1ULKA

Crystal structure of pokeweed lectin-c
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
126
structure length
126
Chain Sequence
APVCGVRASGRVCPDGYCCSQWGYCGTTEEYCGKGCQSQCDYNRCGKEFGGKECHDELCCSQYGWCGNSDGHCGEGCQSQCSYWRCGKDFGGRLCTEDMCCSQYGWCGLTDDHCEDGCQSQCDLPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords lectin-C
publication title Similarity between protein-protein and protein-carbohydrate interactions, revealed by two crystal structures of lectins from the roots of pokeweed.
pubmed doi rcsb
total genus 39
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1ulkA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1ulkA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1ulkA01
2LB7A 4WP4A 1WGCA 1WKXA 1ULMA 7WGAA 2DKVA 1ULNA 4AMLA 2WGCA 2X52A 1P9ZA 2UVOA 1P9GA 1ULKA 1K7UA 1HEVA 2X3TA 1Q9BA 9WGAA 1K7TA 1WGTA 4MPIA 1K7VA 2CWGA 1UHAA
chains in the Genus database with same CATH superfamily
2KCXA 2LB7A 2QQDA 3R5DA 1TBQR 1FYBA 5E3RA 1SGPI 3RU0A 1SGEI 1TIHA 2N1AB 4SGBI 2ROWA 3CXLA 3VE5A 2UZ3A 1TBRR 2E5RA 2J9RA 2OVOA 1R79A 5E3QA 1XBTA 1OMUA 2B0UC 2GKTI 2QQCA 3UGDA 1R0RI 2DB6A 3FC3A 1Z7KB 3TOAA 1HEVA 1YTPA 1MJAA 4A24A 5HI7A 2GKVA 1HDLA 2ODDA 2YUUA 1DS3I 2XRCA 2NU2I 1MJBA 2RIJA 1PTRA 1X4SA 1Y1BA 2NU0I 3B4VC 5EX0A 2NU4I 3TO6A 3QWPA 1K7VA 1BUSA 1WTJA 3UEYA 3TO7A 2GIVA 4UXHA 5CCLA 1TBOA 4DNCA 2WVJA 5FUVA 5E3PA 4B6DA 2V1CA 1KBEA 5DAEA 3R5CA 3D00A 1X74A 2PQ8A 1CGII 7WGAA 1FARA 2YQPA 3OXLA 1DS2I 3GOXA 2OZUA 2DKVA 1IY6A 5J8FA 1ULNA 2ENZA 4AMLA 1PCEA 2GVIA 1CHOI 1M8CA 1LR9A 1TBNA 2M5XA 1P9GA 2N17A 2OD1A 2UVOA 2KMPA 2WCYA 3HH2C 1CT2I 3SEKC 2NU1I 3BJIA 3VDPA 1TURA 1NXUA 2SGPI 3UFFA 2SGEI 3SGBI 1NUBA 2CWFA 2QPOA 1W3SA 1OYVI 1UVFA 2GKRI 3OXFA 2QQ0A 9WGAA 3FSYA 2KMQA 2NU3I 2N52A 3UOEA 1S20A 5FUYA 3E59A 1CT0I 5JHWC 2L8EA 5FUWA 1IY5A 2CWGA 2ORVA 2ORWA 3TJQA 2JW6A 1LR7A 4WP4A 1TUSA 4L9MA 3R5BA 1WGCA 3FSXA 3MEKA 2ARPF 3TO9A 1LR8A 1SGQI 1FAQA 2ERWA 1ULMA 1WKXA 3KY9A 1FY7A 5CCMA 1CSOI 3OL0A 4UXIA 1RFHA 1XA6A 2V1CC 1KMAA 2BUSA 2LUYA 1YU6C 2ELIA 3QTLD 2X52A 2Y0MA 1P9ZA 5HQ8A 1Y1CA 4GI3C 2E73A 5J8CA 2K9HA 1HPTA 1K7UA 1ULKA 1SGDI 4E1PA 1SGRI 1SGNI 4JCVE 1KBFA 1XX6A 1PTQA 1BMOA 1OMTA 2X3TA 3VDUA 2RC4A 1M8BA 2N71A 2L7XA 4OVOA 2A20A 1Q9BA 1UUCA 3UGIA 3OXGA 3SGQI 2CJSC 3OVOA 1K7TA 1AN1I 1CT4I 1OVOA 2DIPA 1WGTA 2OU2A 3E2IA 2B8TA 2LEOA 3PDNA 3QAHA 1MT1A 1UVGA 4HGUA 1IW4A 1UHAA 2CWHA 2ENNA 1TOTA 1CGJI 1CE3A 2JXDA 1PPFI 4UXJA 1MJ9A 3TOBA 2SGFI 1HJAI 3UGLA 2KMRA 3R5AA 4FKDA 2SGQI 2KMOA 2WGCA 2P6AC 1V1HA 1PJUA 1VDDA 5EX3A 3UEJA 2VRWB 1W4RA 2JA1A 2JZMA 5FUXA 2F3CI 1TGSI 2QQEA 1N13A 1V1IA 2V53A 4E1RA 1Z2IA 2JYYA 1U5KA 1Y8FA 2FNFX 1SGYI 4MPIA 1H0ZA 2SGDI 2W0TA 2J87A
chains in the Genus database with same CATH topology
2LB7A 4WP4A 1WGCA 1WKXA 1ULMA 7WGAA 2DKVA 1ULNA 4AMLA 2WGCA 2X52A 1P9ZA 2UVOA 1P9GA 1ULKA 1K7UA 1HEVA 2X3TA 1Q9BA 9WGAA 1K7TA 1WGTA 4MPIA 1K7VA 2CWGA 1UHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LB7 A;  4WP4 A;  1WGC A;  1WKX A;  1ULM A;  7WGA A;  2DKV A;  1ULN A;  4AML A;  2WGC A;  2X52 A;  1P9Z A;  2UVO A;  1P9G A;  1ULK A;  1K7U A;  1HEV A;  2X3T A;  1Q9B A;  9WGA A;  1K7T A;  1WGT A;  4MPI A;  1K7V A;  2CWG A;  1UHA A; 
#chains in the Genus database with same CATH topology
 2KCX A;  2LB7 A;  2QQD A;  3R5D A;  1TBQ R;  1FYB A;  5E3R A;  1SGP I;  3RU0 A;  1SGE I;  1TIH A;  2N1A B;  4SGB I;  2ROW A;  3CXL A;  3VE5 A;  2UZ3 A;  1TBR R;  2E5R A;  2J9R A;  2OVO A;  1R79 A;  5E3Q A;  1XBT A;  1OMU A;  2B0U C;  2GKT I;  2QQC A;  3UGD A;  1R0R I;  2DB6 A;  3FC3 A;  1Z7K B;  3TOA A;  1HEV A;  1YTP A;  1MJA A;  4A24 A;  5HI7 A;  2GKV A;  1HDL A;  2ODD A;  2YUU A;  1DS3 I;  2XRC A;  2NU2 I;  1MJB A;  2RIJ A;  1PTR A;  1X4S A;  1Y1B A;  2NU0 I;  3B4V C;  5EX0 A;  2NU4 I;  3TO6 A;  3QWP A;  1K7V A;  1BUS A;  1WTJ A;  3UEY A;  3TO7 A;  2GIV A;  4UXH A;  5CCL A;  1TBO A;  4DNC A;  2WVJ A;  5FUV A;  5E3P A;  4B6D A;  2V1C A;  1KBE A;  5DAE A;  3R5C A;  3D00 A;  1X74 A;  2PQ8 A;  1CGI I;  7WGA A;  1FAR A;  2YQP A;  3OXL A;  1DS2 I;  3GOX A;  2OZU A;  2DKV A;  1IY6 A;  5J8F A;  1ULN A;  2ENZ A;  4AML A;  1PCE A;  2GVI A;  1CHO I;  1M8C A;  1LR9 A;  1TBN A;  2M5X A;  1P9G A;  2N17 A;  2OD1 A;  2UVO A;  2KMP A;  2WCY A;  3HH2 C;  1CT2 I;  3SEK C;  2NU1 I;  3BJI A;  3VDP A;  1TUR A;  1NXU A;  2SGP I;  3UFF A;  2SGE I;  3SGB I;  1NUB A;  2CWF A;  2QPO A;  1W3S A;  1OYV I;  1UVF A;  2GKR I;  3OXF A;  2QQ0 A;  9WGA A;  3FSY A;  2KMQ A;  2NU3 I;  2N52 A;  3UOE A;  1S20 A;  5FUY A;  3E59 A;  1CT0 I;  5JHW C;  2L8E A;  5FUW A;  1IY5 A;  2CWG A;  2ORV A;  2ORW A;  3TJQ A;  2JW6 A;  1LR7 A;  4WP4 A;  1TUS A;  4L9M A;  3R5B A;  1WGC A;  3FSX A;  3MEK A;  2ARP F;  3TO9 A;  1LR8 A;  1SGQ I;  1FAQ A;  2ERW A;  1ULM A;  1WKX A;  3KY9 A;  1FY7 A;  5CCM A;  1CSO I;  3OL0 A;  4UXI A;  1RFH A;  1XA6 A;  2V1C C;  1KMA A;  2BUS A;  2LUY A;  1YU6 C;  2ELI A;  3QTL D;  2X52 A;  2Y0M A;  1P9Z A;  5HQ8 A;  1Y1C A;  4GI3 C;  2E73 A;  5J8C A;  2K9H A;  1HPT A;  1K7U A;  1ULK A;  1SGD I;  4E1P A;  1SGR I;  1SGN I;  4JCV E;  1KBF A;  1XX6 A;  1PTQ A;  1BMO A;  1OMT A;  2X3T A;  3VDU A;  2RC4 A;  1M8B A;  2N71 A;  2L7X A;  4OVO A;  2A20 A;  1Q9B A;  1UUC A;  3UGI A;  3OXG A;  3SGQ I;  2CJS C;  3OVO A;  1K7T A;  1AN1 I;  1CT4 I;  1OVO A;  2DIP A;  1WGT A;  2OU2 A;  3E2I A;  2B8T A;  2LEO A;  3PDN A;  3QAH A;  1MT1 A;  1UVG A;  4HGU A;  1IW4 A;  1UHA A;  2CWH A;  2ENN A;  1TOT A;  1CGJ I;  1CE3 A;  2JXD A;  1PPF I;  4UXJ A;  1MJ9 A;  3TOB A;  2SGF I;  1HJA I;  3UGL A;  2KMR A;  3R5A A;  4FKD A;  2SGQ I;  2KMO A;  2WGC A;  2P6A C;  1V1H A;  1PJU A;  1VDD A;  5EX3 A;  3UEJ A;  2VRW B;  1W4R A;  2JA1 A;  2JZM A;  5FUX A;  2F3C I;  1TGS I;  2QQE A;  1N13 A;  1V1I A;  2V53 A;  4E1R A;  1Z2I A;  2JYY A;  1U5K A;  1Y8F A;  2FNF X;  1SGY I;  4MPI A;  1H0Z A;  2SGD I;  2W0T A;  2J87 A; 
#chains in the Genus database with same CATH homology
 2LB7 A;  4WP4 A;  1WGC A;  1WKX A;  1ULM A;  7WGA A;  2DKV A;  1ULN A;  4AML A;  2WGC A;  2X52 A;  1P9Z A;  2UVO A;  1P9G A;  1ULK A;  1K7U A;  1HEV A;  2X3T A;  1Q9B A;  9WGA A;  1K7T A;  1WGT A;  4MPI A;  1K7V A;  2CWG A;  1UHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...