7C 3E59A 2B4BA 3GTMJ 3D66A 2QKLB 2AQFA 2CNSA 2R7OA 1R23A 4OWRB 3FF5A 1FJLA 1AOYA 3R9FA 2BVLA 4HF1A 3V42A 4HX7A 1PCEA 4Q47A 5HVQC 1HOMA 2XHKA 1YOVB 4F55A 2L8EA 2MH9A 1O3SA 1FWZA 2BY2A 3A03A 2L54A 3O8HA 4B6ZA 2QVOA 2VB6A 3ZQCA 2SGQI 2EB7A 1ZLJA 1CGPA 4UNOA 4B8XA 2Z3KA 1X2MA 2FA5A 1TC3C 1YLOA 2G7UA 2CWGA 2UVOA 3ISZA 1WSUA 1KU2A 4B09A 5JFRA 1W7PB 2Q2EA 1IGNA 3ZMZA 1HDDC 2CV2A 2J87A 4RS2A 1OYIA 2K40A 3HBLA 1FZPB 3B3WA 1ZH5A 2V8VA 4KUMA 2X9DA 2EIKH 3F9KA 3B6AA 3OR2C 2X7BA 1N78A 3H0DA 2REEA 4I2OA 3SI1A 4QSHA 1J9IA 1YW6A 3OWTA 3QWLA 2XRCA 2O0YA 1P9GA 3HRUA 4ZYHA 1Z91A 4NC7A 1IOFA 3PSIA 3OYGA 4B3AA 2PMHA 2PVWA 4P45A 3RYRA 4CUGA 3ASNH 2NAZA 5K5OA 3FXJA 4EGZA 2FS5A 1VHSA 3PFYA 2CUZA 2FQ3A 4UUVA 1WGTA 3QU3A 1BUSA 4NBQA 2V8HA 1YQAA 4DYCA 2R4GA 5J4YA 2D4PA 4XQFA 1TIHA 2JDDA 1LUJB 2ZEDA 2V9KA 1FOWA 1Y39A 3R5CA 2Z3LA 5TGTA 1OVOA 2D5VA 2MD5A 2O03A 1BO4A 2PR8A 3H3UA 4Y4RA 3ZQHA 1HA8A 4RS8A 2NVQJ 1UB9A 2CJJA 1FMWA 4KSFA 2R7HA 3IU1A 3W91A 3KEYA 2PJ5A 3PO2J 1MT1A 2BOLA 3UNGC 4KOWA 1CJWA 5D8LB 1LEBA 2IRFG 1R00A 3GIUA 4YWYA 3PUBA 2XUBA 4AB7A 1I3QJ 1VFCA 2YSRA 3CDIA 4C9YA 3WTUC 2E1CA 4XKVA 1T0FC 3M1CA 5IB9A 3IWFA 4BEHB 2C6PA 5G21A 2PJCA 4RB3C 4R7MA 4UHTA 5KAIC 4AWXB 1T08B 1YK3A 2K9HA 1CGII 1B59A 3QP6A 4O3MA 1U6GA 2XDVA 5AG6A 2WPWA 5DS0A 1IV8A 2ISYA 2VBYA 1T0FA 2DFFA 3KEOA 3LQRA 1MD0A 2O61A 1J09A 2KT0A 2A4NA 4UEFA 1U9NA 2NS0A 1QSRA 2IJZA 1YX3A 3TO7A 1IYLA 4PXEA 3JSOA 1XMAA 2X1DA 1CF7B 3HPGA 2NRAC 5LRRA 2XPWA 4D0PA 3KP3A 3ABTA 3GLLA 3O6BB 1B6AA 3P7NA 5GP9A 5LHIA 1IC8A 2Q4VA 5IY5H 3PB8X 2E7XA 5HLHA 3OS2A 4GYGA 3CZ6A 4U7BA 5DCMB 1KUYA 1R6RA 3TBIA 3WU1B 2V77A 4AG7A 2DJNA 2EZKA 5JVTA 5IT9Z 1SGPI 1X10A 2GLJA 3FKJA 4PJMA 4JCVE 2ENZA 3ABUA 3HRMA 2B4DA 4OVOA 2ZXIA 3T1BA 2ATRA 3IUOA 5LRGA 2VBWA 5EBVA 3HG9A 1SD7A 3GBGA 1IXSB 1LE8A 3Q0WA 3K2ZA 3DLLF 5F0FA 4J3GA 3SJEA 1MBKA 1IY7A 4FASD 2PJ4A 3BZCA 1MH4A 3FXKA 2HXIA 1E3HA 3IGRA 3RYOA 4ZGYB 2PEXA 1D8KA 1QPMA 1Z67A 3I55I 1OMTA 3FEDA 4A5NA 3TE4A 3GUXA 3FSXA 1O4XA 2D45A 3M1EA 3PL8A 5KVRA 2EA4A 2CV1A 3M8FA 1FBUA 5L3GA 3HDDA 1XIXA 2FXFA 2CF4A 1Y0NA 2FSWA 1JUPA 3BR6A 4GCVA 2J8RA 4NSQA 2LVSA 3GF2A 4XLCA 3H5NA 3BLYA 5ISVA 3KZIC 1K7AA 3BPVA 3R9GA 2UWMA 3Q9SA 4RAZA 4NGQA 5EMIA 1S7EA 1TWFJ 2XROA 2QA4I 5LYFA 2K27A 2X0LA 5FO5A 3BOQA 3DEUA 5IP9J 5B66C 4A93J 1Z8XA 4MEYF 3PFIA 2E1OA 3I3LA 1SGDI 3E2IA 3IH3A 4EATA 2MABA 1U78A 3FZVA 1JKQC 2R93J 3FNCA 1MK4A 1KMAA 4JZ0A 2AE6A 4LQ6A 2F3CI 1QSTA 4H2KA 4PDKA 4LLLA 4M6VA 2YNDA 4LQGA 4R9MA 4BHPA 1S5LC 1BR4A 1T98A 1NHAA 1MZBA 3BLNA 4RDUA 5KTCA 2HVRA 3GZ6A 2CS3A 2H8WA 2XGDA 1YW8A 3EUHC 5FGMA 1HW1A 2CYYA 3QPTA 5HS9A 1HLVA 5IX3A 3LA7A 1OMUA 2ROWA 4FETA 3K2KA 4ZTJA 2Z3MA 1XS9A 2LKSA 1W0TA 2GKTI 3HUGB 4UIAA 1RFHA 3EUHA 2HR3A 2C6YA 3G2BA 5DWNA 1KU7A 4UY8I 2DF5A 2OPTA 3B02A 1T38A 3JTGA 4IF4A 2QKMB 3NAUA 3K9TA 2NVYJ 2ZNYA 5FLXZ 2JLMA 3DBHB 2EK8A 1BC8C 2GXGA 3JRBA 1P7JA 4M3BA 2GVIA 3HSEA 1Y1WJ 3HB9A 1MMAA 2E5NA 3WE2A 4A95A 2RGVA 3DSBA 1B87A 4XRSG 3OYJA 3FKIJ 1EJ9A 3WTYC 3CPXA 4CXFA 1SEUA 1X4SA 2LYCA 2P4WA 3M9AA 4MPIA 3SEKC 1B9NA 1HW5A 4MFJA 5JVGF 1U9OA 4BBHA 1GT0C 1S7KA 1QRYA 3IJ3A 4UB8C 3FMCA 4KOXA 2JEWA 1XJOA 4WF2A 1YR0A 4UCMA 1VDDA 2E7WA 4A33A 4GRIA 1JKOC 2J8NA 4R87A 4QPOA 1YS6A 3WHCA 2STTA 4UWJA 1MMSA 4BY7J 1FY7A 5D5WB 8CPAA 2KPMA 1ONVA 4G6QA 3I54A 4NGPA 1K7TA 1GVDA 2QUFA 1QGPA 2OC6A 3I4MJ 4H6ZA 4BUPA 4ORFA 2E2HJ 1JJ8C 3FVLA 2M8GX 3CCYA 1YRNB 1JT0A 4I6ZA 3VOEA 1SFEA 3CXPA 1MKMA 4CCMA 2R5YA 2O9LA 5E96A 2P6AC 3CJRB 2HPMA 4ON0A 3CCEI 2BE5F 4BQOA 5J8FA 3HL2A 3EYYA 4I98B 1SGNI 2ZEEA 4LB5A 4C7HA 4N9IA 3GWZA 4P6YA 5BPDA 1NUBA 2OZ6A 1QPIA 1PYTB 4KDPA 4BDZA 5HVFA 2W24A 1UAAA 4RI1A 3L00A 2EIMH 3ZMTA 3UEYA 4AUXA 3DKYA 1FC3A 1OR7C 3TO6A 1BI2A 4AIDA 4RMNA 4H4KC 3RZDJ 3L09A 1IF1A 1PUFB 1H88C 1UHAA 2VEZA 2RVCA 4E70A 2BUSA 1SVLA 4V19K 1G3WA 3RQ4A 1OR7A 3IAS2 3NH8A 1IOIA 4UWIA 2J5PA 3SEZA 4EMEA 5A2QK 3DTKA 1G3SA 4CZCA 2JSPA 1BAVA 4NQWA 4EQQA 3IAM2 4JJXA 4LFUA 3QYFA 1CE3A 4R3KA 2P6SA 2XAHA 2MD0A 3SJGA 3PIOF 5HLIA 2JPCA 1WGCA 3GOXA 2FOWA 1UZCA 2LP0A 2EK5A 1A35A 2F5CA 1WVRA 2IVMA 4RAGA 1O3TA 2H27A 5FLVA 3FSYA 1XD7A 3OVOA 1S7AA 2X4HA 4KMFA 4P4IA 4UFXA 2E19A 1AN1I 4Y49C 1KQ0A 4RM3A 1TWAJ 2PJ7A 5TJJA 3D00A 1BR2A 4ZDLA 1PDNC 3QB8A 3R0JA 1KWMA 4ONUA 4B47A 4H89A 2B8TA 2NS7A 3C1DA 4CCNA 1DS3I 3H5ZA 1GV5A 1F36A 3E3VA 3I53A 4L9TA 2LREA 4A30A 1HEEA 3NQOA 2DMTA 1FPQA 3RSNA 1TQIA 4PJJA 3I71A 3VYUB 4AU7A 4XIDA 1YIJI 3S3MA 1D0YA 2GU2A 3CXQA 3LAJA 2FVGA 1B72B 2PJRA 2KJBA 2ZMEC 3KZYA 4ZY0A 3ULQB 3SI0A 1LDKB 3W6VA 4GYIA 4BMHA 3K7AJ 2VOOA 4M74A 1X1BA 1J2XA 1A04A 2HGCA 4CCLA 2A07F 1FIAA 1RO5A 3J7AY 2M87A 2AFUA 2L02A 2DFEA 3OR1C 2X6XA 2B0UC 2RDPA 2ZMEA 1AKHB 2ISZA 3S8PA 2KCXA 2YNEA 5TRDA 2HYGD 3GUDA 4B3XA 3PBEA 1QQIA 4II2A 4F0YA 2BW3A 3DKWA 1AU7A 3BZ6A 2V9PA 3H35A 2D2WA 2ZXVA 2ELJA 2XAFA 4CYNA 5ED4A 1WRJA 4TV7A 3UR3C 2F5FA 3H3VK 4L8AA 2EV5A 3ZPLA 3CCRI 2FNAA 3KYCB 1W4RA 3CC7I 5GTIC 1QA6A 2MH2A 4RGUA 1M4DA 5KTDA 1XE4A 2BCOA 3LSTA 1IB1E 4XLEA 3ERED 4Y17A 4RA2A 4HG2A 5E3LA 4KVXA 3KLOA 4YGOA 5K8MA 3H5RA 1ORKA 4G12A 3DBRB 3DEEA 4DZPA 2WZNA 2Z3NA 1ODDA 3P9KA 4BYYA 1ARMA 3ELKA 2H94A 4QWQA 5E8GA 3CP2A 2LC2A 4XRSA 3FB3A 5F08A 4OC0A 2ABZA 1YG2A 2DFHA 2PMUA 4RB0A 4KISA 1BA5A 2DIPA 2O28A 2FE7A 1TGSI 2PC1A 2F5DA 3U21A 3MKYB 3MEKA 1HDPA 2VPRA 1LAMA 1T56A 5HXDA 3IH4A 4II3A 4BACA 5J4VA 3LFKA 4IHWA 4IHSA 3BR3A 2XF5A 1QBJA 3COAC 4E6KG 4AVBA 3HGGA 1IN8A 5HQ8A 3L9FA 2J9RA 4KLWA 5F04A 5C4JJ 4A5MA 2NOGA 5A27A 1HSJA 3H4QA 3H1CA 1V5EA 4EJOA 2R0QC 3LOCA 3J7AO 1QSOA 2Y0SN 2X1CA 5DV5A 1LNWA 5FKKA 4XLNF 5HMNA 4XK4A 1Y7RA 3CUQB 2PCUA 3ASOH 1I6XA 2O4HA 4LUAA 2WVJA 3S2DJ 1UHMA 1OPCA 1FP2A 2HOTA 1ACIA 3HZJA 4PGGA 3G6EI 1HF0A 4Y49B 2ZO4A 2DI3A 7WGAA 1TP4A 5BS6A 2W85A 5E79C 1NG7A 4PSXA 5LLQA 3NWTA 4NXYA 1I50J 3AL0C 5IOZA 3OYMA 2KMOA 4B5PA 4V2FA 3BG6A 1XMTA 2B5GB 5IYDJ 1LOKA 3BWGA 5THWA 2TCTA 2DA5A 2PJ3A 1LRZA 1RNLA 4MGRA 5DDGA 3RU0A 3LWUA 2WADA 4I0AA 3RPQA 3J81K 1BM9A 5D6FA 1SD6A 2OV7A 3N05A 5E20A 3BG7A 3QYEA 4L5JA 1JTXA 4DNCA 2QSGX 4ENKA 4P1WA 2VXKA 4OAYA 4Y52J 4A3EJ 3CC4I 5LD2C 1CG2A 1ZQ3P 4M73A 2ENNA 5D8KB 3SDBA 1RIOH 3A4CA 2HV2A 2O53A 1NH3A 1B4AA 1Q1HA 1HEVA 4B44A 1BPNA 1JHHA 3QPHA 4G7ZF 1DGRM 1V55H 4FAIA 2E1MC 5EX0A 1Y0RA 4NGSA 2KIQA 2HXOA 1GXPA 1UUCA 4CGPA 1TW2A 1VIXA 2V1DA 5AIPA 4CH7A 3DF8A 1ZTRA 3K4MA 1AWCA 2B3VA 1R5HA 1FSHA 5HNHA 2DJIA 4CCKA 5LHGA 2JQ7A 4IHTA 1JE8A 5CNPA 3W6JB 1XX5A 2XSDC 1ETQA 3TCVA 2H1LA 1F2PA 2GZWA 1LVAA 2V7FA 5K5RA 1JJ6C 1CGJI 1P9QC 1JWQA 4EMSA 2QPOA 2IA2A 2RAEA 5LRSA 3E7LA 2J8MA 1K83J 2Q1ZB 3FDYA 1KZHA 4BE0A 2ELHA 2VBZA 1SGRI 1S7LA 1VQLI 3TKYA 2LBFA 4BINA 5F49A 5F09A 3ABKH 1TQMA 3BTJA 2EV6A 3IWEA 1PUAA 2EQRA 3VEPA 2WPXA 3RAMA 4P55A 3KGQA 2RV8A 1DU6A 1IZ1A 1HSTA 1YYVA 2KISA 5BPIA 2DYRH 5ICGA 2F5IA 2JBKA 1D8JA 3NE8A 3T90A 4UFWA 3UKGA 4RM2A 3U9GA 4S0HB 4ZZDA 5HI7A 1D1AA 2ACJA 1FYBA 4NEXA 5E1XA 1UG2A 4F9VA 3F6OA 1RKWA 1PJUA 1X19A 3KLNA 4HKFA 3EYIA 5F27A 2VI6A 4NFRA 1XB4A 2KQRA 3CDHA 3JRFA 4X5KA 2HDCA 2XEJA 1IN4A 2P6GA 1FLIA 2QVPA 5GAGJ 1YJNI 2FXAA 3BR2A 3PGPA 3K4NA 2A6TA 5TISC 2G9DA 2IA0A 3WTTC 1ZYRF 2IGKA 2M0CA 2WBMA 4U5YA 2Q7BA 2ZW5A 3OXFA 4RUHA 5JH9A 5FKOA 1GHCA 5LRKA 4XMYA 4ZDOA 3LWFA 3F8KA 5CKTA 5KTAA 3PUFA 2ZFUA 2W00A 2E60A 3DTEA 4GGGA 4X1EA 1BC7C 2KMQA 2QQ0A 2F8HA 1MBJA 2PVVA 1JXSA 4MBUA 2BXYA 4NB5A 2LEOA 3VARA 2E71A 1YE9A 5GTHC 1UCRA 4AIKA 1DP3A 1PVEA 4DYQA 1R57A 4NGNA 1EH7A 3E0JB 3CCLI 1U5TB 3EQLF 2G3AA 2FF4A 5ERIA 5J1UA 3JTHA 2IS1A 4JYKA 2GBYA 1R7JA 4L9JA 3C3WA 4OOIA 1H8LA 1SVMA 4MQ9F 3I58A 2DCEA 2EFOA 4IQ4A 2V1NA 4K30A 2GREA 4JLYA 4OC2A 4IUSA 2O3FA 3FIWA 4MFEA 1K4SA 3FXOA 4UB6C 3OV8A 3IWGA 4W1UA 4XNHB 3S32A 2GWRA 4AVPA 3ZMDA 3AG1H 2KZVA 2Z3PA 4E7LA 4EJUA 2EBJA 1TZLA 1W0UA 3MKZA 3FXUA 4HNUA 4B14A 2F4IA 1FNOA 2NYXA 3D8PA 3WGGA 4L18B 4L9NA 2ZJQF 1JKPC 2BO9A 3A2KA 2ZXJA 2XGXA 5FD6A 2K7LA 2W84A 3HYIA 4HNVA 3C26A 1P4XA 2Z10A 5AGEA 2RIJA 1K7VA 2Y0SA 2K3FA 3VYRB 2CUFA 4BXUA 1Z0XA 2PN6A 2WAQN 4BU2A 4BHBA 1VHEA 1APLC 1PTQA 3BQYA 3ROUA 3BJIA 4FD5A 3SHPA 2CNTA 3AKZA 3EPZA 1QZZA 3F8CA 3Q9VA 4PJLA 4CCOA 4BH9A 1YMEA 3LQQA 1VQ7I 1V4RA 2E5ZA 1IAWA 4XRFA 4KOYA 1WCMJ 4XR6A 5F1JA 3EY5A 5EX3A 4L5IA 3TC8A 1WJFA 5JLWA 3I3GA 4G6DA 4XPDB 4KSIA 3HOSA 3MFKA 3PB7X 1ZG1A 3MEXA 2NYQA 4R57A 4A3GJ 3ZN0A 4A3BJ 2QQDA 2R7FA 3O3KA 2ZJRF 2XGCA 5JLXA 3BG3A 3CPAA 1FNNA 1CX8A 3O2PE 3SJXA 1IW7F 3WR7A 4XKBA 2VC0A 2JJ7A 4ESJA 1R1UA 3FMQA 1F1ZA 1O7LA 1VI0A 3RDIA 4HLYA 4CRZB 1BJZA 3B7IA 5HVHA 4KS9A 2PSWA 4HA8A 3GMEA 4OC5A 4KLVA 3KQZA 2QSHX 1IDZA 2K9QA 2HEOA 1P9ZA 4BDYA 3FIXA 3HH2C 1R71A 2GIVA 1O57A 1WGXA 1TBRR 2DMUA 5H20A 3S9LA 5ELYA 3F8NA 1DPRA 5CYVA 1UMQA 4UCNA 2STWA 4CHUA 2R7ZJ 3RZAA 1P4WA 2B0LA 1F43A 4CAXA 4BGDA 2O8XA 3KHXA 4OU0A 3R1KA 1Y8RB 2DT5A 4DJAA 2V6CA 4DW6A 3CCJI 2H6BA 3DDDA 3LACA 1EF4A 2XPVA 1SMYF 1M4LA 1X74A 4ZYDA 3PQKA 2P8TA 1GYTA 2J9AA 2LNBA 2CJSC 5F46A 3LMSA 2ZJPF 3TTHA 2COBA 1YI2I 3F5BA 4KVOE 4QB9A 3BXMA 2AXTC 3BR5A 4XPLA 2CTBA 1TKJA 4WP4A 3K4CA 1R36A 2HNHA 2X51A 5FUXA 1DU0A 4L9VA 4KN4X 3GLJA 1ZRCA 4JX6A 1E0EA 5IPAA 3P9IA 1IU8A 3SXYA 2R92J 3DGVA 4MY3A 3GZNB 1KZFA 1IUYA 1B1BA 3K10A 4E4HA 4XRMA 1BIBA 5D5XB 3KETA 5K5QA 1WH7A 1KU9A 2WAFA 1XPXA 2AS5F 1HDQA 4MFKA 4AIJA 1P2FA 3P5JA 4DUKA 2EZLA 5D6EA 1ZG3A 3R61A 4A2UA 2VPLA 1Q7LA 1E3PA 4MFPA 1VF9A 3FM5A 1W36D 4KYWA 3I9SA 2I5UA 4IX7A 2DA2A 1R5ID 2E5RA 4A24A 2RREA 5GAEJ 3PQJA 3RQIA 1WJ5A 1NE9A 3NA6A 5I0CA 2XRLA 2FT0A 1O3QA 3IC1A 4F92B 5JR3A 5D4SA 1VQ4I 3ECHA 1ETOA 3KEQA 2ZPAA 3TP3A 5ICCA 4CGOA 2XPUA 3KP5A 2H1KA 4X0GA 4IHVA 3WC6A 3E5UA 1TXRA 4DOZA 1N71A 1P4NA 4P4BA 1ULYA 2F6CA 4HRIA 4OMZA 1TBOA 1YHQI 4RLQA 3GY9A 1TL8A 1TNSA 5JHFA 2E2IJ 2YR2A 2JSCA 3FBNB 4IOCF 1WJDA 3DP7A 4HLXA 1VQNI 2P5KA 1OCTC 1ZR2A 2GFQA 3RBUA 3S6KA 3G73A 1SQHA 1RRJA 2QF7A 4ONWA 4DJLA 1K79A 1W5TA 1KBEA 3H8EA 3H8FA 3BTLA 1ZG8A 2QZ8A 1OCPA 2BY1A 2I10A 1WQ2A 2KJCA 2PIYA 2YU3A 1PJRA 4XSXF 1TKHA 2B9SA 3GEZA 4IRIA 4CYCB 4JWPA 1SFUA 3BPXA 1M1DA 1DQUA 2Z33A 3S6FA 5DEQA 4QPQA 5F6FA 4CPAA 2MLKA 2YQPA 5DM7F 2M1BA 4Y7NJ 2L7MP 4HF0A 2ANPA 2YPRA 2JRMA 1A6QA 1SFKA 4C2YA 1EH6A 3SDGA 4XLPF 2AJ6A 3TGNA 2DT7B 3PFEA 1WI3A 4HZFA 1XSVA 5DAEA 1MJAA 1TBQR 4MCQA 4IRGA 4W9YA 3CZXA 4KNYA 1VZ0A 2EZIA 2OD1A 2JPBA 1KGSA 3D0SA 4MTEA 4ITVA 1Y8QB 5G1ZA 2DO7A 2XF6A 3EXNA 4RB2C 2FOKA 4KORA 3VODA 1ZHFA 2L4AA 3HUGA 3UFFA 3NWSA 2DYSH 3MAJA 4OIOF 3UGIA 1XBUA 3ONQA 1MNMC 4XOTA 2Q2EB 2FCKA 2QBYA 4F93B 3EC4A 2DA7A 3QODA 4MHZA 1OKRA 4BJ5C 2N8GA 3F3XA 5LGUA 1VQ8I 2VI7A 2P5VA 2QWWA 3SHFA 2WSAA 5E3OA 4WJBA 1J4JA 1Y1VJ 2WAQA 1DE4C 5DD4A 2OU2A 1LB2A 2UUZA 3CD6I 2XEFA 3V4GA 1Z9CA 4R8HA 2Q4YA 5FUWA 1YX5A 3D4UA 4NGMA 1WTJA 4OAZA 2W0TA 3NFZA 1IRXA 3JRAA 3CDXA 1ZAOA 2PFBA 4U9YA 3K4BA 4CRYB 4CYPA 1UG0A 5ICEA 4Y13A 3BZKA 4GO1A 1J7KA 4UFVA 3F22A 1M4IA 5K7ZA 3H9GA 5L3DA 4M6XA 3PIPF 3U1KA 2GOXB 3OOPA 3V7CA 1AA7A 3VWDA 4C2MJ 2BY3A 2XC7A 3JVNA 1F2OA 5JQ4A 3ZXSA 2L7KA 4R76A 2A61A 1BL0A 2I79A 2Q7SA 2DDAA 1V54H 1MBEA 2FQ4A 3DQVC 3HRTA 4E7ZA 2DBBA 3IV5A 2LD5A 3H3ZA 1TOTA 2Y69H 1XOVA 4FD4A 4Q7AA 3A01A 2DMQA 5C44J 4JBAA 5CVRA 5H6RA 2OTJI 3R5DA 5IOYA 5JHWC 3KFWX 1K4TA 1PCAA 3GTKJ 2VQGA 4IHXA 3OL0A 5FUYA 2OZHA 2ZKZA 3FXRA 4YRVA 1I6HJ 4HNXB 4FD6A 3IU2A 5CPAA 1HW2A 2OF7A 2QIRA 4YFNF 4F52A 5F1RA 3KKWA 2ZNZA 3FXLA 2K9LA 3TEDA 3HSFA 3BCBA 3S3OA 1CHOI 1ETVA 2Q0OA 3F8MA 2FL4A 2P7VB 4RB1A 1PP8F 3GCMA 4P96A 5CJ9A 2SGPI 2V8GA 4A0YA 3BJAA 3W2WA 1GVJA 2DOAA 3BJOA 2DDBA 1S6LA 5B5EC 3N4MA 1JHFA 4LIUA 3UGLA 3PP9A 4C7IA 1OCZH 1CSOI 4XM3A 2L9NA 1X4PA 4OIPF 1BR1A 4X2TA 3EUAA 3OYKA 2PJ0A 1QO0D 3D5LA 4E7IA 2V1UA 2QQAA 4G8XA 4Q4ZF 4FQGA 4PQAA 1S9HA 3DU6A 4AC0A 4A6EA 4RAYA 4HQEA 2CQXA 2F4MB 3MD2A 1JTYA 4C3HJ 4LG0B 2DQRA 2ME0A 2OUMA 2ZEPA 4KN7X 3OOUA 1S7OA 3PO3J 1IYKA 3CF2A 1HPTA 4CZZA 5IT9K 2Q43A 3GTLJ 4HNWB 2ZSHB 4UUTA 4Q5SF 1YIOA 3DR6A 4MI4A 4LD5A 1TWCJ 1M1EB 5BNGA 4KT5C 2YU9J 2V1XA 4PXDA 2P5LC 1T95A 1RETA 3S2WA 1XF8A 1E2XA 2ADUA 3CESA 2R8VA 3I4PA 2YGWA 3S93A 4YG2F 2QLZA 1DTDA 3M3YJ 3QQAA 4PFPA 4W97A 4WK8F 4ABZA 1DUXC 2KIFA 3WC5A 4DYOA 3GO5A 4OMEA 1S8NA 2MA3A 2PX9A 3TL4X 1LCPA 2F4OB 1W36C 1IY6A 4UXIA 1IXCA 4ZDPA 5B3SH 5LEKA 5IT3A 1MSFC 1EE3P 3DKXA 2JUGA 4UXNA 4CYDA 3CLOA 3FRMA 3D2PA 1DGWY 2FNFX 2ZENA 4JD6A 3WT4A 5EGOA 2JA5J 4EFDA 2G0BA 2BGCA 4P44A 1ZRDA 4ESFA 2IMOA 4G7OF 2FBIA 1R58A 3ZQFA 4CS0B 3CJNA 3OS1A 4HDUA
chains in the Genus database with same CATH topology
3GVAA 3MQ0A 2LKPA 4ZH4F 3CO6C 1SMTA 5G22A 1H9GA 4U88A 1XSDA 3HIFA 4QLCU 2EFPA 1YS7A 1BI3A 1I1SA 2VC1A 2A6HF 4HDVA 4P9FA 1P0HA 4I02A 5FD5A 3GYHX 2XAGA 3B73A 2HKXA 4I09A 5AG5A 3QAHA 2PR1A 2EFQA 3QP5A 1USSA 2DU9A 2TDXA 3RIRA 1IN5A 1IN6A 2VE8A 4AIHA 3R96A 5CVJA 5FLXK 1BI1A 2DQLA 4JK1X 5JHUA 4FHTA 4CYQA 3BDDA 2KKOA 2G7HA 5D4RA 1MDMA 4M9SA 1Z05A 3LD2A 2JZYA 3IKTA 1Y9KA 2QQBA 2CG4A 1XN7A 5CVIA 2JDCA 1TLHB 2K86A 4EVYA 2CQKA 1D3YA 1YLFA 2JT1A 4JQFA 3FYNA 2HQNA 3ZMSA 5H6QA 1BOBA 4DQ2A 4UCPA 2PQ8A 5EEGA 5HOOA 1HKTA 2EWNA 1F9NA 4MEXF 2KCWA 3PZJA 5HH1A 1ZLKA 4WCGA 2DW4A 5DWNA 4LX9A 3FM3A 3IWZA 4M6YA 1TW3A 5DD8A 3GYAA 5F48A 3K1MA 1Q2YA 3F23A 3RKXA 4II9A 2OA4A 2FIAA 2BYVE 6PAXA 3SQNA 3E6CC 1W7PD 1FYMA 5FFZA 4ESBA 4BAYA 4G7HF 2D4OA 3WTSC 1IRGA 5BMZA 1KUXA 4U0YA 4AVAA 5ICFA 4LK0F 4CAWA 1UHWA 3HHGA 3TO9A 3I5UA 2ZJ2A 4E2AA 4UV8A 1H0MA 4Q38A 1WK4A 1Z9UA 2Z5UA 4EJTA 4RGRA 4G94A 2DK5A 4KA4A 1JGSA 4ZYGA 5GCNA 2OBPA 2M8EA 3E6DA 3C7JA 3SXNA 3VFZA 2B58A 1ON0A 3ML6A 3BJ8A 1S7NA 3G3ZA 2Q8KA 5CLSA 2ZMEB 4F6AA 2HQRA 1YO5C 5HDNA 3JSPA 1T39A 1YLEA 1TNTA 4KOSA 3M8EA 1I5ZA 1R5GA 2M45A 3I59A 5JPHA 1GHEA 2DXQA 1K78A 1YREA 1MJ9A 4UVAA 1VTNC 3F8FA 5JI6A 1YVKA 2Q0YA 2DK8A 2NNNA 4AD9A 5L3BA 2HTSA 4R3LA 2DPUA 2I00A 2MC3A 5FVJA 1FSEA 1TIQA 1XGMA 2KIMA 3JAMZ 3BP8A 2FBKA 3EO4A 3E6BA 4MFLA 1U6MA 2CY2A 3J80Z 4L89A 5BQTA 2PJPA 2VBXA 4MJ8A 3P9CA 1FYKA 1HXDA 2RC4A 2IW5A 5AG4A 3MWMA 2FMLA 2MBFA 1RI7A 4CGLA 5AIQA 3ZMUA 2WC2A 4B13A 4CGZA 2PI0A 2ESNA 2K4BA 4HX8A 1NSLA 1MJBA 4HQMA