3SEKC

Crystal structure of the myostatin:follistatin-like 3 complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
201
Chain Sequence
GVCWLQATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth/differentiation factor 8
publication title Structure of myostatinfollistatin-like 3: N-terminal domains of follistatin-type molecules exhibit alternate modes of binding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 37
structure length 201
sequence length 209
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sekC02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sekC03
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 3sekC01
1UVGA 1CSOI 1LR7A 1UVFA 1TBQR 2NU4I 1YU6C 2V53A 1BUSA 2W86A 2N17A 3SGBI 2GKRI 1N13A 1IW4A 1SGPI 3SGQI 1HJAI 1UZJA 1IY5A 2KMPA 1CHOI 1H0ZA 1M8CA 1SGNI 2NU3I 4OVOA 2SGEI 2N71A 2SGDI 2LEOA 1TGSI 1PJUA 1CT4I 4GI3C 2KMQA 1Y1CA 2OVOA 1APJA 2JZMA 1SGQI 3TJQA 1UZQA 2B0UC 4HGUA 1OMTA 1CT0I 2SGPI 1UZKA 2JYYA 1HPTA 2KMOA 1CGII 2SGFI 1CE3A 1IY6A 1SGDI 3HH2C 3QTLD 1PCEA 2WCYA 1KSQA 2QQCA 1SGYI 3SEKC 1DS3I 1PPFI 1Z7KB 1TIHA 1UUCA 1MT1A 5DAEA 1OVOA 2NU1I 2M5XA 2P6AC 2KCXA 2KMRA 1LR9A 1YTPA 2ARPF 1BMOA 1TURA 1TBRR 2XRCA 5JHWC 2ERWA 2N52A 3B4VC 1OYVI 1SGEI 1SGRI 2SGQI 2BUSA 4SGBI 1FYBA 1TUSA 1UZPA 1KMAA 1M8BA 1CGJI 2QQDA 1R0RI 1CT2I 1Y1BA 3OVOA 1DS2I 2GKTI 1NUBA 1OMUA 2JXDA 2F3CI 2NU2I 1AN1I 1HDLA 2GKVA 1LR8A 2NU0I
chains in the Genus database with same CATH superfamily
1FY7A 2ENNA 1UVGA 1CSOI 3UOEA 1LR7A 1UVFA 1MJAA 1TBQR 1X4SA 2NU4I 1XA6A 1YU6C 1ULMA 2V53A 2B8TA 5CCLA 5E3QA 2ELIA 5FUYA 1BUSA 2A20A 2N17A 2W86A 2OU2A 3SGBI 2GKRI 4UXJA 1K7UA 1N13A 2V1CC 1IW4A 1TOTA 2OD1A 2LB7A 1SGPI 1U5KA 1TBOA 3SGQI 7WGAA 5HQ8A 2QPOA 1HJAI 1UZJA 1IY5A 1Y8FA 2KMPA 1R79A 1CHOI 3QAHA 2LUYA 1H0ZA 1M8CA 1PTQA 1SGNI 2NU3I 3OL0A 4OVOA 1WKXA 2GVIA 3FSYA 2N1AB 2SGEI 2N71A 1K7TA 1X74A 1P9GA 2SGDI 3QWPA 1V1IA 1K7VA 1TGSI 1WGTA 1PJUA 1CT4I 2L8EA 2LEOA 2VRWB 2WVJA 1WGCA 4GI3C 2GIVA 2J9RA 2KMQA 2JW6A 4E1RA 3TO7A 2RIJA 5J8CA 1Y1CA 2OVOA 1PTRA 3UGIA 1APJA 2JZMA 1SGQI 3R5DA 2DB6A 5EX3A 3UGDA 3PDNA 9WGAA 3TJQA 3FSXA 5HI7A 1UZQA 3R5AA 2B0UC 1MJBA 1KBEA 1OMTA 4HGUA 1MJ9A 2E5RA 1CT0I 1Q9BA 2ORWA 2J87A 5E3PA 1W4RA 1RFHA 2UVOA 5CCMA 2SGPI 1UZKA 1NXUA 2JYYA 2K9HA 3TO9A 1UHAA 1HPTA 2KMOA 4AMLA 5J8FA 1KBFA 1CGII 1ULNA 2SGFI 4UXHA 2QQ0A 4B6DA 1CE3A 3TOAA 1XX6A 2ROWA 1IY6A 1SGDI 2CJSC 2X3TA 2Y0MA 3HH2C 3QTLD 3VDUA 1PCEA 3VE5A 1WTJA 5EX0A 2JA1A 2WCYA 1ULKA 1KSQA 2QQCA 1SGYI 3SEKC 1DS3I 2ENZA 3R5CA 1PPFI 4JCVE 1Z7KB 1TIHA 3RU0A 1UUCA 2FNFX 2V1CA 4L9MA 3UEYA 1MT1A 5DAEA 1OVOA 1FARA 2NU1I 2M5XA 2P6AC 3UEJA 1TBNA 2KCXA 1V1HA 3MEKA 2KMRA 2YUUA 5FUXA 1LR9A 1YTPA 3GOXA 2QQEA 2ARPF 1BMOA 1TURA 2ORVA 2X52A 5FUVA 1FAQA 4WP4A 1TBRR 2XRCA 5JHWC 2ERWA 2N52A 5FUWA 3OXFA 3KY9A 5E3RA 2PQ8A 3B4VC 2OZUA 3VDPA 1OYVI 1S20A 3OXGA 3R5BA 1SGEI 3BJIA 2E73A 1SGRI 1P9ZA 2BUSA 2SGQI 3D00A 1W3SA 4SGBI 3TOBA 3FC3A 1FYBA 3TO6A 3E59A 4E1PA 2CWGA 1TUSA 2CWHA 2DIPA 2RC4A 3CXLA 3UFFA 2CWFA 1UZPA 4A24A 1XBTA 1KMAA 2ODDA 1CGJI 1M8BA 2QQDA 2YQPA 1R0RI 2L7XA 1CT2I 1Z2IA 4MPIA 1Y1BA 1HEVA 2WGCA 3OVOA 1DS2I 2GKTI 3UGLA 2UZ3A 3E2IA 4UXIA 4DNCA 1NUBA 1OMUA 1VDDA 2JXDA 2F3CI 2NU2I 1AN1I 1HDLA 2GKVA 1LR8A 3OXLA 2W0TA 4FKDA 2NU0I 2DKVA
chains in the Genus database with same CATH topology
2ENNA 1UVGA 1CSOI 1LR7A 1UVFA 1TBQR 1X4SA 2NU4I 1XA6A 1YU6C 2V53A 2B8TA 5CCLA 5FUYA 2ELIA 1BUSA 2W86A 2A20A 2N17A 3SGBI 2GKRI 4UXJA 1N13A 2V1CC 1IW4A 1TOTA 2OD1A 1SGPI 1U5KA 1TBOA 3SGQI 5HQ8A 2QPOA 1HJAI 1UZJA 1IY5A 1Y8FA 2KMPA 1R79A 1CHOI 2LUYA 1H0ZA 1M8CA 1PTQA 1SGNI 2NU3I 3OL0A 4OVOA 2GVIA 2N1AB 2SGEI 2N71A 1X74A 2SGDI 3QWPA 1V1IA 2LEOA 1TGSI 5FUWA 1PJUA 1CT4I 2L8EA 2WVJA 2VRWB 4GI3C 2J9RA 2KMQA 2JW6A 4E1RA 1Y1CA 2OVOA 1PTRA 3UGIA 1APJA 2JZMA 1SGQI 2DB6A 5EX3A 3UGDA 3PDNA 3TJQA 5HI7A 1UZQA 2B0UC 4HGUA 1KBEA 1OMTA 2E5RA 1CT0I 2ORWA 2J87A 1W4RA 1RFHA 5CCMA 2SGPI 1UZKA 2JYYA 2K9HA 1HPTA 2KMOA 1KBFA 1CGII 2SGFI 4UXHA 4B6DA 2QQ0A 1CE3A 1XX6A 2ROWA 1IY6A 1SGDI 2CJSC 3HH2C 3VDUA 3QTLD 3VE5A 1PCEA 5EX0A 2JA1A 2WCYA 1KSQA 2QQCA 1SGYI 3SEKC 1DS3I 2ENZA 1PPFI 4JCVE 1Z7KB 1TIHA 3RU0A 1UUCA 2FNFX 2V1CA 4L9MA 3UEYA 1MT1A 5DAEA 1OVOA 1FARA 2NU1I 2M5XA 2P6AC 3UEJA 1TBNA 2KCXA 1V1HA 3MEKA 2KMRA 2YUUA 5FUXA 1LR9A 1YTPA 3GOXA 2QQEA 2ARPF 1BMOA 1TURA 2ORVA 5FUVA 1FAQA 1TBRR 2XRCA 5JHWC 2ERWA 2N52A 3OXFA 3KY9A 3B4VC 3VDPA 1OYVI 3OXGA 1SGEI 3BJIA 2E73A 1SGRI 2SGQI 2BUSA 3D00A 4SGBI 1W3SA 3FC3A 1FYBA 3E59A 4E1PA 1TUSA 2DIPA 3CXLA 3UFFA 1UZPA 4A24A 1XBTA 1KMAA 2ODDA 1CGJI 1M8BA 2QQDA 2YQPA 1R0RI 2L7XA 1CT2I 1Y1BA 3UGLA 3OVOA 1DS2I 2GKTI 2UZ3A 3E2IA 4UXIA 1NUBA 1OMUA 1VDDA 2JXDA 2F3CI 2NU2I 1AN1I 1HDLA 2GKVA 1LR8A 3OXLA 2W0TA 4FKDA 2NU0I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UVG A;  1CSO I;  1LR7 A;  1UVF A;  1TBQ R;  2NU4 I;  1YU6 C;  2V53 A;  1BUS A;  2W86 A;  2N17 A;  3SGB I;  2GKR I;  1N13 A;  1IW4 A;  1SGP I;  3SGQ I;  1HJA I;  1UZJ A;  1IY5 A;  2KMP A;  1CHO I;  1H0Z A;  1M8C A;  1SGN I;  2NU3 I;  4OVO A;  2SGE I;  2N71 A;  2SGD I;  2LEO A;  1TGS I;  1PJU A;  1CT4 I;  4GI3 C;  2KMQ A;  1Y1C A;  2OVO A;  1APJ A;  2JZM A;  1SGQ I;  3TJQ A;  1UZQ A;  2B0U C;  4HGU A;  1OMT A;  1CT0 I;  2SGP I;  1UZK A;  2JYY A;  1HPT A;  2KMO A;  1CGI I;  2SGF I;  1CE3 A;  1IY6 A;  1SGD I;  3HH2 C;  3QTL D;  1PCE A;  2WCY A;  1KSQ A;  2QQC A;  1SGY I;  3SEK C;  1DS3 I;  1PPF I;  1Z7K B;  1TIH A;  1UUC A;  1MT1 A;  5DAE A;  1OVO A;  2NU1 I;  2M5X A;  2P6A C;  2KCX A;  2KMR A;  1LR9 A;  1YTP A;  2ARP F;  1BMO A;  1TUR A;  1TBR R;  2XRC A;  5JHW C;  2ERW A;  2N52 A;  3B4V C;  1OYV I;  1SGE I;  1SGR I;  2SGQ I;  2BUS A;  4SGB I;  1FYB A;  1TUS A;  1UZP A;  1KMA A;  1M8B A;  1CGJ I;  2QQD A;  1R0R I;  1CT2 I;  1Y1B A;  3OVO A;  1DS2 I;  2GKT I;  1NUB A;  1OMU A;  2JXD A;  2F3C I;  2NU2 I;  1AN1 I;  1HDL A;  2GKV A;  1LR8 A;  2NU0 I; 
#chains in the Genus database with same CATH topology
 1FY7 A;  2ENN A;  1UVG A;  1CSO I;  3UOE A;  1LR7 A;  1UVF A;  1MJA A;  1TBQ R;  1X4S A;  2NU4 I;  1XA6 A;  1YU6 C;  1ULM A;  2V53 A;  2B8T A;  5CCL A;  5E3Q A;  2ELI A;  5FUY A;  1BUS A;  2A20 A;  2N17 A;  2W86 A;  2OU2 A;  3SGB I;  2GKR I;  4UXJ A;  1K7U A;  1N13 A;  2V1C C;  1IW4 A;  1TOT A;  2OD1 A;  2LB7 A;  1SGP I;  1U5K A;  1TBO A;  3SGQ I;  7WGA A;  5HQ8 A;  2QPO A;  1HJA I;  1UZJ A;  1IY5 A;  1Y8F A;  2KMP A;  1R79 A;  1CHO I;  3QAH A;  2LUY A;  1H0Z A;  1M8C A;  1PTQ A;  1SGN I;  2NU3 I;  3OL0 A;  4OVO A;  1WKX A;  2GVI A;  3FSY A;  2N1A B;  2SGE I;  2N71 A;  1K7T A;  1X74 A;  1P9G A;  2SGD I;  3QWP A;  1V1I A;  1K7V A;  1TGS I;  1WGT A;  1PJU A;  1CT4 I;  2L8E A;  2LEO A;  2VRW B;  2WVJ A;  1WGC A;  4GI3 C;  2GIV A;  2J9R A;  2KMQ A;  2JW6 A;  4E1R A;  3TO7 A;  2RIJ A;  5J8C A;  1Y1C A;  2OVO A;  1PTR A;  3UGI A;  1APJ A;  2JZM A;  1SGQ I;  3R5D A;  2DB6 A;  5EX3 A;  3UGD A;  3PDN A;  9WGA A;  3TJQ A;  3FSX A;  5HI7 A;  1UZQ A;  3R5A A;  2B0U C;  1MJB A;  1KBE A;  1OMT A;  4HGU A;  1MJ9 A;  2E5R A;  1CT0 I;  1Q9B A;  2ORW A;  2J87 A;  5E3P A;  1W4R A;  1RFH A;  2UVO A;  5CCM A;  2SGP I;  1UZK A;  1NXU A;  2JYY A;  2K9H A;  3TO9 A;  1UHA A;  1HPT A;  2KMO A;  4AML A;  5J8F A;  1KBF A;  1CGI I;  1ULN A;  2SGF I;  4UXH A;  2QQ0 A;  4B6D A;  1CE3 A;  3TOA A;  1XX6 A;  2ROW A;  1IY6 A;  1SGD I;  2CJS C;  2X3T A;  2Y0M A;  3HH2 C;  3QTL D;  3VDU A;  1PCE A;  3VE5 A;  1WTJ A;  5EX0 A;  2JA1 A;  2WCY A;  1ULK A;  1KSQ A;  2QQC A;  1SGY I;  3SEK C;  1DS3 I;  2ENZ A;  3R5C A;  1PPF I;  4JCV E;  1Z7K B;  1TIH A;  3RU0 A;  1UUC A;  2FNF X;  2V1C A;  4L9M A;  3UEY A;  1MT1 A;  5DAE A;  1OVO A;  1FAR A;  2NU1 I;  2M5X A;  2P6A C;  3UEJ A;  1TBN A;  2KCX A;  1V1H A;  3MEK A;  2KMR A;  2YUU A;  5FUX A;  1LR9 A;  1YTP A;  3GOX A;  2QQE A;  2ARP F;  1BMO A;  1TUR A;  2ORV A;  2X52 A;  5FUV A;  1FAQ A;  4WP4 A;  1TBR R;  2XRC A;  5JHW C;  2ERW A;  2N52 A;  5FUW A;  3OXF A;  3KY9 A;  5E3R A;  2PQ8 A;  3B4V C;  2OZU A;  3VDP A;  1OYV I;  1S20 A;  3OXG A;  3R5B A;  1SGE I;  3BJI A;  2E73 A;  1SGR I;  1P9Z A;  2BUS A;  2SGQ I;  3D00 A;  1W3S A;  4SGB I;  3TOB A;  3FC3 A;  1FYB A;  3TO6 A;  3E59 A;  4E1P A;  2CWG A;  1TUS A;  2CWH A;  2DIP A;  2RC4 A;  3CXL A;  3UFF A;  2CWF A;  1UZP A;  4A24 A;  1XBT A;  1KMA A;  2ODD A;  1CGJ I;  1M8B A;  2QQD A;  2YQP A;  1R0R I;  2L7X A;  1CT2 I;  1Z2I A;  4MPI A;  1Y1B A;  1HEV A;  2WGC A;  3OVO A;  1DS2 I;  2GKT I;  3UGL A;  2UZ3 A;  3E2I A;  4UXI A;  4DNC A;  1NUB A;  1OMU A;  1VDD A;  2JXD A;  2F3C I;  2NU2 I;  1AN1 I;  1HDL A;  2GKV A;  1LR8 A;  3OXL A;  2W0T A;  4FKD A;  2NU0 I;  2DKV A; 
#chains in the Genus database with same CATH homology
 2ENN A;  1UVG A;  1CSO I;  1LR7 A;  1UVF A;  1TBQ R;  1X4S A;  2NU4 I;  1XA6 A;  1YU6 C;  2V53 A;  2B8T A;  5CCL A;  5FUY A;  2ELI A;  1BUS A;  2W86 A;  2A20 A;  2N17 A;  3SGB I;  2GKR I;  4UXJ A;  1N13 A;  2V1C C;  1IW4 A;  1TOT A;  2OD1 A;  1SGP I;  1U5K A;  1TBO A;  3SGQ I;  5HQ8 A;  2QPO A;  1HJA I;  1UZJ A;  1IY5 A;  1Y8F A;  2KMP A;  1R79 A;  1CHO I;  2LUY A;  1H0Z A;  1M8C A;  1PTQ A;  1SGN I;  2NU3 I;  3OL0 A;  4OVO A;  2GVI A;  2N1A B;  2SGE I;  2N71 A;  1X74 A;  2SGD I;  3QWP A;  1V1I A;  2LEO A;  1TGS I;  5FUW A;  1PJU A;  1CT4 I;  2L8E A;  2WVJ A;  2VRW B;  4GI3 C;  2J9R A;  2KMQ A;  2JW6 A;  4E1R A;  1Y1C A;  2OVO A;  1PTR A;  3UGI A;  1APJ A;  2JZM A;  1SGQ I;  2DB6 A;  5EX3 A;  3UGD A;  3PDN A;  3TJQ A;  5HI7 A;  1UZQ A;  2B0U C;  4HGU A;  1KBE A;  1OMT A;  2E5R A;  1CT0 I;  2ORW A;  2J87 A;  1W4R A;  1RFH A;  5CCM A;  2SGP I;  1UZK A;  2JYY A;  2K9H A;  1HPT A;  2KMO A;  1KBF A;  1CGI I;  2SGF I;  4UXH A;  4B6D A;  2QQ0 A;  1CE3 A;  1XX6 A;  2ROW A;  1IY6 A;  1SGD I;  2CJS C;  3HH2 C;  3VDU A;  3QTL D;  3VE5 A;  1PCE A;  5EX0 A;  2JA1 A;  2WCY A;  1KSQ A;  2QQC A;  1SGY I;  3SEK C;  1DS3 I;  2ENZ A;  1PPF I;  4JCV E;  1Z7K B;  1TIH A;  3RU0 A;  1UUC A;  2FNF X;  2V1C A;  4L9M A;  3UEY A;  1MT1 A;  5DAE A;  1OVO A;  1FAR A;  2NU1 I;  2M5X A;  2P6A C;  3UEJ A;  1TBN A;  2KCX A;  1V1H A;  3MEK A;  2KMR A;  2YUU A;  5FUX A;  1LR9 A;  1YTP A;  3GOX A;  2QQE A;  2ARP F;  1BMO A;  1TUR A;  2ORV A;  5FUV A;  1FAQ A;  1TBR R;  2XRC A;  5JHW C;  2ERW A;  2N52 A;  3OXF A;  3KY9 A;  3B4V C;  3VDP A;  1OYV I;  3OXG A;  1SGE I;  3BJI A;  2E73 A;  1SGR I;  2SGQ I;  2BUS A;  3D00 A;  4SGB I;  1W3S A;  3FC3 A;  1FYB A;  3E59 A;  4E1P A;  1TUS A;  2DIP A;  3CXL A;  3UFF A;  1UZP A;  4A24 A;  1XBT A;  1KMA A;  2ODD A;  1CGJ I;  1M8B A;  2QQD A;  2YQP A;  1R0R I;  2L7X A;  1CT2 I;  1Y1B A;  3UGL A;  3OVO A;  1DS2 I;  2GKT I;  2UZ3 A;  3E2I A;  4UXI A;  1NUB A;  1OMU A;  1VDD A;  2JXD A;  2F3C I;  2NU2 I;  1AN1 I;  1HDL A;  2GKV A;  1LR8 A;  3OXL A;  2W0T A;  4FKD A;  2NU0 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...