1ULKA

Crystal structure of pokeweed lectin-c
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
126
structure length
126
Chain Sequence
b'APVCGVRASGRVCPDGYCCSQWGYCGTTEEYCGKGCQSQCDYNRCGKEFGGKECHDELCCSQYGWCGNSDGHCGEGCQSQCSYWRCGKDFGGRLCTEDMCCSQYGWCGLTDDHCEDGCQSQCDLPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin-C
publication title Similarity between protein-protein and protein-carbohydrate interactions, revealed by two crystal structures of lectins from the roots of pokeweed.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 39
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1ulkA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1ulkA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1ulkA01
1WKXA 1HEVA 1P9GA 2WGCA 4MPIA 1Q9BA 7WGAA 2CWGA 1WGTA 1P9ZA 1UHAA 1K7UA 2UVOA 1K7TA 1ULKA 1K7VA 1ULMA 2X52A 9WGAA 1WGCA 2X3TA 4AMLA 2LB7A 2DKVA 4WP4A 1ULNA
chains in the Genus database with same CATH superfamily
1KBEA 2ARPF 1TOTA 2N1AB 2NU0I 2CWFA 1SGYI 2YQPA 3FSYA 3OXLA 3R5DA 5E3RA 3UGLA 1HEVA 2ODDA 2V1CC 2VRWB 3OVOA 2V53A 3CXLA 2GVIA 1Q9BA 5HI7A 2ROWA 2N71A 2CWGA 1LR8A 1R0RI 2Y0MA 3OXFA 1P9ZA 3PDNA 2B8TA 4UXIA 1CE3A 3KY9A 1NUBA 2QPOA 1CT4I 1Z7KB 2JW6A 2KMOA 1SGEI 5DAEA 2JXDA 3TJQA 5FUWA 1FYBA 2SGDI 2FNFX 2OD1A 3D00A 2X52A 3E59A 2P6AC 2SGQI 3UGIA 4AMLA 5E3QA 1BMOA 1MT1A 2DKVA 1HDLA 2N17A 1CSOI 1FY7A 2LEOA 1OMTA 1ULNA 2L7XA 1PJUA 1XX6A 2QQDA 1UUCA 1FARA 1PCEA 3UOEA 2QQCA 2J9RA 2L8EA 1SGDI 1YU6C 1V1HA 3QAHA 2ORWA 4UXHA 3TO9A 1KMAA 1TURA 7WGAA 1Y1BA 1S20A 3SEKC 5CCLA 2BUSA 2NU3I 5EX3A 1MJAA 5JHWC 2WVJA 1K7TA 3BJIA 1IY6A 3R5BA 1KBFA 1R79A 1ULKA 1K7VA 1Y1CA 3RU0A 1ULMA 1W4RA 3UFFA 2KMRA 3E2IA 1UVFA 1WGCA 2JA1A 3FC3A 2CJSC 2DB6A 1TGSI 1SGNI 2N52A 1SGPI 3UEJA 3SGBI 4E1RA 1X74A 1XBTA 1OMUA 5HQ8A 1PTQA 1CGII 1WKXA 3OL0A 3UGDA 3B4VC 2OVOA 2WGCA 1CHOI 5EX0A 3TO7A 2SGEI 2SGFI 2LUYA 1M8BA 1AN1I 2CWHA 1YTPA 2ERWA 1WGTA 3R5CA 2JYYA 1M8CA 1Z2IA 2E73A 1PTRA 1UHAA 2ELIA 5FUXA 5FUYA 2ENZA 2V1CA 4L9MA 2QQEA 2RC4A 2J87A 2NU1I 2SGPI 4UXJA 1IW4A 4E1PA 3QTLD 3VDUA 3GOXA 4FKDA 1BUSA 1HJAI 5FUVA 2B0UC 1Y8FA 2M5XA 1TIHA 1SGQI 1RFHA 2LB7A 2PQ8A 1MJBA 1XA6A 2X3TA 3HH2C 3R5AA 4WP4A 2KMQA 1TUSA 2A20A 2NU4I 1MJ9A 3VDPA 4DNCA 1H0ZA 1HPTA 2ENNA 1CT2I 1TBQR 1UVGA 1W3SA 3TOAA 2F3CI 3MEKA 1P9GA 2ORVA 2WCYA 4SGBI 5J8FA 3FSXA 1U5KA 1FAQA 3SGQI 4MPIA 4HGUA 2K9HA 1CT0I 2QQ0A 1VDDA 2RIJA 1N13A 2JZMA 3UEYA 3VE5A 1K7UA 2KMPA 2UVOA 2NU2I 5CCMA 2W0TA 1PPFI 1IY5A 1TBRR 2E5RA 3OXGA 3QWPA 4OVOA 3TOBA 4A24A 2YUUA 2XRCA 1X4SA 4GI3C 1TBOA 9WGAA 2GKTI 1LR9A 1DS3I 2GKVA 5J8CA 1OYVI 1CGJI 1WTJA 4JCVE 5E3PA 1SGRI 3TO6A 1TBNA 1V1IA 2KCXA 2GIVA 2UZ3A 2GKRI 4B6DA 1OVOA 1DS2I 1LR7A 2DIPA 2OZUA 2OU2A 1NXUA
chains in the Genus database with same CATH topology
1WKXA 1HEVA 1P9GA 2WGCA 4MPIA 1Q9BA 7WGAA 2CWGA 1WGTA 1P9ZA 1UHAA 1K7UA 2UVOA 1K7TA 1ULKA 1K7VA 1ULMA 2X52A 9WGAA 1WGCA 2X3TA 4AMLA 2LB7A 2DKVA 4WP4A 1ULNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKX A;  1HEV A;  1P9G A;  2WGC A;  4MPI A;  1Q9B A;  7WGA A;  2CWG A;  1WGT A;  1P9Z A;  1UHA A;  1K7U A;  2UVO A;  1K7T A;  1ULK A;  1K7V A;  1ULM A;  2X52 A;  9WGA A;  1WGC A;  2X3T A;  4AML A;  2LB7 A;  2DKV A;  4WP4 A;  1ULN A; 
#chains in the Genus database with same CATH topology
 1KBE A;  2ARP F;  1TOT A;  2N1A B;  2NU0 I;  2CWF A;  1SGY I;  2YQP A;  3FSY A;  3OXL A;  3R5D A;  5E3R A;  3UGL A;  1HEV A;  2ODD A;  2V1C C;  2VRW B;  3OVO A;  2V53 A;  3CXL A;  2GVI A;  1Q9B A;  5HI7 A;  2ROW A;  2N71 A;  2CWG A;  1LR8 A;  1R0R I;  2Y0M A;  3OXF A;  1P9Z A;  3PDN A;  2B8T A;  4UXI A;  1CE3 A;  3KY9 A;  1NUB A;  2QPO A;  1CT4 I;  1Z7K B;  2JW6 A;  2KMO A;  1SGE I;  5DAE A;  2JXD A;  3TJQ A;  5FUW A;  1FYB A;  2SGD I;  2FNF X;  2OD1 A;  3D00 A;  2X52 A;  3E59 A;  2P6A C;  2SGQ I;  3UGI A;  4AML A;  5E3Q A;  1BMO A;  1MT1 A;  2DKV A;  1HDL A;  2N17 A;  1CSO I;  1FY7 A;  2LEO A;  1OMT A;  1ULN A;  2L7X A;  1PJU A;  1XX6 A;  2QQD A;  1UUC A;  1FAR A;  1PCE A;  3UOE A;  2QQC A;  2J9R A;  2L8E A;  1SGD I;  1YU6 C;  1V1H A;  3QAH A;  2ORW A;  4UXH A;  3TO9 A;  1KMA A;  1TUR A;  7WGA A;  1Y1B A;  1S20 A;  3SEK C;  5CCL A;  2BUS A;  2NU3 I;  5EX3 A;  1MJA A;  5JHW C;  2WVJ A;  1K7T A;  3BJI A;  1IY6 A;  3R5B A;  1KBF A;  1R79 A;  1ULK A;  1K7V A;  1Y1C A;  3RU0 A;  1ULM A;  1W4R A;  3UFF A;  2KMR A;  3E2I A;  1UVF A;  1WGC A;  2JA1 A;  3FC3 A;  2CJS C;  2DB6 A;  1TGS I;  1SGN I;  2N52 A;  1SGP I;  3UEJ A;  3SGB I;  4E1R A;  1X74 A;  1XBT A;  1OMU A;  5HQ8 A;  1PTQ A;  1CGI I;  1WKX A;  3OL0 A;  3UGD A;  3B4V C;  2OVO A;  2WGC A;  1CHO I;  5EX0 A;  3TO7 A;  2SGE I;  2SGF I;  2LUY A;  1M8B A;  1AN1 I;  2CWH A;  1YTP A;  2ERW A;  1WGT A;  3R5C A;  2JYY A;  1M8C A;  1Z2I A;  2E73 A;  1PTR A;  1UHA A;  2ELI A;  5FUX A;  5FUY A;  2ENZ A;  2V1C A;  4L9M A;  2QQE A;  2RC4 A;  2J87 A;  2NU1 I;  2SGP I;  4UXJ A;  1IW4 A;  4E1P A;  3QTL D;  3VDU A;  3GOX A;  4FKD A;  1BUS A;  1HJA I;  5FUV A;  2B0U C;  1Y8F A;  2M5X A;  1TIH A;  1SGQ I;  1RFH A;  2LB7 A;  2PQ8 A;  1MJB A;  1XA6 A;  2X3T A;  3HH2 C;  3R5A A;  4WP4 A;  2KMQ A;  1TUS A;  2A20 A;  2NU4 I;  1MJ9 A;  3VDP A;  4DNC A;  1H0Z A;  1HPT A;  2ENN A;  1CT2 I;  1TBQ R;  1UVG A;  1W3S A;  3TOA A;  2F3C I;  3MEK A;  1P9G A;  2ORV A;  2WCY A;  4SGB I;  5J8F A;  3FSX A;  1U5K A;  1FAQ A;  3SGQ I;  4MPI A;  4HGU A;  2K9H A;  1CT0 I;  2QQ0 A;  1VDD A;  2RIJ A;  1N13 A;  2JZM A;  3UEY A;  3VE5 A;  1K7U A;  2KMP A;  2UVO A;  2NU2 I;  5CCM A;  2W0T A;  1PPF I;  1IY5 A;  1TBR R;  2E5R A;  3OXG A;  3QWP A;  4OVO A;  3TOB A;  4A24 A;  2YUU A;  2XRC A;  1X4S A;  4GI3 C;  1TBO A;  9WGA A;  2GKT I;  1LR9 A;  1DS3 I;  2GKV A;  5J8C A;  1OYV I;  1CGJ I;  1WTJ A;  4JCV E;  5E3P A;  1SGR I;  3TO6 A;  1TBN A;  1V1I A;  2KCX A;  2GIV A;  2UZ3 A;  2GKR I;  4B6D A;  1OVO A;  1DS2 I;  1LR7 A;  2DIP A;  2OZU A;  2OU2 A;  1NXU A; 
#chains in the Genus database with same CATH homology
 1WKX A;  1HEV A;  1P9G A;  2WGC A;  4MPI A;  1Q9B A;  7WGA A;  2CWG A;  1WGT A;  1P9Z A;  1UHA A;  1K7U A;  2UVO A;  1K7T A;  1ULK A;  1K7V A;  1ULM A;  2X52 A;  9WGA A;  1WGC A;  2X3T A;  4AML A;  2LB7 A;  2DKV A;  4WP4 A;  1ULN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...