2OZUA

Crystal structure of human myst histone acetyltransferase 3 in complex with acetylcoenzyme a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
253
Chain Sequence
RCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQSIKKLSKLTGICPQDITSTLHHLRMLIRREKLIQDHMAKLQLRPVDVDPECLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone acetyltransferase MYST3
publication title The crystal structure of human MYST histone acetyltransferase 3 in complex with acetylcoenzyme A
rcsb
source organism Homo sapiens
total genus 78
structure length 253
sequence length 270
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ozuA03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 2ozuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ozuA02
4RGRA 5ICCA 4AVCA 2UXXA 4NHJA 2HR3A 1S7KA 2AXLA 4NQWA 1O57A 1MK4A 3VFZA 3TDZC 5AIQA 3M8FA 4ENNA 1XMAA 2LNBA 4XLPF 3DQVC 4JLYA 2ZW6A 5JVTA 5BQTA 2XVCA 4HOBA 4F0YA 1DUXC 1FPQA 4EM2A 3KP4A 3S2WA 4FD7A 1ZH5A 3R0JA 5ED4A 1Q2CA 1LRZA 1XIXA 2VI7A 1KUYA 2Y75A 2FNPA 1Y7RA 3VOEA 2M30A 2FMLA 2NYXA 1SD4A 5CVRA 2CO5A 3IL2A 1TQIA 3WG9A 2Q0YA 4FHTA 4M9ZA 2PMUA 4U5YA 3EYYA 1LDKB 4UWJA 3L9FA 3GZ6A 1E17A 2WC2A 2O6GE 3P9KA 2JDCA 1OMIA 1HKTA 1R1VA 3D2MA 2G9WA 2Z33A 1Z05A 4IPAA 1ZRFA 2UZKA 4E70A 3MZHA 1O3TA 3PP9A 3IGRA 3HIFA 2B4DB 4CGZA 3SXYA 1LNWA 2VOOA 2QVOA 1I21A 5E1XA 1U6MA 2PC1A 1OYIA 3QOPA 3EYIA 3SXOA 1I1GA 5CVVA 3OOPA 3S6KA 4UUVA 2PQ8A 3KP6A 1XGMA 5C82A 3CUQC 3B02A 4HAMA 2PSWA 2B5GB 5K5QA 5CVUA 1S7OA 4KVOE 4L9VA 1KQ8A 1X3UA 2BSWA 4HV6A 4EJOA 2NAZA 4B09A 4QUSA 1AOYA 1QSNA 2B5GA 1W7PB 3WTZA 2HQNA 2BE5F 4A12A 1Z91A 2XIGA 1HKQA 2F2EA 1SQHA 4I0AA 3U9GA 2H6CA 3R95A 4HX8A 3ZJ0A 3ABUA 5EC4A 1FLIA 3TOAA 1N71A 3F8BA 5HDGA 3N4MA 4R87A 2FIAA 3GX4X 3VEPA 3MFKA 4AD9A 3F8KA 4CXFA 1IN7A 3PQKA 2VC1A 1B6AA 5JFRA 2RQPA 2FL4A 3WU0A 1FBSA 3ISPA 3GW2A 1G4DA 5LBQA 4KMFA 3DPTA 5H86A 3IC7A 4XBFA 2G7HA 5ICGA 2IT0A 3EXNA 2QLZA 2ETHA 1IB1E 1I1SA 3P2HA 3N7ZA 4KNYA 3FIXA 2L4MA 3EC4A 4KN7X 1AWCA 4IF5A 5AIPA 3K9TA 4HW0A 3MGDA 4B8XA 3WTSC 5LEKA 4L0ZB 3WTXC 2ZXJA 3L09A 1U5TC 2O0YA 4I2OA 4G94A 2XRNA 2CY2A 2P7VB 2REEA 1ZGAA 4BYYA 3EDPA 2ZNZA 3W6JB 3DDDA 1HBXG 4JK1X 4MTDA 1TIQA 2JLMA 3MCZA 2PRBA 4P55A 5IT9K 1QSOA 4JD6A 1K78B 5HH1A 2OD5A 4U9YA 1OYYA 1T2KA 3KP2A 4MJ8A 1LDDA 2H6BA 3O2PE 3ZP5A 3BJAA 2ZJ2A 3TDUC 2G3AA 5D5VB 2V1DA 3BP8A 1YQAA 2QM3A 3ECOA 4Y49B 2Y48A 1F9NA 4KUBA 2M45A 2Z10A 2DXQA 1KA8A 3EFAA 3T90A 3E6BA 4XNHC 5JQ4A 1SMTA 2R3SA 4A5MA 2M5WA 3GF2A 3RKXA 4IJAA 5C88A 2J5OA 2JRTA 2LF8A 3C7JA 1IYLA 2QQAA 1XN7A 3ZQ7A 1XSDA 4IHTA 4PCQA 3T8TA 4PGHA 2NS0A 5DD4A 1T0FA 1D5VA 2IA1A 2W25A 3KZZA 4G6DA 3W6SA 4YFKF 3R9EA 1ZG1A 2PR1A 4RS2A 3D8PA 5EEGA 5L3EA 1KYZA 3V7RA 1HQCA 2V6CA 3B73A 3SHPA 1RIOH 2RDPA 1IXRC 2DPDA 2ELHA 2VONA 3E5QA 1XB4A 5DUKA 1CM0A 1T6SA 2EV6A 4DNCA 1MDMA 1UCRA 4D0PA 2R7DA 4WXCA 3WE2A 1P4WA 6PAXA 4U0YA 3I54A 2QECA 5ILSA 2QQBA 4ZH4F 3GEZA 3FYNA 1XGSA 2IVMA 2P5LC 3VWEA 1V3FA 2CNMA 1K7AA 2GA1A 1MJAA 1Z1DA 2H94A 4ORFA 3WR7A 3F21A 1KGSA 5CNPA 2J5PA 1QNTA 3IWFA 5ICEA 4MTEA 3I58A 1DP7P 3SFZA 2D4OA 3W6KB 3FF5A 4ENMA 5K1YA 1YS7A 4IRGA 1CGPA 1CF7B 3S6FA 2MH9A 1YIOA 2JTVA 2CYYA 5DV5A 1B4AA 2R8VA 1CF7A 3K1PA 3I64A 4E2AA 3OV8A 4HLXA 2ADUA 3NRVA 4BHPA 5E8GA 4AWXB 1O3RA 1FYMA 2HZTA 2KRFA 3M7GA 2FBKA 2R98A 4WF2A 4R79A 3EO4A 2DLLA 3CXQA 1QSTA 4P5OA 3FZVA 4M6XA 5L3GA 3NEUA 2MLKA 3KP3A 3T8RA 3JTHA 5FFXA 5F46A 3WE3A 4FD6A 1Z6RA 2EFOA 5DEQA 1EH8A 2L01A 3BWGA 2UWMA 2CFXA 2WV0A 5KTCA 2GWRA 3PZJA 3ZN1A 2ZW7A 2ZW4A 1I6XA 1I5ZA 1RUOA 1S7AA 5BPIA 3ZMVA 3G73A 1BI0A 3HOSA 4LUAA 2GAUA 5F47A 2H5MA 2K5TA 3BROA 1Z9UA 4ZBGA 3IRQA 1M1DA 4KVME 3RJPA 4AVPA 4BNCA 4JXRA 1IW7F 1XGOA 3E3VA 3RYRA 1BJAA 1EV7A 3I0TA 3ECHA 2O3FA 3ZMSA 4FD4A 1M4DA 3KZYA 5J8CA 1IN8A 4HNYB 3LA7A 2L3DA 5H6QA 4GS4A 3F0AA 1F5TA 2MLGA 2HUZA 2XAGA 2QWWA 4EMSA 3DKWA 2CGPA 2VOPA 4K30A 2Q0OA 2PI0A 1B59A 2G0BA 1DPRA 1WWXA 5LHGA 3DR6A 2VBZA 4YFJA 2OZHA 2W85A 2E1CA 1RXTA 4P9FA 2IL4A 2D1HA 3V7SA 2BL1A 3DNSA 1LEBA 2VBXA 3JSPA 2BV6A 2LDUA 3R9GA 4UV8A 3IRRA 2M87A 4I0BA 1G3SA 3E6DA 2NMTA 4KOXA 4I98B 5DUIA 1FX7A 4ENKA 1P4AA 1Y9WA 4KOUA 2HQRA 2K7LA 1XF8A 4AVAA 1QBJA 4A0XA 2P6FA 3M9AA 2OU2A 5D4RA 4OIPF 4MI4A 1P4XA 2FQ3A 2XUBA 3ZMDA 3HRMA 3GFLA 1R57A 3V4GA 4O3MA 1ZYRF 4LB5A 3FRMA 1RO5A 1QSRA 2YX7A 3ML6A 1FBQA 4KIGA 4MNUA 4MBUA 1ZREA 2VN2A 1R7JA 5F6FA 1UFMA 3R4KA 2KCWA 2IJLA 5JR3A 3CDHA 4J3GA 3KETA 2ZPAA 5FD5A 5KTDA 4LLNA 3RYPA 2V1XA 3FMQA 1Y0UA 1H9GA 2DK8A 5CVJA 5HS8A 2GXBA 5CYVA 1SFEA 5E8IA 2Z9OA 1SD7A 1BIBA 3KLOA 1W5TA 1PUAA 3B8GA 2EB7A 2FMYA 1LB2A 2EWNA 2NNNA 5DWNA 4AIJA 2JT1A 1T38A 1WKMA 3MEXA 4AG7A 2EFWA 2EV0A 4MHGA 4X5KA 2BBYA 2Z99A 2ZO4A 1KQ9A 1TQPA 2YPRA 4CYDA 5DCMA 2ZXVA 2FOKA 3GLXA 4UVBA 1WQ2A 3JUWA 1S7NA 2IA0A 4R3KA 4ON0A 2VT3A 1MJBA 3GFIA 5E1WA 4EGZA 2HQYA 1MKMA 1USTA 4ASNA 5HDKA 1YREA 3LFKA 5L3FA 4H6ZA 1J9IA 1B87A 1WK4A 1R22A 2FE3A 1F4KA 4ESBA 4CRZB 3D2PA 1EH7A 1XDUA 1RZ4A 3CO6C 4LFUA 4H6UA 4CAXA 1K79A 1YLFA 4QBJA 2OB0A 2A6HF 4WWCA 1R00A 4ESFA 1BC8C 3KCCA 1JHFA 2B0LA 3VODA 2DK5A 3SXNA 3F3XA 2DQRA 3H3UA 1S5KA 4JQFA 3ZPLA 1BM9A 2FT0A 2HOEA 2OBPA 1Q2YA 2KJBA 3CXPA 3WTTC 1I1DA 3C18A 2PMHA 3CUQB 3AAFA 2MBFA 2BEOA 2ESHA 1M44A 3I5UA 4CAWA 1IXCA 2OQRA 4NF1A 1BC7C 3T0YA 4F6AA 3DFGA 3CUQA 3I3GA 2WPWA 2PJPA 1V4RA 4A0ZA 3HTUA 3QPHA 4LGWA 3FXQA 4M6YA 4EGYA 4FX0A 3U1DA 3JTGA 1W5SA 3PQJA 1ON2A 4R3LA 2PDOA 4RGSA 5HLIA 2AE6A 5D6EA 3WTWC 3K69A 1WWZA 4U0VA 1PP7U 5I0CA 2B4DA 2L4AA 3KLNA 3MWMA 4Q5SF 1BI3A 3FMSA 1OYWA 2MC3A 4WCGA 4R57A 1YVKA 1XSXA 4RB1A 3KP7A 3J81Z 2R7HA 5J8FA 3BPXA 2C27A 5KVRA 2Z3YA 2REFA 1U5TB 3E5UA 4OU0A 1WRJA 2W24A 1P4NA 1W7PA 2P4WA 3CTAA 3RDIA 5IT3A 3FBUA 5E20A 1L3LA 1R36A 2UXNA 2EJRA 2P0WA 1U5TA 2Z0ZA 2ZW5A 2F5DA 4HDVA 3P2FA 1YW9A 4CS0B 2X7BA 1ODDA 1FOKA 4ZYHA 2PFBA 3VWDA 3HRTA 4RGXA 3J7AO 4KOSA 2XASA 1DDNA 2X4HA 2OZUA 1VKCA 3BY6A 3BZ6A 5E96A 3E6CC 2B58A 1JGSA 3LQQA 2J8RA 2EFPA 1PUEE 4LX9A 1U6GA 3W6XA 4R1HA 4XNHB 3K2ZA 4IUSA 2XHKA 2B3UA 1IN6A 4U7DA 5LLQA 4YRHA 1G3TA 3WGHA 2YX4A 1YK3A 3GYAA 2O03A 2PLYA 1K4JA 2K4BA 4JXQA 3T1BA 1R1UA 3F8MA 5FO5A 4AIKA 4BXUA 5E17F 4L8AA 3M8EA 3WTYC 4KMUX 1U2WA 3RYOA 2GA2A 2DO7A 2FXAA 2LSOA 2DPUA 5LHIA 5DD8A 1TLHB 1GXPA 1L0CA 4XPDC 4UWIA 4HF1A 2B3VA 4L9TA 3HHGA 1DPUA 1K78A 4KOTA 1IUYA 2WPXA 1FYLA 3H3ZA 4UVAA 4UXNA 2Z11A 4OIOF 1ZRDA 3V7CA 4LLGF 1LDJA 4PK2A 4KLWA 4RB3C 5ERIA 4AG9A 5K5RA 5CLSA 1J75A 4UV9A 2W84A 5FFZA 2HGCA 3LAJA 2VEZA 3M1EA 2GANA 5E1ZB 2FS5A 3G8WA 3F72A 2JPBA 4HF2A 3I53A 3GWZA 3TGNA 4KN4X 4BAYA 1QZYA 4HBLA 2H27A 3V8IA 1ON0A 2X0LA 2FBIA 3BJ7A 3EQLF 3CLOA 4G6QA 3FWEA 2MA3A 3WU1B 1KU3A 4ZYDA 3GFMA 2V79A 3I71A 4KOWA 3FB3A 3J80Z 2A61A 4FT8A 1FYKA 4QLCU 3TO6A 3CXSA 4KA4A 4FX4A 2EUIA 2CSOA 4N9IA 3DR8A 3GVAA 1UHWA 5FVJA 3GFJA 3TCVA 1S6LA 4RI1A 1Z4RA 4M71A 2CQKA 3FXRA 4G9YA 1W4MA 2DFIA 2RKHA 4PGGA 2DBBA 4PSWA 4GGGA 3H4QA 4MEYF 3ROUA 2RGVA 2B4BA 2KIFA 3K1MA 1CJWA 3LAPA 1IN4A 5LRSA 2MH2A 2ZFWA 3R9FA 4A5NA 1YW8A 2C6YA 4O6JA 2GQQA 3FM5A 1FY7A 4KZTA 3P9CA 4LMYA 3J81K 2QMLA 1IZ1A 1KUXA 3SHFA 1YS6A 4L89A 3COAC 4YIIA 3HHHA 1IF1A 3ELKA 4KUMA 2VBQA 3RIRA 3FNCA 4QC6A 2OAZA 3KE2A 2QBYB 4OMZA 1NSLA 3RKWA 1SFUA 3R1KA 2RN7A 1IXSB 3PFIA 2PR8A 2W57A 1K6OA 4IXAA 1YW7A 4HLYA 3Q9SA 5DDGA 1A04A 3WGGA 4CICA 1TW2A 2LF7A 1T39A 4HQEA 3V8LA 1ZLKA 4KUAA 3GO5A 1YYVA 3BJ8A 2R1IA 2CNTA 2IRFG 3LD2A 2FXFA 1KZFA 5BS6A 1Z6TA 4NXYA 1SMYF 4PV6A 2VE9A 3FXUA 4RB0A 4ZZLA 3JW4A 2O8XA 1IIDA 2EFQA 1I27A 1O7FA 3GXOA 2ESNA 1R58A 4WXDA 1HW5A 1ZN2A 2MD5A 2OH1A 4HX4A 2CNSA 1C0WA 3GKRA 3L7WA 2I00A 3BOQA 1U3EM 2FRHA 5HLHA 3P9IA 3FHZA 2WWYA 4OIQF 2Q8KA 2J8NA 2XROA 1IRGA 4TV7A 4DQ2A 3D3SA 4AIHA 4NB5A 4HKFA 2XKOA 3F6OA 2XAQA 2BYVE 1MGTA 1ZARA 1FZPB 5J6XA 3F8CA 4HQMA 4I49A 1FT9A 5HVQC 3FXTA 1FWZA 2TDXA 2L02A 3QU6A 5HS7A 4F7ZA 4RAZA 5LGTA 1HSJA 4B5OA 2R7FA 1ZG3A 1ZG5A 2STWA 4MQVA 4RGUA 2IP2A 4MGRA 3BJOA 1UHMA 1GVJA 2HS5A 3EY5A 4PZJA 3RPUA 3TO9A 4AB7A 3GZ5A 3EETA 2RVCA 2O28A 1YTYA 1ZHFA 4N9HA 2KKOA 4WXHA 2VODA 3KEQA 1ZRCA 4KDPA 3F6VA 1QZZA 4BMHA 3NQOA 4LJZF 4M3SA 3J80K 5FGMA 1HW2A 3E5XA 2CW0F 1J0RA 2VZYA 5F48A 1VTNC 5HLGA 1XGNA 1UFHA 2GZWA 2HTSA 4Q48A 5FD6A 4PDKA 3Q5FA 5AONA 5D5XB 2EA4A 5D8KB 2XAJA 4OADA 4BHCA 2D1VA 4KICA 2ACJA 4XSXF 3I9SA 3QP6A 1FP2A 2ARHA 1KU7A 5EBVA 4MY3A 2PG4A 3K9UA 5ISVA 5BOXA 3UY5A 2P5VA 1KYWA 2XGXA 4KT5C 2FF4A 3SZPA 2FSWA 3EUHA 2HDCA 1J59A 5D8LB 4A0YA 2A68F 4KORA 4KOYA 4EVYA 4UBRA 1I12A 2IPQX 2NRAC 2ZBKA 3R61A 1XCBA 5A2QZ 3K1NA 1OPCA 1XCVA 3FM3A 4I09A 5JHUA 2BUEA 1R5HA 2E1NA 2GIVA 4LG0B 1G3WA 1S8NA 2V9VA 4GXOA 4G7ZF 1XEBA 2A69F 1B6BA 2D4PA 2V1UA 4R8HA 4XRFA 4LLLA 2WTEA 3H92A 4LG0A 2Q04A 3O3KA 1QQIA 3QPTA 3DEUA 4Z2YA 3FMRA 1IAWA 1BOBA 1O3QA 3S6GA 2HEOA 4RB2C 5D4SA 2HV2A 4O5VA 3IKVA 5IX3A 4M72A 1B1BA 1NMTA 3KKWA 3IWZA 2GXGA 1WI9A 2FIWA 3RTRA 2P8TA 2HKOA 5H84A 4GYIA 3R6SA 3U2RA 2JEVA 4EQQA 5GCNA 3HSFA 2XAFA 3DP7A 1SD5A 3BLNA 4HV5A 1P92A 1B9MA 3BDDA 4A6EA 4UA3A 3HYIA 2DT5A 4YG2F 3N97A 1OZPA 3C1DA 2JZYA 4CO8A 1KQ0A 4CHUA 5IB0A 2O61A 1HSTA 3TTHA 3TKYA 1YVOA 4ZYGA 4A6DA 3JSOA 2XV4S 4M74A 2RNJA 2FU4A 4S04A 1FP1D 4H89A 2F5CA 1O3SA 4M85A 1L0OC 1YO5C 1XDSA 1USSA 1KU9A 4EVIA 5F49A 1TNTA 3QP5A 1TTYA 1JE8A 5LEJA 2OQGA 2FNAA 4MHDA 3G3SA 4S05A 3G3ZA 4EV0A 4R9MA 1Z9CA 5CJ9A 1XE4A 2VXKA 5HOOA 4M9SA 2P6GA 4JJXA 4NSQA 2K86A 1JXSA 4HNWB 2ISYA 5EEHA 1W7PD 3ERED 2DW4A 2A3SA 3HRUA 2CG4A 4YIFA 3GUDA 3SZTA 2Q7BA 3LQRA 3HUGA 1TW3A 5L3DA 2HKXA 1ZAOA 4NCZA 1RNLA 4IVNA 3TOBA 4XPDB 3ZN0A 1HW1A 5E18F 2VC0A 3TQNA 1R5GA 4IF4A 4XPLA 4G8XA 5IV0A 2A5YB 1YFHA 4HX7A 2K02A 3KFWX 3R96A 2FEZA 1XMKA 2VT2A 2XAHA 2HWVA 1UB9A 4YFNF 4EJWA 4ZYEA 4UHTA 4L9NA 2AS5F 1J2XA 3ZZIA 3D0SA 1IRFA 1BI1A 1FNNA 2EFNA 1YGHA 2A07F 4NEXA 2FE7A 5H20A 1GHCA 4PK3A 3Q9VA 4BHBA 2OZ6A 3HTSB 1YG2A 5F64A 3S6HA 1YR0A 1S7FA 1IICA 2PBIA 3BPVA 3QB8A 1QGPA 3MQ0A 4Y13A 1D3YA 3F8NA 4KYWA 4IHSA 4UNOA 2G7UA 4KOVA 1XD7A 1XMTA 4P9UA 1HXDA 2LKPA 1LQ1A 1BBYA 4ENJA 4A2UA 1PP8F 5H6RA 3DF8A 2YSRA 1OR7A 4EJTA 5A2QK 4L9JA 5KTAA 5HMNA 5LGNA 4U88A 1KU2A 3HSRA 5L3CA 4MY0A 4P96A 4HF0A 3GYHX 2K27A 1NE9A 2P6EA 1B9NA 1S3ZA 3E0KA 2Q4YA 5DWMA 3KEOA 3V8KA 2VBYA 5F1RA 2FSRA 2QUFA 4I02A 2D2WA 2P7CB 4PSXA 3RKYA 1FSEA 2M8EA 4N0BA 4EM1A 1MZBA 3T9YA 1LJ9A 1T98A 4U9ZA 4EM0B 4JWPA 4K2EA 1ZLJA 4UVCA 2VQYA 4G7HF 4EJUA 2EK5A 3TT2A 4CDGA 3LODA 3F8FA 1JHHA 3L00A 4JBAA 5D5UB 3IHUA 4MEXF 4E8OA 4CRYB 1Q1HA 2PEXA 4L18B 4LK1F 4XSZF 5BPDA 2F5EA 4OOIA 3V8JA 4OLLA 4Q4ZF 5DYMA 2FA5A 2K4JA 4GYGA 1J4JA 5LGUA 5KK1A 1HKSA 3HOTA 4Y49C 4HDUA 1MDMB 4Q47A 1BIAA 3E6MA 2L54A 3QU3A 3LWFA 5D6FA 4II9A 1U78A 4CZZA 4ONUA 4M9XA 2YR2A 3GY9A 5FLXZ 4AVBA 1LEAA 1TNSA 3TO7A 2F5IA 1V0CA 4MQ9F 1ZGJA 3R60A 2D45A 4E0AA 2QYOA 5HDNA 5ILVA 3ULQB 4OAEA 1IYKA 2H09A 4IRIA 4OIRF 1Z7UA 2ZMEB 1F1ZA 3P7NA 5ICFA 1H9TA 5FB2A 3T5XA 2ZNYA 3BJ6A 2Y0MA 3JVNA 3PGPA 1STZA 2PN6A 4M73A 4KIBA 2ZMEA 3HRSA 4HZFA 3O6BB 3CJNA 1M4GA 4KFCA 3WTUC 2EVNA 2Z5UA 2ZCWA 5TJJA 3E97A 5ILUA 3JAMZ 3REOA 3F22A 1Z4EA 2QBYA 3CUOA 3F23A 5DCFA 1S29A 3L2CA 2QENA 2Q44A 2HYGD 3DSBA 3TFYA 4XLNF 1FC3A 1U8RA 1FBUA 2Q2EA 1QSMA 1MJ9A 3LA2A 1H0MA 1G3YA 1YX0A 2YU3A 4OINF 3C3WA 4BH9A 1PDNC 4FD5A 2AJ6A 1D8JA 2OA4A 3WODF 1TBXA 1OKRA 2XKPA 3DPLC 1EH6A 1Q2DA 2G3TA 4KLVA 4Y15A 2I79A 3I4PA 4YGOA 4HA8A 4WX9A 2A4NA 2BEIA 1GXQA 4QVTA 3K0LA 1ONVA 3W91A 1SAXA 4LK0F 2HFHA 5LHHA 1M4IA 2ISZA 4YFXF 1VHSA 2E7XA 2DTRA 4GO1A 1R23A 1QPMA 3I59B 4XPKA 3MAJA 1J5YA 4RS8A 1PU9A 4L5IA 2A6EF 5TRDA 2VBWA 4U0WA 1NHAA 3NE7A 3IWGA 3I59A 3F5BA 3FX3A 2JDDA 4OMYA 1ON1A 2JPCA 2IA2A 4I7HA 2HTJA 2DU9A 2QZ8A 4GCVA 1BOAA 3HSEA 5D5WB 1KUVA 2ATRA 3MZYA 1P2FA 1RUNA 3D5LA 2DQLA 1RI7A 1TQMA 2P6SA 4QWQA 1XSVA 3ZMTA 4QB9A 4G7OF 4L5JA 4KIFA 4H0EA 4LB6B 4ESJA 1IN5A 1D8KA 4BQAA 3IKTA 1SD6A 4HNXB 2QIRA 1MD0A 3ZMUA 2NNYA 3WTVC 3ZMZA 3KP5A 1WSUA 4LD5A 1S7LA 2Q4VA 1YLEA 2RC4A 2ZKZA 5LRRA 1ULYA 2P5KA 4WK8F 2DI3A 2FBHA 3OWCA 1QO0D 2J8MA 4ZZDA 5CVIA 2VXZA 3ABTA 4CAVA 1G6NA 1J7KA 4ETSA 3DXJF 5HS9A 1BI2A 5BMZA 2GE3A 3LSTA 2BGCA 1P0HA 4HYEA 4EJVA 2CWEA 1FSHA 2OZGA 2FCKA 1GHEA 4KVXA 5FLXK 2EV5A 3DV8A 3LA3A 4RAYA 1E2XA 2VZZA 5JPHA 2JSCA 2VE8A 3TE4A 1SFXA 2KJCA 2HYFA 2IW5A 4Y17A 1BO4A 3RI4A 2STTA 1REPC 2EA2A 1Y9KA 2F5FA 3QRFF 4IRHA 2DAOA 3SQNA 2RV8A 2KIMA 5IT9Z 3C26A 1LVAA 5DCMB 4B5PB 2QQ9A 5L3BA 3RPQA 1R1TA 2E7WA 2P6TA 3CO7C 5K5OA 4U7BA 4B5PA 2COMA 4I01A 5JI6A 4L0YB 1BN5A 3WGIA 1S3JA 1S60A 1P6RA 3JAMK 3R0AA 2M1BA 2KIUA 3QAHA 1O7LA 3VB2A
chains in the Genus database with same CATH superfamily
4RGRA 4ZTJA 5ICCA 5J3LA 4AVCA 2UXXA 2F7VA 4NHJA 2HR3A 1S7KA 2AXLA 4NQWA 1O57A 1V5FA 1BUSA 1MK4A 3VFZA 3TDZC 4D1QA 5AIQA 3M8FA 1XC5A 4ENNA 3UGIA 3QOEA 1XMAA 4RUHA 2LNBA 4DBRA 4XLPF 1IY6A 3DQVC 3KZIC 1VQ4I 3TP3A 4JLYA 5EYRA 2ZW6A 1HA8A 1TGSI 5JVTA 3OL4A 5BQTA 1TWCJ 2XVCA 1ZR2A 2HU9A 2SGEI 4HOBA 4F0YA 1DUXC 3BG9A 4MCRA 1FPQA 2K85A 1S7EA 2GFQA 2ENZA 4EM2A 2IMOA 2EIJH 3KP4A 5F08A 3LSKA 4BE2A 3S2WA 4E7SA 1R9TJ 4FD7A 1ZH5A 3R0JA 5ED4A 2Q4ZA 1Q2CA 5GTIC 1LRZA 1XIXA 2VI7A 1Z0XA 1KUYA 1G2HA 2Y75A 4CYNA 1SEUA 5CCMA 1WH7A 2FNPA 2RREA 3BZCA 1Y7RA 3VOEA 2M4GA 3RZOJ 4D5FA 5CBMA 2M30A 2OPTA 3GUXA 2FMLA 2NYXA 1SD4A 3DTIA 4YRVA 5CVRA 3BTCA 4CYCB 2CO5A 3A4CA 3IL2A 3LMMA 1VIXA 3SJGA 3G1MA 1TQIA 3W2WA 3IEHA 3OYIA 1TBRR 3ZXSA 3IAM2 3WG9A 2Q0YA 2VL8A 4FHTA 3FF3A 4JZ0A 4ZYQA 2IGNA 4BY7J 4SGBI 4M9ZA 1T33A 2PMUA 4U5YA 4PXCA 1I50J 3EYYA 1LDKB 4UWJA 2DJNA 3CJRB 3L9FA 1A6IA 3S9NA 3BR3A 3GZ6A 2WC2A 1E17A 3IWWA 4G6TB 3HKZN 2O6GE 3P9KA 2JDCA 1OMIA 2HXOA 4J00A 5FUYA 1VHEA 1HKTA 4BACA 2R7RA 1R1VA 1QZEA 2WV1A 3D2MA 2G9WA 5GTHC 2Z33A 3S1NJ 1Z05A 4IPAA 1ZRFA 2UZKA 2O8KA 4E70A 3MZHA 1O3TA 4F91B 3PP9A 1AKHB 3IGRA 4E6KG 4F3QA 1MNDA 3HIFA 5E3OA 2B4DB 2DMUA 5FRNA 4FCYA 3AL0B 1JKRC 1HDPA 4CGZA 4M6IA 3SXYA 4P4FA 1AKHA 1LNWA 2NVXJ 2VOOA 2QVOA 1I21A 5E1XA 1U6MA 5CQEA 2PC1A 1OYIA 5E3QA 3QOPA 3D68A 3LSJA 4C3JJ 3EYIA 1XBUA 5G22A 3SXOA 1I1GA 3NAUA 5CVVA 4YEJA 1JWQA 1UG2A 3H9GA 3OOPA 4A38A 3S6KA 2CUJA 5C4XJ 1F36A 4UUVA 2PQ8A 1VQ5I 2WA0A 3KP6A 1XGMA 2WGCA 2PVWA 2Q43A 3CUQC 3B02A 4HEA2 4HAMA 2O53A 3PFYA 2B5GB 5K5QA 5CVUA 2PSWA 3CC7I 3S3MA 1S7OA 4IL6C 1HEEA 4L9VA 1RKTA 1KQ8A 4KVOE 1X3UA 2BSWA 1ERDA 4HV6A 4EJOA 1WI3A 1RTQA 2ID6A 2NAZA 4B09A 4QUSA 1AOYA 4E1RA 5LFAA 1QSNA 2B5GA 2PJ5A 1W7PB 1K7VA 3BZKA 3WTZA 2HQNA 2BE5F 4A12A 1Z91A 3JRCA 1CT4I 3S14J 2ZXWH 4NGTA 1HLVA 4FKDA 2XIGA 1HKQA 1WJAA 1AA7A 3FKIJ 2F2EA 4XKBA 4PQAA 1SQHA 4I0AA 3U9GA 2H6CA 5LD2C 3R95A 4HX8A 3ZJ0A 1OFCX 3ABUA 5EC4A 2W4SA 2M34A 1FLIA 3NH4A 4JYWA 2H8RA 3TOAA 1N71A 1FARA 4AYBN 3F8BA 5HDGA 3N4MA 3L2QA 1PUFA 2FIAA 3GX4X 3FSYA 4PXDA 4KT6A 4XORA 4R87A 3VEPA 3MFKA 5FLVA 1LAMA 4AD9A 3F8KA 4CXFA 2ZB9A 2K9LA 1IN7A 3PQKA 2VC1A 1B6AA 5JFRA 2RQPA 1Q9BA 3KZWA 1S20A 4LOCA 3VDPA 2FL4A 4PXEA 3WU0A 1FBSA 2E60A 2R0QC 4S0HB 3ISPA 2NSMA 3GW2A 2KPMA 1G4DA 5LBQA 1FOYA 1TKFA 4KMFA 3DPTA 5H86A 3JRUA 3IC7A 4XBFA 2G7HA 5ICGA 3QPLA 1WKXA 2IT0A 3EXNA 2Y31A 2R93J 2QLZA 2ETHA 1ETWA 1IB1E 4BDZA 1I1SA 2QKLB 2VQLA 3P2HA 1LKXA 2BOLA 3N7ZA 3R5CA 2YNDA 4KNYA 4J01A 1SGDI 3FIXA 4LG3A 2L4MA 3EC4A 4UEZA 4KN7X 1AWCA 4IF5A 4V2FA 5AIPA 1LR7A 5HXDA 2EINH 3K9TA 4HW0A 1BR4A 4B8XA 1TBNA 3WTSC 3MGDA 5LEKA 4L0ZB 3WTXC 2ZXJA 3L09A 1E0EA 1U5TC 2O0YA 4I2OA 4G94A 2XRNA 2CY2A 2P7VB 4B10A 2REEA 2QF7A 2PX9A 2HVRA 5C82A 1QRYA 1ZGAA 4BYYA 3UFFA 3EDPA 2ZNZA 3W6JB 3DDDA 1HBXG 4JK1X 4MTDA 3HBLA 1TIQA 2JLMA 3MCZA 4Q7AA 2PRBA 4P55A 2KMOA 2PCUA 5IT9K 4AVZA 1QSOA 1OCCH 2KISA 4JD6A 1K78B 3OMYA 5HH1A 4PK4A 3I4NJ 2ERWA 3A01A 2OD5A 3CMAI 4U9YA 3A0BC 5FKKA 4OC2A 1OYYA 1T2KA 3KP2A 3B3TA 3H3VK 1LDDA 2H6BA 3O2PE 1HDDC 3IU1A 4MJ8A 5GAHJ 3ZP5A 3BJAA 2VJJA 2ZJ2A 5KHDA 3TDUC 5J1RA 5G21A 1DS3I 2G3AA 4C7HA 4D7NA 2B9SA 5D5VB 3PM1A 4QPQA 4A69C 2DPTA 2V1DA 4CH7A 1UHAA 3BP8A 1YQAA 2QM3A 3ECOA 4DJLA 4QPOA 2B0UC 5IP6A 4Y49B 2Y48A 1F9NA 4KUBA 2LTPA 2M45A 2Z10A 4B47A 5EG0B 1KA8A 2DXQA 2V77A 3HOWJ 4HG2A 2LUYA 3EFAA 3B2YA 3E6BA 3NA6A 3T90A 3I4MJ 4XNHC 4X1EA 4HSTA 2DT7B 3ASOH 5JQ4A 3M8JA 4GFBA 2BY3A 1SMTA 2R3SA 4KSAA 4A5MA 5F1JA 1EKEA 5EG0A 1HC8A 2ANPA 2M5WA 3GF2A 3A2KA 3DBLB 3RKXA 4JP0A 1ZELA 4IJAA 2PJ4A 5ELYA 4XNFA 3OY9A 5C88A 2CXAA 3WC7A 2J5OA 2Q7SA 2JRTA 2CRGA 3QWPA 2LF8A 5HLTA 3C7JA 2V53A 1IYLA 4UF4A 3UKGA 2QQAA 4ZI6A 3LSHA 1XN7A 1PTQA 2WSAA 4BBHA 2W48A 3ZQ7A 1BW5A 1XSDA 1R71A 2N8GA 4D5CA 4IHTA 2B63J 1R0RI 2CJJA 2E34A 2G0EA 4PCQA 3T8TA 4PGHA 2NS0A 2CF4A 5DD4A 5KNLA 4A3KJ 1T0FA 1D5VA 1RFHA 2IA1A 2LVSA 2EZKA 4MCQA 3CMEI 2W25A 2ODDA 2X51A 3KZZA 1Y6IA 4G6DA 5J1UA 3W6SA 4YFKF 1MIJA 2H8WA 4M3GA 1SGEI 2KDOA 3G1LA 3R9EA 2DA4A 1ZG1A 4MHZA 2HVSA 2PR1A 4RS2A 3D8PA 5EEGA 4LITA 3S8PA 3SEZA 3K4BA 2BY1A 5L3EA 5AG6A 1KYZA 3V7RA 1VI0A 1HQCA 2V6CA 3B73A 4ZYAA 1RIOH 3SHPA 1ZQ3P 2IQ6A 2RDPA 2ABZA 3FC3A 4CGMA 1IXRC 2KFDA 1H88C 1LR8A 3VYSB 2DPDA 1ETXA 2ELHA 2VONA 3E5QA 1XB4A 1OMTA 1POGA 3HC7A 3R5DA 1R4MB 5DUKA 4A3CJ 1CM0A 1T6SA 2EV6A 3RKQA 3DWLE 2M5XA 1TKHA 4DNCA 1MDMA 1NXUA 1UCRA 2TRTA 4DUKA 4D0PA 4CAFA 2R7DA 2J9AA 2ZSHB 4WXCA 3WE2A 1P4WA 4UCMA 6PAXA 1SANA 4U0YA 4PFOA 4B6ZA 3I54A 2QECA 5ILSA 2QQBA 3QYFA 4ZH4F 2R7SA 3GEZA 3FYNA 1XGSA 2IVMA 2P5LC 1K6YA 3VWEA 2WY7Q 4UUTA 4A30A 2HQAA 2ORVA 1K83J 3RNZA 3K10A 4AXVA 5B3SH 1W0UA 1V3FA 4XMYA 3ZOBA 4QIWN 1JJ6C 3E59A 2CNMA 2LY9A 1K7AA 2GA1A 4IO9F 1MJAA 4J19A 3KR5A 5GPCA 1Z1DA 2H94A 3ZQGA 4ORFA 3F21A 3K4KA 2DIPA 3WR7A 1KGSA 1WJCA 5CNPA 1T8IA 2J5PA 1UG0A 1QNTA 2O5RA 3IWFA 4BY1J 3OS2A 2BY0A 3LSMA 4BJTA 5ICEA 4MTEA 1BL0A 4UCPA 3I58A 1ETOA 1DP7P 2CW8A 3SFZA 2AO9A 2XRCA 2F4IA 2D4OA 2BVMA 3W6KB 1CX8A 4NFRA 3BTLA 3FF5A 4ENMA 2WAQN 1YJ9I 1XPXA 2W82A 1W3SA 5DS9A 1R49A 2YNCC 1BPMA 5K1YA 1YS7A 4IRGA 1CGPA 1CF7B 5EX3A 4NDLA 1YW6A 5K7HA 4CGOA 3S6FA 4M3FA 2MH9A 1BW6A 3MKZA 2R7WA 1YIOA 2E1MC 2JTVA 2CYYA 2UV1A 1F43A 3CP8A 3O8HA 5DV5A 5CQGA 1B4AA 2R8VA 1CF7A 3K1PA 4PPZA 3CESA 3I64A 3M3YJ 1FTTA 4E2AA 3OV8A 2DMQA 4HLXA 2ADUA 3NRVA 4V2GA 4BHPA 5E8GA 4AWXB 1O3RA 4A3EJ 1ORKA 4CSWA 2HZTA 2VQGA 1FYMA 5GPAA 1T95A 3FX6A 2KRFA 3M7GA 1N13A 2Q51A 2FBKA 2V8VA 2UUZA 1WJDA 1W36D 3M07A 2R98A 4MRIA 4WF2A 3GLLA 4R79A 3EO4A 2QYVA 2Z3KA 2DLLA 3WU2C 1I6HJ 3CXQA 1QSTA 5GAEJ 2V1NA 3A03A 4P5OA 3FZVA 4M6XA 1ZKGA 4PJMA 5L3GA 3NEUA 2Y9ZA 1BR2A 2MLKA 3KP3A 3JTHA 2JWTA 3T8RA 5JM6A 2P6AC 5FFXA 3GIUA 5F04A 2GXAA 5F46A 3WE3A 4FD6A 1WJ5A 2JZMA 3GTQJ 1Z6RA 2EFOA 3AG1H 5DEQA 1EH8A 2L01A 3BWGA 2EK9A 5EX0A 4E7KA 2JUCA 2WYRA 2GU2A 2UWMA 2CFXA 2WV0A 3FJUA 4WWVA 3OR1C 5KTCA 2GWRA 3PZJA 3ZN1A 2ZW7A 5E79C 2ZW4A 1I6XA 1I5ZA 2R92J 3ZQFA 1RUOA 3DEWA 1S7AA 5BPIA 1VQMI 3ZMVA 1HF0A 1F2PA 2CTCA 3G73A 1BI0A 3HOSA 4LUAA 4UUSB 2GAUA 5F47A 2H5MA 5LYLA 2OVOA 2K5TA 3BJIA 4MHPA 1FJLA 3BROA 1Z9UA 2ZEOA 4ZBGA 3IRQA 4A3JJ 1Z2LA 5J4VA 4FUUA 4R6TA 4ZX8A 2JVGA 1M1DA 4KVME 4UY8I 2CUEA 2I5UA 2K40A 3RJPA 4AVPA 3OL0A 4BNCA 5E3PA 2Y0SA 1IW7F 2DKVA 1XGOA 2XSJC 4JXRA 2MD0A 2ODFA 3E3VA 2DF5A 2IS6A 3RYRA 4BS9A 3EUKL 3LSRA 1BJAA 4CYOA 2JSPA 1EV7A 3I0TA 3ECHA 2O3FA 3ZMSA 4FD4A 3FXLA 2HPIA 1M4DA 5JGFA 2UVOA 3GOXA 3L2VA 3KZYA 3RAMA 3BI0A 4N4NB 5J8CA 1LCPA 4KS9A 1PYVA 2X1DA 2CV0A 2QSGX 1IN8A 5JVGF 1SGPI 4HNYB 1KBFA 3LA7A 2GLJA 5IYCJ 2L3DA 4Z65A 5H6QA 5HNHA 4E7IA 4GS4A 2QVPA 2GOMA 2EILH 1XG1A 1IDZA 1UVFA 3F0AA 1F5TA 4IHXA 2MLGA 2IS1A 2ZEMA 1JGGA 3S9MA 2HUZA 2XAUA 2XAGA 2QWWA 4EMSA 1WZ2A 3BTIA 3DKWA 2CGPA 2PJ7A 2VOPA 2O7OA 2V4JC 1HCRA 4K30A 2Q0OA 3D4UA 3BR2A 2PI0A 1Y1WJ 3WHCA 2K9SA 1B59A 1VQ9I 1R79A 2G0BA 1DPRA 2DPSA 4B11A 5HNFA 1WWXA 5LHGA 3DR6A 3V7ZA 2WAEA 2VBZA 4UFWA 1MSEC 4IX7A 4YFJA 2OZHA 2EK8A 2W85A 3P5JA 2E1CA 1Z8XA 1RXTA 3CP2A 4P9FA 3D67A 2IL4A 2D1HA 3V7SA 4I99C 2BL1A 4NC6A 2XF7A 4MXUA 3DNSA 3CCVI 1LEBA 2X52A 5M5WJ 2VBXA 3JSPA 3S3OA 1LE8B 2BV6A 2LDUA 3H8FA 4Q36A 2E1OA 3R9GA 4UV8A 2POKA 3IRRA 2M87A 4I0BA 1ACIA 1G3SA 3SFIA 1IRZA 3E6DA 2HPMA 4BJ6C 2NMTA 4KOXA 1TXRA 1TWAJ 2YQPA 2E35A 5IOZA 4I98B 4JX6A 1VQ8I 1T08B 5DUIA 1FX7A 1LE8A 2KCXA 4ENKA 2Z3OA 1P4AA 3FHNA 1Y9WA 4KOUA 2HQRA 3K70D 2K7LA 1XF8A 2QEXI 2RFHA 4IKFA 3HZJA 3ABKH 2VRWB 1NG7A 4AVAA 5F27A 3NFZA 3A1YA 4MCSA 4P4DA 3SI1A 1QBJA 4A0XA 1FNOA 1KONA 1M8CA 2P6FA 3M9AA 1FIPA 2OU2A 2VJ5A 1DU0A 4CYPA 5D4RA 3GCMA 9ANTA 4OIPF 1IU8A 3GZNB 4MI4A 3MKLA 1P4XA 2B8TA 2GLFA 2FQ3A 2XUBA 4IZZA 4UB8C 4MFLA 4TWEA 4I6ZA 3ZMDA 2DYSH 4AMLA 3W3CA 3HRMA 2E5RA 4CCNA 3GFLA 2X1EA 4XKWA 3CMMA 3E0JB 4PJLA 1ZYRF 3V4GA 2R5YB 4LB5A 4O3MA 1R57A 1XTAA 3I55I 4MO7A 3JRAA 2LH9A 3VE5A 2YX7A 1CP6A 1QSRA 1RO5A 1V1IA 4PUSA 4UCNA 3ML6A 1FBQA 4KIGA 2FOWA 4MNUA 4MBUA 1ZREA 2VN2A 3KL9A 1R7JA 5HQ8A 1ARMA 1X10A 5F6FA 4PFPA 1UFMA 3R4KA 1Z7LA 4XLCA 2XEFA 2KCWA 4FQGA 1HDLA 2IJLA 2X6YA 4M6VA 5JR3A 3CDHA 3CC4I 1PCAA 2JA5J 2A6TA 4J3GA 3KETA 2ZPAA 1MNEA 5FD5A 5KTDA 4LLNA 2VB6A 3RYPA 2V1XA 2MYSA 4A37A 1RR7A 3FMQA 1Y0UA 1H9GA 2DK8A 5CVJA 5HS8A 2LYCA 5HVFA 2GXBA 5CYVA 1X74A 2V8DA 4OAYA 2IEKA 1SFEA 1V54H 1V5GA 1X1AA 5GADJ 5E8IA 3H5NA 2Z9OA 2BXZA 4E4HA 1SD7A 3DLJA 1BIBA 3KLOA 1FMWA 1W5TA 3CF2A 3W6VA 1AN1I 1PUAA 3B8GA 2XPUA 4UEEA 2EB7A 2FMYA 1LB2A 2EWNA 1YSJA 1VQ6I 3SJXA 2NNNA 4DGWB 1IC8A 5DWNA 4AIJA 2JT1A 4W1UA 1WKMA 1T38A 3MEXA 4AG7A 3SGQI 1ENHA 2EFWA 1LUJB 4M3DA 2CWFA 3MD2A 1Z8WA 2EV0A 4MHGA 2LB7A 4X5KA 4OKOA 1X3ZB 2BBYA 4P1WA 2DN0A 2Z99A 1KQ9A 1NG6A 1TQPA 2YPRA 2ZO4A 4CYDA 1VFCA 2C6CA 5GP9A 5DCMA 2XB5A 2ZXVA 5TISC 2FOKA 3GLXA 4MPIA 4UVBA 1WQ2A 1VQPI 3JUWA 1NK2P 4ZJZA 4U87A 2IA0A 1S7NA 3FBNB 5JLWA 3BTJA 4ON0A 1Y7EA 3IC1A 4AC0A 4R3KA 1XX5A 1MJBA 2VT3A 4HPQA 5IOYA 5G1ZA 4F9UA 4ANJA 3GFIA 4HPSA 4A3GJ 5E1WA 4EGZA 2YGWA 3A0HC 2DEAA 2HQYA 4PJNA 1MKMA 5H2FC 3GTPJ 1USTA 2KDZA 1SGYI 4ASNA 5HDKA 1YREA 1MMGA 1APLC 3LFKA 5L3FA 4H6ZA 3K4CA 2C6GA 3B4VC 1J9IA 1D0ZA 1UZCA 4XL9A 4BXFA 3ZCOA 1B87A 1CPSA 1F57A 2PJ6A 1WK4A 4FWUA 1R22A 2AQFA 3CJTB 3PUFA 3LNQA 3RU0A 2FE3A 1F4KA 3B6CA 3ZQLA 2YNEA 2CIJA 4ESBA 1Z5RA 2KHMA 4CRZB 1P9QC 1EF4A 1IGBA 3D2PA 1EH7A 2F6CA 4C2YA 2ARPF 2JK3A 1XDUA 2IS4A 1RZ4A 3CO6C 4LFUA 3PFOA 4H6UA 4CAXA 2HNHA 1K79A 1WJBA 2OC6A 1YLFA 4ZDPA 5FROA 4QBJA 5JHWC 2OB0A 2A6HF 4WWCA 1R00A 4ESFA 1BC8C 1ULMA 5HI7A 4HKFA 1BMOA 1UWYA 3KCCA 2ZXHA 3ABLH 2L7KA 1JHFA 2B0LA 3QODA 4ZTFA 2PJCA 1Y8QB 3PB8X 3VODA 2DK5A 3A02A 5CPAA 3EUHC 3SXNA 1X3WB 2DQRA 3F3XA 3H3UA 2KP6A 1BLLE 3D1NI 1S5KA 4JQFA 3F9KA 2YU9J 2YS9A 2K5CA 2XPVA 3MKYB 2GKRI 6CPAA 4ZY0A 1S72I 3ZPLA 1BM9A 2FT0A 2HOEA 2OBPA 1M4LA 3ONQA 2PJRB 1Q2YA 2M7AA 3TMOA 2KJBA 3CXPA 3WTTC 1I1DA 3C18A 2PMHA 2XGCA 3CUQB 3AAFA 1ZGWA 1MBEA 2MBFA 2BEOA 4IHWA 2R4GA 2ESHA 1Z3YA 3H35A 3I5UA 1M44A 2MSYA 4CAWA 1YOVB 1YMEA 1IXCA 2OQRA 2PJRA 4NF1A 3K4JA 1BC7C 3T0YA 1VZ0A 3CLQA 4F6AA 3DFGA 3CCRI 3CUQA 2PJ0A 3I3GA 2WPWA 2PJPA 1V4RA 1TWHJ 2WY8Q 4A0ZA 4CYCA 4EWTA 2L2OA 3HTUA 3QPHA 3FXQA 4LGWA 4M6YA 4EGYA 2K9HA 4FX0A 1MH3A 2Z1DA 3U1DA 2X1CA 3BG6A 1W5SA 3PQJA 3LSPA 1ON2A 4R3LA 1W0TA 4NJRA 2PDOA 4RGSA 2KL4A 2WAFA 5HLIA 2AFSA 4ZGYB 4A32A 2AE6A 2OCEA 2IS2A 3OSFA 1IW4A 3PBEA 1ZG7A 5D6EA 3LL7A 2CWGA 3S2DJ 2Z3NA 4CCJA 3FIWA 3WTWC 3K69A 3SGBI 1WWZA 4DBQA 3UOEA 2PE3A 4F52A 5K8PA 2KLOA 2L9SA 2XF5A 3H5RA 4U0VA 1PP7U 3L1PA 1G8XA 4D7MA 2BHZA 2EQRA 1YQEA 3SZGA 3E1SA 2GOXB 3OYDA 2V8HA 4DOZA 3S9LA 5I0CA 1DP3A 3DU5A 2B4DA 2NVTJ 3FEEA 5FJ8J 1EJ9A 2MABA 2L4AA 4BQQA 4IQJA 3S1QJ 2AFOA 1CSOI 3KLNA 3DLLF 2FQ4A 3CCLI 3FEDA 1RC9A 4XRMA 5FKLA 4E1PA 3MWMA 3H1CA 4Q5SF 1MMNA 4C2TA 2K9MA 2VQHA 2QJ8A 1BI3A 2M2EA 3TW6A 3SJFA 2SGPI 3FMSA 1OYWA 2MC3A 4NGNA 3TP0A 4WCGA 4R57A 2V7FA 1XSXA 4RB1A 3KP7A 1YVKA 3OYKA 2E71A 3D5RC 3J81Z 2CMPA 1IG7A 2R7HA 2W7NA 2ELKA 5J8FA 3HOXJ 2HXIA 1JKPC 3BPXA 2C27A 4A95A 4A3BJ 1MMAA 5KVRA 5I4MA 3WT4A 2GM4A 2LBFB 3HUGB 4OWRB 2LY2A 3DLAA 2Z3YA 2REFA 1U5TB 3E5UA 4OU0A 4BUPA 1WRJA 2W24A 1P4NA 3FVLA 2EO8A 4KSIA 3ZQQA 1W7PA 3B3CA 2P4WA 3CTAA 3RDIA 5IT3A 3FBUA 4Z6YA 1A2ZA 5E20A 1L3LA 3PRTA 1R36A 2LBFA 3KQXA 2UXNA 2EJRA 2ZJQF 4P4IA 2LOOA 2P0WA 1U5TA 3OYNA 2Z0ZA 2ZW5A 2F5DA 2COBA 3BR5A 1TWFJ 3U1KA 5C44J 4HDVA 3GTMJ 1YW9A 2RIJA 4OVOA 3P2FA 2OTLI 4X3RA 4CS0B 2X7BA 1ODDA 1FOKA 4UFVA 4ZYHA 1XMXA 2PFBA 3VWDA 1Y1VJ 5IYDJ 3HRTA 4RGXA 3J7AO 4KOSA 1XBTA 2XASA 3DBHB 1YU6C 3CCMI 1DDNA 2X4HA 4MHYA 2OZUA 4C3IJ 1VKCA 4BJ5C 3ISXA 4B14A 3BY6A 3BZ6A 1NH3A 5E96A 3E6CC 2B58A 1JGSA 5EZGA 2I10A 3LQQA 2J8RA 4DYCA 1WVRA 2EFPA 3AKZA 1PUEE 2R7TA 2NU2I 3MN8A 4LX9A 4BINA 4A24A 1U6GA 2DOFA 2QA4I 3W6XA 4R1HA 4XNHB 4JX4A 3K2ZA 2ZELA 2XHKA 2B3UA 4IUSA 1IN6A 4U7DA 4E7ZA 5LLQA 4YRHA 1GV5A 3TBIA 1G3TA 3WGHA 2HOSA 2YX4A 1YK3A 4NBQA 2EZHA 2O03A 1OVOA 3UGDA 3GYAA 3IU2A 5K8OA 3OWTA 2PLYA 1K4JA 4NNJA 2WUUA 1UUCA 2K4BA 5D8NA 2SGFI 4JXQA 3T1BA 2PMZN 1R1UA 3F8MA 3QWLA 5FO5A 2VLAA 4AIKA 1Z8TA 5AG5A 4BXUA 2PJ8A 2ZXIA 5E17F 3PSFA 3M8EA 3JRHA 4L8AA 2X6WA 3L2WA 4KITB 5EJCA 2LMDA 2IBDA 3WTYC 2CWHA 4M6GA 4KMUX 1U2WA 3RYOA 4YU9A 2E2IJ 2AFZA 3PDNA 2BHYA 2GA2A 3LWUA 2DO7A 3FXJA 1NSAA 1X19A 3ABMH 2V6EA 2FXAA 4MIMA 3CDXA 3O8GA 4AIDA 2LSOA 4DYOA 2DPUA 5LHIA 2KZGA 1F2OA 5DD8A 1TLHB 4IOCF 1GXPA 4FE7A 1L0CA 2R7OA 1WHUA 4XPDC 5GAGJ 3MZ8A 3B6AA 4UWIA 3RQ4A 5M3MJ 2Y9YA 4HF1A 2B3VA 2K3PA 3DTEA 2Z3PA 2YUUA 4L9TA 3HHGA 4BL0B 1DPUA 2KQRA 2DCEA 1K78A 4X8IA 2LG4A 4KOTA 1LFWA 1IUYA 2WPXA 4XKVA 3FSXA 4IOAF 1FYLA 3H3ZA 1TT5B 5EZHA 2ROWA 4UVAA 3WHBA 3H36A 1X2MA 4UXNA 2Z11A 4OIOF 2DFFA 1J09A 1B8IB 3HLPA 2WADA 2LD5A 1Z8LA 8CPAA 1ZRDA 2AFXA 3V7CA 3VARA 4LLGF 4NGPA 1LDJA 4PK2A 4KLWA 1ITYA 2FNFX 4BD9A 4RB3C 5ERIA 2QPOA 1XFOA 5DM7F 1Y0YA 2PRQA 4AG9A 5K5RA 5CLSA 2W1OA 1J75A 4UV9A 1B8IA 4E7HA 3ASNH 2WAQA 1QHHD 2W84A 5FFZA 2HGCA 3LAJA 3W2AA 4LQ6A 2VEZA 1OCTC 3M1EA 2GANA 5E1ZB 2FS5A 2BW3B 2VL1A 3G8WA 3F72A 3BG3A 3CXLA 2JPBA 4HF2A 3JRFA 3I53A 1YI2I 1GUUA 3GWZA 3TGNA 2F8HA 3KHZA 4KN4X 4IHMA 4BAYA 1UJ8A 3HH2C 5K7FA 1QZYA 4HBLA 2H27A 1HJAI 3PFEA 3V8IA 3ISZA 4CAEA 1ON0A 5E3LA 3OS1A 2X0LA 1P9ZA 2K9QA 2Z16A 2FBIA 1E3HA 3BG5A 2ME6A 4DZPA 4O23A 3PNTA 3BJ7A 1TZLA 3EQLF 3CLOA 4XRSA 1KMAA 3KEYA 4G6QA 3FWEA 5A28A 2AFUA 1QU3A 3JRGA 3JRIA 3PB7X 1RESA 2MA3A 1YJNI 3WU1B 1K7UA 2ENNA 3A9LA 1KU3A 3ZQHA 4ZYDA 2P81A 3RQIA 3GFMA 2V79A 3I71A 1OR7C 1VQKI 2QQEA 1XA6A 4KOWA 4P45A 4A39A 4YWYA 3FB3A 1PJUA 3D66A 2CV2A 3J80Z 4M6HA 2JMWA 2A61A 4FT8A 1FYKA 4QLCU 1WCMJ 2WB1A 3TO6A 3M4OJ 3CXSA 4IAVA 4A2ZA 4KA4A 2E1MB 4Y52J 4II2A 4F9VA 4LIUA 4FX4A 3H9QA 2EUIA 2CSOA 4N9IA 3FBIB 1ARLA 2YNCA 3DR8A 7CPAA 2NVQJ 3GVAA 2DXIA 1UHWA 4DIQA 5FVJA 3GFJA 3TCVA 4PXBA 2LY1A 1S6LA 3JR9A 2QKMB 1FTZA 4RI1A 1Z4RA 1OISA 1V55H 4M71A 4RA2A 3VATA 2CQKA 3FXRA 1ZR4A 4UXHA 3UGLA 4HRIA 4G9YA 1A35A 3KYDB 2PJ3A 4RN7A 2R5ZB 2A5WA 1W4MA 2DFIA 2RKHA 3K2KA 5FLMJ 4PGGA 3VH9A 1V1HA 1IV8A 2DBBA 2VXDA 4PSWA 4GGGA 3H4QA 2DMTA 3CC2I 5F0FA 3OYCA 4MEYF 3ROUA 1R43A 3WC6A 1MBJA 2R5ZA 1JKQC 2RGVA 1R4NB 3HDDA 2B4BA 2M3AA 4MFZA 2PIYA 1TURA 3B3WA 2KIFA 3K1MA 1CJWA 3KYCB 3B3SA 3S32A 3LAPA 1IN4A 5LRSA 4ITVA 4N4OB 5E3MA 1DGRM 5IP7J 2GVIA 2MH2A 2ZFWA 5EGOB 3R9FA 1U9OA 4A5NA 4XN3A 1D1CA 1YW8A 4O6JA 2GQQA 3FM5A 4OAZA 5EEAA 2C6YA 4IHVA 1XRYA 1FY7A 2SGQI 4KZTA 2ZOGA 1T0FC 3ZRGA 2XDVA 3P9CA 4C3HJ 2PJ2A 4LMYA 3J81K 2M0CA 1CPXA 2QMLA 4JOMA 2HDDA 4QSHA 1TC3C 1FAQA 4P44A 2PJ1A 1IZ1A 1KUXA 3CJQB 3S15J 2NS7A 3SHFA 1YS6A 3EUAA 4L89A 1FMVA 3COAC 1SVMA 4YIIA 3HHHA 5LRJA 3MMYB 1IF1A 1Y0NA 3ELKA 4KUMA 4P4BA 2IGOA 2VBQA 2KRHA 3RIRA 3MN2A 1OJLA 3FNCA 4QC6A 2OAZA 1GDTA 4GXHA 1A36A 3KQZA 3KE2A 2QBYB 4GRIA 4OMZA 1NSLA 3RKWA 1SFUA 3R1KA 2RN7A 4BE1A 1IXSB 4ONWA 1CT2I 2QGUA 1ETVA 2LFBA 3PFIA 2W57A 2PR8A 2E36A 1K6OA 3CZ6A 2YUSA 3IH3A 4IXAA 3CPAA 1YW7A 2CW7A 3Q9SA 4HLYA 5DDGA 1A04A 3WGGA 4CICA 1TW2A 3N05A 2LF7A 1T39A 3PJRA 4BBSJ 4H2KA 3DPUA 4HQEA 3V8LA 3RCOA 4CA0A 2HI3A 2VPRA 2F3CI 1ZLKA 4KUAA 3J7AY 3GO5A 1YYVA 2Q2EB 3FRMA 3BJ8A 4XR6A 2R1IA 2CNTA 1OCPA 2IRFG 3LD2A 2DA6A 3GTLJ 4MFJA 1PTRA 1Z7KB 2MW8A 2FXFA 1KZFA 2VQCA 3VDUA 5BS6A 3TEDA 1Z6TA 4NXYA 1PYTB 1OMUA 1SMYF 2KRCA 4PV6A 2VE9A 4CPAA 3FXUA 4RB0A 4ZZLA 1CG2A 3FKJA 4A3DJ 5J1QA 3JW4A 2O8XA 3BR6A 4BQNA 1IIDA 4ZX9A 2EFQA 1XS9A 3CT9A 1I27A 1O7FA 3CCUI 4FETA 2NU1I 4KSFA 3GXOA 5KCMA 3CCQI 3FECA 1LFUP 1Y1BA 3BG7A 2ESNA 3NWTA 1R58A 4WXDA 5E3RA 1HW5A 4UUSA 1WGCA 1ZN2A 2MD5A 2ZMEC 3M1CA 2OOTA 2OH1A 2VJIA 2GIZA 4HX4A 2CNSA 1C0WA 3GKRA 3L7WA 2I00A 3BOQA 1IDYA 3OOUA 1U3EM 2FRHA 3HOYJ 4Y7NJ 3B35A 3VPRA 2XPWA 3FH4A 1JI8A 5K8MA 1MBHA 1HDUA 2NU0I 1JTYA 2VKEA 5HLHA 1OBRA 4LQGA 3CQZJ 1K4SA 1K7TA 1DU6A 3SDGA 3KR4A 3P9IA 1SAUA 3BQYA 1LVKA 3FHZA 2WWYA 4OIQF 5F0HA 2Q8KA 2J8NA 4AM3A 2XROA 1IRGA 1SVLA 2IXSA 3CDIA 4TV7A 3KHXA 4MFKA 2R7QA 2DYRH 4DQ2A 2LKSA 3D3SA 4AIHA 4NB5A 1G59A 2XKOA 1D1AA 3F6OA 3I3LA 4IEJA 1W36C 1VQNI 1TKJA 2XAQA 1FIAA 1A6QA 2BYVE 4JCVE 1MGTA 1ZARA 1FZPB 2J9RA 3PBBA 5J6XA 3VWBA 5AG7A 2X48A 3F8CA 3V42A 1WTJA 4HQMA 4B43A 2Z3LA 4I49A 3KX2A 2ELJA 4RAFA 1FT9A 5HVQC 4RLFA 3FXTA 1FWZA 1PPFI 2TDXA 2L02A 3QU6A 2N17A 5HS7A 1ETQA 4F7ZA 2WCYA 2NU3I 3IWEA 4MLOA 2W00A 2JA2A 4RAZA 4B44A 3BR0A 5LGTA 1HSJA 4B5OA 2R7FA 3IUOA 1ZG3A 3J7ZI 3K2AA 2HYJA 2ELIA 1IY7A 2DA7A 1ZG5A 2STWA 1FEXA 4MQVA 4RGUA 2IP2A 4MGRA 3BJOA 1UHMA 4Y3OA 3PNYA 3IO1A 3KI9A 3OYAA 1GVJA 1VGYA 2HS5A 1TF9A 3AFHA 3EY5A 4HNUA 1BR1A 1DQUA 3PIOF 4PZJA 3RPUA 3TO9A 2QSHX 1XX6A 2ZEHA 1X2NA 3GZ5A 1QA6A 1TIHA 4AB7A 3EETA 1E3OC 2RVCA 3NH8A 2O28A 3C2GA 1SVOA 1YTYA 2ZEPA 3HJEA 3BR1A 1ZHFA 1X1DA 4XLAA 3OYFA 4F92B 4N9HA 2KKOA 2DA2A 4CCOA 4AU7A 3FDYA 4XICA 4CYQA 4WXHA 3VSKA 2VODA 3H5AA 4BBRJ 3KEQA 5J1YA 1JT0A 1ZRCA 4XIDA 3BQZA 2AHQA 2ZC2A 4KDPA 5AGEA 1SGRI 3F6VA 2ICWG 1QZZA 1RPWA 2D5VA 4BMHA 3NQOA 4OC0A 4UEFA 3B3VA 1UELB 3OIOA 4LJZF 2LEOA 4L9MA 4M3SA 1FOWA 3J80K 5FGMA 4P4EA 3RZDJ 3H8GA 4C2ZA 2DOEA 1HW2A 3GTGJ 3RSNA 3E5XA 2O9LA 3QQAA 2NVUB 1KBEA 1YW4A 2CW0F 2AXTC 3TX8A 1J0RA 4DYQA 2VZYA 1WJEA 2VPLA 1S9HA 5F48A 2GKTI 3I56I 1VTNC 5J40A 3OYMA 1D0XA 5HLGA 1XGNA 3G2BA 2GZWA 2N52A 1UFHA 2HTSA 1OCOH 1QVTA 3FISA 2VKVA 4Q48A 1ELLP 3GB0A 3JREA 2R5YA 2EWBA 1X4PA 5FD6A 4PDKA 3Q5FA 5AONA 5D5XB 4CZCA 2XGEA 2V8GA 2EA4A 1LR9A 3OXFA 1LANA 5D8KB 2M8GX 1NTCA 3I9V2 4X0GA 3OVOA 1Y0RA 1OYVI 2XAJA 4OADA 4BHCA 3KGQA 1VF9A 2D1VA 4KICA 2ACJA 4XSXF 3I9SA 4NJQA 5KAFC 2UZ3A 1E3PA 4W9YA 3QP6A 1P9GA 2E5ZA 4F93B 3FK6A 1ZG8A 1Z2IA 2Y30A 1FP2A 3TL4X 2CUFA 4ZY1A 3HKZA 2ARHA 2EIKH 1XJOA 1KU7A 4C30A 5EBVA 4B12A 1JKOC 3BI1A 2K3FA 2MGQA 1ZK8A 2PG4A 4MY3A 3U21A 1UHSA 1MT1A 3K9UA 5ISVA 2XEGA 1YX3A 5BOXA 3UY5A 5B1AH 1JJ8C 3QAYA 2P5VA 3K70C 2LRDA 4XM3A 3SEKC 3CCYA 2BUSA 2FVGA 3MRUA 1KYWA 4XONA 2XGXA 4KT5C 1K4TA 2Z3MA 2FF4A 3SZPA 2FSWA 3EUHA 2HC9A 3FMCA 2HDCA 3PO3J 1J59A 3D7GA 3DBRB 5D8LB 2IGKA 3D5SC 1I3AA 3SI0A 4A0YA 4C2MJ 2A68F 4KORA 1WGTA 4B3XA 1ZLHA 4V19K 1Q1VA 2ZENA 1I12A 4KOYA 4UBRA 1QHGA 4EVYA 2KZVA 3BHXA 2IPQX 3UR3C 2ZEDA 3FXOA 1U0JA 3ZGKA 3PIPF 2CH0A 2ZBKA 2NRAC 1VHOA 3R61A 4OIWA 1XCBA 5A2QZ 4TNUA 1AMPA 3K1NA 2ZEFA 1OPCA 1XCVA 3FM3A 4I09A 3PUBA 5JHUA 3R5BA 1JUSA 2BUEA 1R5HA 2F5VA 2E1NA 2GIVA 2V1CC 3DTKA 4LG0B 1ZLIA 1JQGA 2EBIA 2V9KA 1G3WA 1S8NA 4CUGA 1RR8C 1HEVA 4E7JA 1T56A 2V9VA 4GXOA 4G7ZF 2Z2SB 3H0GJ 3BXMA 4ZDOA 4EMEA 3C2BA 1XEBA 2A69F 1B6BA 3OSGA 3L2UA 2D4PA 5EF6A 4R8HA 3SDBA 1VQLI 2V1UA 3PB6X 3WG7H 4XRFA 4FE4A 3BC8A 2WTEA 3H92A 2DOAA 4LG0A 4LLLA 3O3KA 2Q04A 1VQ7I 1QQIA 2BCOA 2L9NA 3QPTA 3R5AA 3B7IA 2WVJA 2FD5A 5KAIC 2F48A 3DEUA 4Z2YA 3HOZJ 3FMRA 1IAWA 4MFDA 1BOBA 1HDQA 1O3QA 3S6GA 2KMPA 1SGNI 2PIZA 1X1CA 2HEOA 4RB2C 1PVEA 1OCZH 2VUMJ 4AYBA 5D4SA 5IY5H 4AUXA 2HV2A 3IJ3A 4C68A 2ME0A 3ZR8X 1W5CC 1U8BA 3CZXA 5CKTA 4O5VA 3IKVA 3OYBA 5THWA 5LYDA 5IX3A 3NE8A 4M72A 3HOUJ 2L8EA 1B1BA 4IHYA 1NMTA 4WJBA 1CP7A 3KKWA 1ELMP 3IWZA 2DA3A 2QQ0A 4HGUA 2GXGA 1WI9A 1H0ZA 1DGWY 2KT0A 1JUPA 5FUXA 2FIWA 5A27A 3RTRA 2P8TA 2GLOA 4P6YA 2HKOA 5H84A 4GYIA 2J87A 1MH4A 2R7XA 3UEJA 1CGII 4ZY2A 3R6SA 3U2RA 2JEVA 4EQQA 3H0DA 1NUBA 1DTDA 2JA1A 1FT7A 3LMSA 5GCNA 3HSFA 2XAFA 3DP7A 1SD5A 2HB6A 3BLNA 4HNTA 4HV5A 2OCCH 1P92A 1WJFA 4Q38A 3DGVA 4A33A 1WFXA 1B9MA 5C4JJ 4MFPA 3BDDA 5FUWA 5IP9J 2M0MA 3KIOA 4A6EA 4UA3A 2KMQA 1BAVA 3HYIA 3Q0WA 4JYKA 2DT5A 4YG2F 3N97A 1OZPA 3AG2H 3C1DA 2JZYA 3IP4B 1QQ9A 4CO8A 1KQ0A 2PVVA 1X12A 4CHUA 1ZTRA 5IB0A 2PMZA 2O61A 4C2UA 3FXKA 1HSTA 2FX0A 3TTHA 3TKYA 1YVOA 2DODA 4A6DA 4ZYGA 3JSOA 3JTGA 2XV4S 3HPGA 4M74A 1GLNA 2VI6A 2RNJA 2FU4A 4S04A 3MKWB 3ZQCA 4UIAA 1FP1D 4H89A 2F5CA 4OC5A 1O3SA 4M85A 1L0OC 1BPNA 1YO5C 3VYUB 3ZQIA 1XDSA 3OYEA 1X4OA 3OXGA 1USSA 3WABA 1KU9A 4EVIA 5F49A 1TNTA 2MC4A 2ZEEA 2NOGA 3QP5A 2N71A 1TTYA 1JE8A 2CU7A 5LEJA 5B5EC 1DS2I 2OQGA 2FNAA 2HZDA 3PO2J 2I8DA 3G3SA 4MHDA 3S1RJ 4S05A 3G3ZA 4EV0A 1YHQI 4L5EA 4R9MA 3MVPA 4I76A 3BCAA 1YLOA 4XOPA 1Z9CA 1MNMC 3QPSA 3J7YJ 3NWSA 3JRDA 5CJ9A 1XE4A 5C3EJ 2VXKA 2F4OB 5HOOA 4M9SA 1TL8A 2P6GA 3LACA 5F0CA 4JJXA 1D1BA 4NSQA 5LRKA 2K86A 1JXSA 2OR4A 4HNWB 2ISYA 3G71I 5EEHA 1W7PD 2DW4A 3ERED 2A3SA 2HDWA 3DKXA 1CGJI 3HRUA 1ZG9A 2CG4A 2GKVA 4YIFA 2WBMA 3GUDA 3SZTA 2L9RA 2NOJB 3LQRA 2Q7BA 2E5NA 2NU4I 1AHDP 3HUGA 1TW3A 4XKCA 5L3DA 5K7ZA 1RKWA 3IAS2 1LAPA 2HKXA 1ZAOA 3OS0A 3CMYA 1RNLA 3BLYA 2AQEA 4IVNA 2A20A 2JBKA 4NCZA 4GM5A 4YIRX 3TOBA 2QQCA 3HEFA 5BNGA 4MMOA 5M5YJ 2B7EA 4B3AA 3CCJI 4OC1A 3ZN0A 4B6DA 3GLJA 4XPDB 5FUVA 1HW1A 5E18F 1PUFB 2VC0A 5FKNA 1R5GA 3TQNA 2CS3A 4IF4A 3E7LA 2EZIA 3QTLD 4XPLA 2BXYA 4G8XA 2CQXA 1K61A 5IV0A 2A5YB 2CQNA 1YFHA 4HX7A 1Z77A 2K02A 3KFWX 5EDNA 3R96A 1YX5A 2FEZA 1OQYA 1XMKA 2VT2A 1GV2A 3HG9A 2XAHA 1BJZA 2HWVA 1UB9A 4YFNF 4EJWA 4UHTA 4ZYEA 3G1OA 4OC3A 2JUGA 2H1LA 4L9NA 2AS5F 1J2XA 3AL0C 3ZZIA 5D29A 3SI2A 3D0SA 1IRFA 1BI1A 1FNNA 1Z21A 1KZHA 3GMEA 2EFNA 2AFMA 1YGHA 2L9VA 3QNVA 2A07F 4NEXA 2FE7A 2PJAA 2Y2ZA 5H20A 1GHCA 2R7UA 2M7BA 4PK3A 2HVQA 3TC8A 5E3NA 3Q9VA 4B48A 1W1WE 4BHBA 2OZ6A 2JBJA 3IFEA 2NS8A 1MBFA 3HTSB 2QCOA 1YG2A 5F64A 3Q0VA 2FUG2 4PJ0C 1YRNB 2O4HA 3S6HA 1QVUA 1YR0A 1S7FA 3OXLA 1IO2A 1IICA 2PBIA 1Q7LA 3BPVA 3QB8A 3RO0A 1QGPA 3MQ0A 2XF6A 4Y13A 1HPTA 3HGYA 1D3YA 3F8NA 2CV1A 4KYWA 5J47A 1YRNA 1CE3A 1LFPA 4IHSA 2DFEA 4UNOA 1DE4C 2G7UA 4KOVA 1RETA 3HPHA 1XD7A 1XMTA 3ESWB 4P9UA 1HXDA 2LKPA 1LQ1A 1BBYA 4ENJA 4A2UA 4FTHA 4R76A 3A01B 4K3NA 3HGGA 1PP8F 5H6RA 3DF8A 2LR8A 4B13A 2YSRA 1OR7A 3OL3A 4RLQA 4BU2A 4A3FJ 4EJTA 2Q1ZB 3D00A 5A2QK 4L9JA 1SGQI 2JA8J 5KTAA 5HMNA 5LGNA 1IUFA 1R5ID 1XOVA 4U88A 1KU2A 1Z67A 4XK4A 1CHOI 3HSRA 4C2XA 5L3CA 4MY0A 1JUMA 2LLKA 4P96A 1IY5A 3H8EA 1IJWC 4HF0A 3GTJJ 3GYHX 2QQ8A 1TBOA 2K27A 3V38A 1NE9A 2P6EA 4NGMA 1B9NA 2V26A 1FOXA 2XEJA 1S3ZA 3E0KA 2Q4YA 2K9NA 2G9DA 4BDYA 1JTXA 1WPKA 5DWMA 3TJQA 3KEOA 3V8KA 2F4MB 3OYLA 2VBYA 5F1RA 2MG4A 1R6RA 2HOAA 5DTDA 4NC7A 2DMPA 2CUZA 2L7FP 2D2WA 1MBKA 2QUFA 4I02A 2P7CB 4F0XA 1ETYA 4PSXA 3RKYA 3PB9X 2BW3A 3T8WA 3H5ZA 1TOTA 4F55A 1FSEA 2M8EA 4N0BA 2DTZA 1P7IA 1MZBA 4EM1A 3T9YA 2JQ7A 1CBXA 1LJ9A 3F0CA 1T98A 4U9ZA 2XRLA 4UB6C 3VYRB 4EM0B 4JWPA 4K2EA 4JX5A 1ZLJA 4UVCA 2JW6A 3E2IA 4NGSA 4P10A 2VQYA 3CD6I 3C2HA 4G7HF 5CCLA 4EJUA 1U5KA 4R8FA 2E19A 3VDXA 2ZJPF 2BY2A 4OMEA 2EK5A 2CQ7A 3TT2A 4A31A 4CDGA 3LODA 2OF7A 3F8FA 1JHHA 3PEIA 3L00A 4JBAA 5D5UB 3IHUA 4MEXF 4E8OA 1M8BA 1X1BA 1IOFA 4CRYB 1Q1HA 2DFHA 2GBYA 1TP4A 3UNGC 2PEXA 1YIJI 4L18B 1BA5A 4RDUA 4EFDA 4LK1F 2VJ4A 4XSZF 5BPDA 3KASA 2F5EA 4OOIA 3X2QH 2JA6J 4A93J 3S1MJ 3CCEI 3OYHA 3V8JA 4OLLA 3JTKA 4Q4ZF 5DYMA 2FA5A 2K4JA 4GYGA 2BOAA 3VSLA 4XQFA 3HUVA 1J4JA 5LGUA 5KK1A 1HKSA 3HOTA 1P7JA 2XB0X 5HVGA 2LKXA 2L7XA 1V5EA 5B66C 4BKXA 3D7HA 4Y49C 4HDUA 2FSRA 3SJEA 3K4MA 4ABZA 1MDMB 5JHFA 4KISA 4Q47A 1BIAA 3E6MA 2L54A 3BT9A 2DJIA 3QU3A 2QQDA 4IQ4A 2TCTA 2EH3A 4WP4A 4DW6A 3SEQA 2RB7A 2KIQA 4MHNA 4RMNA 4GDFA 3LWFA 2JRMA 5FKMA 2W0TA 2LK2A 5D6FA 1CT0I 2Y69H 5CPRB 3TW7A 1VQOI 2M9HA 5JH9A 4E7LA 4II9A 2OD1A 4NGRA 1WH5A 1U78A 4CZZA 4CCKA 4ONUA 1PJRA 3FK7A 5IYBJ 4M9XA 2YR2A 3GY9A 4EATA 1MSFC 5FLXZ 4AVBA 1LEAA 2CQQA 1Y39A 1TNSA 3KYLA 3TO7A 2F5IA 2OV7A 1V0CA 1XMBA 5EGOA 3Q0UA 4MQ9F 3AG3H 4CGLA 1ZGJA 3R60A 1UVGA 2JVHA 2D45A 4HNVA 4E0AA 2QYOA 2SGDI 5HDNA 4MCPA 5ILVA 1TWGJ 3ULQB 4CCMA 3CPXA 4OAEA 5EMIA 2ECBA 1IYKA 4GI3C 2H09A 4IRIA 4OIRF 1Z7UA 2ZMEB 1F1ZA 3P7NA 5ICFA 4EEFG 1H9TA 1IGNA 1PCEA 5FB2A 3T5XA 2ZNYA 3BJ6A 2CJSC 2Y0MA 1HOMA 4PJJA 3I1UA 3JVNA 1FYBA 3PGPA 5F09A 2DDBA 1STZA 2PN6A 2RQQA 2AFWA 3ERMA 4M73A 4F8ZA 4KIBA 4FISA 1YITI 4DJAA 1ETKA 2JN6A 2ZMEA 3HRSA 3OYGA 4HZFA 3O6BB 1H8AC 3CJNA 1I39A 1M4GA 1A31A 4KFCA 4BEHB 3GTKJ 3WTUC 3DCFA 4CGNA 2EVNA 2Z5UA 2ZCWA 5TJJA 2BZTA 3E97A 3PSIA 5ILUA 3AG4H 5HODA 1YTPA 1O4XA 3JAMZ 3REOA 4DYRA 3F22A 5M3FJ 2E2JJ 2QBYA 1Z4EA 2IAIA 3CUOA 3F23A 1Y56A 3MEKA 5DCFA 5IB9A 4BEHA 2R7ZJ 1VNDA 1S29A 2L5QA 5DS0A 1N78A 2IJZA 4OIDA 2EIMH 3L2CA 2QENA 1Y8FA 2JA7J 3WC5A 2Q44A 2HYGD 2ID3A 2ECCA 3LOCA 3DSBA 2HOTA 5FRMA 2DT6A 2NVYJ 2DA1A 3TFYA 1MBGA 3K6GA 4XLNF 4C7IA 1FC3A 1U8RA 1FBUA 2Q2EA 5DAEA 1SC7A 3JRBA 4FASD 2ZJRF 3GTOJ 1QSMA 4CGPA 1WGXA 1MJ9A 2M4KA 3LA2A 1H0MA 2OUMA 2BO9A 1G3YA 1YX0A 4C9YA 1D5YA 4KLVA 2YU3A 3D7FA 1TT0A 4OINF 1UMQA 3C3WA 4BH9A 1PDNC 1IOIA 1EE3P 2AJ6A 1D8JA 4FD5A 2OA4A 3WODF 1TBXA 2XKPA 1OKRA 3CDLA 1EH6A 3DPLC 3LFUA 4ZDLA 2WB1N 1Q2DA 4Y15A 2G3TA 2I3CA 3PB4X 2I79A 3I4PA 2L7MP 4YGOA 4HA8A 2X6XA 4WX9A 4X6AJ 1KWMA 3S17J 2A4NA 2BEIA 1GXQA 4QVTA 3K0LA 1ONVA 5JLXA 1LPQA 2X6OA 3DU6A 4OC4A 4BQOA 5J4YA 3W91A 3SJMA 4LK0F 2HFHA 1S5LC 4CCLA 2XC7A 4Y4RA 5LHHA 1SAXA 1M4IA 2ISZA 3N5FA 2XSDC 4YFXF 1LOKA 1VHSA 2NXNB 2E7XA 4DZJA 2DTRA 4GO1A 2KMUA 2LP0A 1R23A 1QPMA 4RM2A 2JYYA 4UIBA 3I59B 4XPKA 3MAJA 1J5YA 4RS8A 1PU9A 4L5IA 2DA5A 2H1KA 1TBQR 4FAIA 2KMRA 5HVHA 2A6EF 2X85A 4Y33A 1SFOJ 2PJBA 4G1PA 5TRDA 1SFKA 2VBWA 1TF8A 2ZEGA 3OIQA 4U0WA 1NHAA 3RZAA 3NE7A 3IWGA 2VKDA 3I59A 3G4SI 3S3NA 3F5BA 3FX3A 2X3TA 2DDAA 4B1RA 2JDDA 2EPFA 1ON1A 2JPCA 5M5XJ 4OMYA 2IA2A 4I7HA 2HTJA 5BWAB 4A3IJ 2DU9A 3D7DA 1MW7A 3OIPA 1IV6A 1MMSA 2DB6A 2GREA 2N1AB 2VIXA 3IH2A 2QZ8A 1OCRH 3HM5A 1BOAA 4GCVA 1Y1CA 3DEEA 3S2HJ 3HSEA 5D5WB 1KUVA 2ATRA 3MZYA 1P2FA 3LSGA 1RUNA 4A3LJ 3UEYA 2XEIA 1AUGA 2EBJA 1I3QJ 4P4JA 1H8LA 5IPAA 4XN0A 3RPUD 3IIBA 3QYBA 3D5LA 3L2NA 2DQLA 1QPIA 4R7MA 3HXLA 1RI7A 2OTJI 2EZLA 3LSIA 1TQMA 4A3MJ 2P6SA 1GT0C 2ORWA 3K4NA 4QWQA 1XSVA 3ZMTA 3DKYA 3K7AJ 4BE0A 4G7OF 4QB9A 3EPZA 4RM3A 4L5JA 3S16J 4KIFA 1RRJA 4IK2A 4II3A 4H0EA 4LB6B 4ESJA 1X1PA 1H89C 3HOVJ 1YE9A 1IN5A 5DM6F 2CFOA 1D8KA 4BQAA 4RBOA 3IKTA 2VASA 4A94A 3K4LA 2XGDA 1SD6A 4RAGA 5LYFA 4G12A 4HNXB 2QIRA 1MD0A 5TGTA 3NARA 3ZMUA 2NNYA 5AG4A 3H9JA 3WTVC 2RNGA 3ZMZA 3KP5A 1WSUA 1ULNA 4LD5A 1S7LA 2QSFX 2Q4VA 3Q3SA 1YLEA 2ZOFA 2RC4A 7WGAA 3W2VA 5K8NA 2ZKZA 1Z3XA 2L0KA 1ULYA 1IRXA 2ZFUA 1GVDA 5LRRA 4MFEA 1ZO0A 2P5KA 3NH5A 3PL8A 4WK8F 1D0YA 2DI3A 5LYIA 2FBHA 2E73A 3OWCA 5G20A 1QO0D 1JT6A 2LREA 4ZZDA 2J8MA 5CVIA 2NYQA 2VXZA 3ABTA 4CAVA 3L2RA 2JXDA 4LIVA 1G6NA 1J7KA 2WZNA 4OP4A 2OJED 1GYTA 1YJWI 2C1CA 4ETSA 3G6EI 3DXJF 3RBUA 3KPHA 5HS9A 4XRSG 1BI2A 4B4CA 4BXXJ 5BMZA 2Y0SN 1VDDA 2GE3A 2V1CA 3LSTA 2BGCA 4M3BA 4UXIA 1X4SA 2V9PA 2PJ9A 3FXMA 1B72B 1P0HA 3GBGA 4XLEA 1EA3A 4HSRA 4HYEA 1A5JA 4EJVA 2CWEA 1FSHA 2OZGA 3OR2C 2FCKA 1LFBA 1GHEA 4KVXA 2R7VA 5FKOA 5FLXK 3JCUC 1QMUA 2JEWA 2EV5A 3DV8A 2BVLA 1B72A 3LA3A 1TUSA 4RAYA 1E2XA 4KJZA 1N77A 9WGAA 1AYEA 4MFQA 4BGDA 2VZZA 5JPHA 2X9DA 2JSCA 2VE8A 5LRGA 3TE4A 1SFXA 3SYTA 3QYEA 4XLHA 2KJCA 2HYFA 2IGMA 2IW5A 4Y17A 1ULKA 1BO4A 5B1BH 1NK3P 1X58A 1W4RA 3RI4A 2STTA 2DMNA 2ZSIB 1REPC 2EA2A 3CCSI 4NC8A 4NUBA 4QTRA 1Y9KA 2F5FA 2JJ7A 3QRFF 4IRHA 2A05A 1R3NA 2DAOA 2L7ZA 2RV8A 2KIMA 3SQNA 5IT9Z 4UXJA 2C6PA 1LVAA 3C26A 4FBEA 5DCMB 2HQ5A 3S93A 3CF5F 2E2HJ 4B5PB 2QQ9A 5L3BA 1N75A 3RPQA 1MMDA 4NGQA 4XLFA 1R1TA 1Y8RB 3PNVA 2VKHA 2CTBA 2E7WA 2P6TA 4H4KC 3IH4A 4ZC3A 3CO7C 4UFXA 4X2TA 5K5OA 4U7BA 4B5PA 1U9NA 2COMA 4I01A 4D9JA 2FJ1A 5JI6A 4L0YB 1N25A 1BN5A 2MFZA 2RAEA 3BCBA 3WGIA 3OYJA 3IV5A 3KY9A 1S3JA 3HL2A 1P6RA 4W97A 1CQTA 1S60A 3JAMK 3HB9A 3R0AA 2M1BA 2KIUA 4NQWB 4YELA 1AU7A 3VYTB 2LC2A 1UAAA 1M1EB 4M3EA 1OLTA 3QAHA 1O7LA 4XOTA 3VB2A
chains in the Genus database with same CATH topology
4RGRA 5ICCA 4AVCA 2UXXA 4NHJA 2HR3A 1S7KA 2AXLA 4NQWA 1O57A 1MK4A 3VFZA 3TDZC 5AIQA 3M8FA 4ENNA 1XMAA 2LNBA 4XLPF 3DQVC 4JLYA 2ZW6A 5JVTA 5BQTA 2XVCA 4HOBA 4F0YA 1DUXC 1FPQA 4EM2A 3KP4A 3S2WA 4FD7A 1ZH5A 3R0JA 5ED4A 1Q2CA 1LRZA 1XIXA 2VI7A 1KUYA 2Y75A 4CYNA 2FNPA 1Y7RA 3VOEA 2M30A 2FMLA 2NYXA 1SD4A 5CVRA 2CO5A 3IL2A 1TQIA 3WG9A 2Q0YA 4FHTA 4M9ZA 2PMUA 4U5YA 3EYYA 1LDKB 4UWJA 3L9FA 3GZ6A 1E17A 2WC2A 2O6GE 3P9KA 2JDCA 1OMIA 1HKTA 1R1VA 3D2MA 2G9WA 2Z33A 1Z05A 4IPAA 1ZRFA 2UZKA 4E70A 3MZHA 1O3TA 3PP9A 3IGRA 3HIFA 2B4DB 4CGZA 3SXYA 1LNWA 2VOOA 2QVOA 1I21A 5E1XA 1U6MA 2PC1A 1OYIA 3QOPA 3EYIA 5G22A 3SXOA 1I1GA 5CVVA 3OOPA 3S6KA 4UUVA 2PQ8A 3KP6A 1XGMA 5C82A 3CUQC 3B02A 4HAMA 2PSWA 2B5GB 5K5QA 5CVUA 1S7OA 4KVOE 4L9VA 1KQ8A 1X3UA 2BSWA 4HV6A 4EJOA 2NAZA 4B09A 4QUSA 1AOYA 1QSNA 2B5GA 1W7PB 3WTZA 2HQNA 2BE5F 4A12A 1Z91A 2XIGA 1HKQA 2F2EA 1SQHA 4I0AA 3U9GA 2H6CA 3R95A 4HX8A 3ZJ0A 3ABUA 5EC4A 1FLIA 3TOAA 1N71A 3F8BA 5HDGA 3N4MA 4R87A 2FIAA 3GX4X 3VEPA 3MFKA 4AD9A 3F8KA 4CXFA 1IN7A 3PQKA 2VC1A 1B6AA 5JFRA 2RQPA 2FL4A 3WU0A 1FBSA 3ISPA 3GW2A 1G4DA 5LBQA 4KMFA 3DPTA 5H86A 3IC7A 4XBFA 2G7HA 5ICGA 2IT0A 3EXNA 2QLZA 2ETHA 1IB1E 1I1SA 3P2HA 3N7ZA 2YNDA 4KNYA 3FIXA 2L4MA 3EC4A 4KN7X 1AWCA 4IF5A 5AIPA 3K9TA 4HW0A 3MGDA 4B8XA 3WTSC 5LEKA 4L0ZB 3WTXC 2ZXJA 3L09A 1U5TC 2O0YA 4I2OA 4G94A 2XRNA 2CY2A 2P7VB 4B10A 2REEA 1ZGAA 4BYYA 3EDPA 2ZNZA 3W6JB 3DDDA 1HBXG 4JK1X 4MTDA 1TIQA 2JLMA 3MCZA 2PRBA 4P55A 5IT9K 1QSOA 4JD6A 1K78B 5HH1A 2OD5A 4U9YA 1OYYA 1T2KA