3SEKC

Crystal structure of the myostatin:follistatin-like 3 complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
201
Chain Sequence
GVCWLQATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Growth/differentiation factor 8
publication title Structure of myostatinfollistatin-like 3: N-terminal domains of follistatin-type molecules exhibit alternate modes of binding.
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 201
sequence length 209
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sekC02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sekC03
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 3sekC01
1HDLA 1APJA 1CGII 1OMUA 1SGQI 2NU4I 2QQDA 1SGEI 2NU0I 1Y1BA 1TUSA 1N13A 3OVOA 2B0UC 2V53A 1UZKA 2GKVA 1CT0I 2SGFI 3HH2C 3QTLD 1SGYI 1PCEA 1H0ZA 1TBRR 2GKTI 2W86A 1TGSI 5DAEA 3TJQA 2ARPF 2JXDA 1LR8A 1UUCA 2KMRA 1KSQA 1IW4A 2N52A 2KMOA 2KMQA 1DS3I 1PPFI 1TIHA 2P6AC 3SGBI 2NU1I 1OVOA 1IY5A 1UVFA 1CT2I 2SGDI 1DS2I 4SGBI 1LR7A 2OVOA 1NUBA 1CSOI 4HGUA 3SEKC 1Z7KB 2SGEI 1R0RI 2XRCA 1SGRI 2NU3I 1YU6C 1CT4I 2QQCA 2NU2I 3SGQI 1UZPA 2LEOA 1BMOA 1OMTA 1BUSA 1M8CA 2KMPA 2N17A 3B4VC 1TURA 2JZMA 2KCXA 1CHOI 1LR9A 4GI3C 1TBQR 1CGJI 2SGPI 1OYVI 1PJUA 2JYYA 1UZQA 1M8BA 2SGQI 2M5XA 1SGPI 2N71A 1CE3A 1AN1I 1HJAI 1SGNI 1SGDI 5JHWC 4OVOA 1FYBA 1Y1CA 2BUSA 2GKRI 1UZJA 2F3CI 1HPTA 1KMAA 2WCYA 1UVGA 1MT1A 1YTPA 2ERWA 1IY6A
chains in the Genus database with same CATH superfamily
1HDLA 1UHAA 1APJA 1MJ9A 1CGII 1OMUA 1SGQI 2OD1A 2LB7A 2UZ3A 3FSYA 2WVJA 5E3PA 3QAHA 3UEJA 5J8FA 2NU4I 2QQDA 1SGEI 2NU0I 2OZUA 5HI7A 4B6DA 2WGCA 1Y1BA 3UOEA 1TUSA 2CWGA 2UVOA 4L9MA 1U5KA 1W4RA 4UXJA 2W0TA 2ORVA 1N13A 3OVOA 3OXGA 2B0UC 2V53A 3TOAA 4A24A 1UZKA 2X52A 2GKVA 4MPIA 1CT0I 1K7VA 3R5AA 3VDPA 3VDUA 2L8EA 2SGFI 3CXLA 3HH2C 3QTLD 1SGYI 1PCEA 1RFHA 1W3SA 1TBRR 3FSXA 3TO9A 2RIJA 3UGDA 1H0ZA 2GKTI 1HEVA 2W86A 2VRWB 3MEKA 1TGSI 1WTJA 5DAEA 3E59A 3TJQA 2ARPF 4UXHA 4JCVE 2JXDA 1LR8A 1UUCA 2KMRA 1PTRA 1KSQA 2GVIA 2K9HA 1IW4A 2N52A 2KMOA 4DNCA 3FC3A 2KMQA 1DS3I 2CJSC 3PDNA 1Z2IA 5FUWA 1WKXA 2CWFA 1K7UA 1KBEA 1PPFI 1TIHA 1FY7A 1XX6A 2JA1A 3OXFA 2P6AC 5E3QA 1MJBA 2E5RA 2YQPA 1R79A 3SGBI 4AMLA 2NU1I 1S20A 1OVOA 1IY5A 1UVFA 2LUYA 1CT2I 2ENNA 2E73A 1DS2I 2SGDI 2V1CC 1LR7A 2OVOA 3R5CA 4SGBI 1NUBA 1CSOI 4HGUA 3OXLA 3SEKC 1XA6A 1FARA 2DIPA 4WP4A 3GOXA 1Z7KB 2ENZA 1R0RI 2SGEI 2YUUA 5EX3A 2JW6A 1TBNA 1MJAA 1TBOA 1PTQA 7WGAA 2XRCA 1SGRI 2GIVA 2NU3I 1YU6C 1ULKA 2DB6A 1CT4I 2ELIA 2J87A 1Q9BA 2NU2I 2ODDA 2QQCA 2QQEA 2ROWA 2RC4A 3R5BA 1P9GA 3SGQI 1UZPA 2LEOA 1BMOA 1OMTA 3BJIA 5FUVA 3VE5A 3UEYA 1V1HA 3QWPA 1BUSA 1M8CA 3D00A 2KMPA 2ORWA 1WGCA 9WGAA 2N17A 5J8CA 1NXUA 1WGTA 3B4VC 1TURA 3OL0A 2L7XA 2N1AB 2JZMA 2PQ8A 1P9ZA 2DKVA 1V1IA 2KCXA 5CCLA 4FKDA 1CHOI 2FNFX 1LR9A 4GI3C 3RU0A 5CCMA 5E3RA 1TBQR 1ULMA 3KY9A 1CGJI 2SGPI 2B8TA 1OYVI 1PJUA 4E1PA 2JYYA 1X74A 3UGLA 1X4SA 5EX0A 1UZQA 1M8BA 2QQ0A 1FAQA 2SGQI 2CWHA 2M5XA 1XBTA 1Y8FA 2Y0MA 1SGPI 2N71A 2A20A 1CE3A 3E2IA 1AN1I 1HJAI 1SGNI 1SGDI 5JHWC 4OVOA 1ULNA 2J9RA 1TOTA 1FYBA 1Y1CA 1VDDA 2BUSA 2GKRI 1KBFA 1UZJA 4E1RA 2QPOA 3TOBA 2F3CI 3UFFA 3TO6A 3R5DA 4UXIA 1HPTA 5HQ8A 3TO7A 1KMAA 3UGIA 2WCYA 5FUXA 2X3TA 1K7TA 1UVGA 2OU2A 1MT1A 1YTPA 5FUYA 2V1CA 2ERWA 1IY6A
chains in the Genus database with same CATH topology
1HDLA 1APJA 1CGII 1OMUA 1SGQI 2OD1A 2UZ3A 2WVJA 3UEJA 2NU4I 2QQDA 1SGEI 2NU0I 5HI7A 4B6DA 1Y1BA 1TUSA 4L9MA 1U5KA 1W4RA 4UXJA 2W0TA 2ORVA 1N13A 3OVOA 3OXGA 2B0UC 2V53A 4A24A 1UZKA 2GKVA 1CT0I 3VDPA 3VDUA 2L8EA 2SGFI 3CXLA 3HH2C 3QTLD 1SGYI 1PCEA 1RFHA 1W3SA 1TBRR 3UGDA 1H0ZA 2GKTI 2W86A 2VRWB 3MEKA 1TGSI 5DAEA 3E59A 3TJQA 2ARPF 4UXHA 4JCVE 2JXDA 1LR8A 1UUCA 2KMRA 1PTRA 1KSQA 2GVIA 2K9HA 1IW4A 2N52A 2KMOA 3FC3A 2KMQA 1DS3I 2CJSC 3PDNA 5FUWA 1KBEA 1PPFI 1TIHA 2JA1A 1XX6A 3OXFA 2P6AC 2E5RA 2YQPA 1R79A 3SGBI 2NU1I 1OVOA 1IY5A 1UVFA 2LUYA 1CT2I 2ENNA 2E73A 1DS2I 2SGDI 2V1CC 1LR7A 2OVOA 4SGBI 1NUBA 1CSOI 4HGUA 3OXLA 3SEKC 1XA6A 1FARA 2DIPA 3GOXA 1Z7KB 2ENZA 1R0RI 2SGEI 2YUUA 5EX3A 2JW6A 1TBNA 1TBOA 1PTQA 2XRCA 1SGRI 2NU3I 1YU6C 2DB6A 1CT4I 2ELIA 2J87A 2ODDA 2NU2I 2QQCA 2QQEA 2ROWA 3SGQI 1UZPA 2LEOA 1BMOA 1OMTA 3BJIA 5FUVA 3VE5A 3UEYA 1V1HA 3QWPA 1BUSA 1M8CA 3D00A 2KMPA 2ORWA 2N17A 3B4VC 1TURA 3OL0A 2L7XA 2N1AB 2JZMA 2KCXA 1V1IA 5CCLA 4FKDA 1CHOI 2FNFX 1LR9A 4GI3C 3RU0A 5CCMA 1TBQR 3KY9A 1CGJI 2SGPI 2B8TA 1OYVI 1PJUA 4E1PA 2JYYA 1X74A 3UGLA 1X4SA 5EX0A 1UZQA 1M8BA 2QQ0A 1FAQA 2SGQI 2M5XA 1XBTA 1Y8FA 1SGPI 2N71A 2A20A 1CE3A 3E2IA 1AN1I 1HJAI 1SGNI 1SGDI 5JHWC 4OVOA 2J9RA 1TOTA 1FYBA 1Y1CA 1VDDA 2BUSA 2GKRI 1KBFA 1UZJA 4E1RA 2QPOA 2F3CI 3UFFA 4UXIA 1HPTA 5HQ8A 1KMAA 3UGIA 2WCYA 5FUXA 1UVGA 1MT1A 1YTPA 5FUYA 2V1CA 2ERWA 1IY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HDL A;  1APJ A;  1CGI I;  1OMU A;  1SGQ I;  2NU4 I;  2QQD A;  1SGE I;  2NU0 I;  1Y1B A;  1TUS A;  1N13 A;  3OVO A;  2B0U C;  2V53 A;  1UZK A;  2GKV A;  1CT0 I;  2SGF I;  3HH2 C;  3QTL D;  1SGY I;  1PCE A;  1H0Z A;  1TBR R;  2GKT I;  2W86 A;  1TGS I;  5DAE A;  3TJQ A;  2ARP F;  2JXD A;  1LR8 A;  1UUC A;  2KMR A;  1KSQ A;  1IW4 A;  2N52 A;  2KMO A;  2KMQ A;  1DS3 I;  1PPF I;  1TIH A;  2P6A C;  3SGB I;  2NU1 I;  1OVO A;  1IY5 A;  1UVF A;  1CT2 I;  2SGD I;  1DS2 I;  4SGB I;  1LR7 A;  2OVO A;  1NUB A;  1CSO I;  4HGU A;  3SEK C;  1Z7K B;  2SGE I;  1R0R I;  2XRC A;  1SGR I;  2NU3 I;  1YU6 C;  1CT4 I;  2QQC A;  2NU2 I;  3SGQ I;  1UZP A;  2LEO A;  1BMO A;  1OMT A;  1BUS A;  1M8C A;  2KMP A;  2N17 A;  3B4V C;  1TUR A;  2JZM A;  2KCX A;  1CHO I;  1LR9 A;  4GI3 C;  1TBQ R;  1CGJ I;  2SGP I;  1OYV I;  1PJU A;  2JYY A;  1UZQ A;  1M8B A;  2SGQ I;  2M5X A;  1SGP I;  2N71 A;  1CE3 A;  1AN1 I;  1HJA I;  1SGN I;  1SGD I;  5JHW C;  4OVO A;  1FYB A;  1Y1C A;  2BUS A;  2GKR I;  1UZJ A;  2F3C I;  1HPT A;  1KMA A;  2WCY A;  1UVG A;  1MT1 A;  1YTP A;  2ERW A;  1IY6 A; 
#chains in the Genus database with same CATH topology
 1HDL A;  1UHA A;  1APJ A;  1MJ9 A;  1CGI I;  1OMU A;  1SGQ I;  2OD1 A;  2LB7 A;  2UZ3 A;  3FSY A;  2WVJ A;  5E3P A;  3QAH A;  3UEJ A;  5J8F A;  2NU4 I;  2QQD A;  1SGE I;  2NU0 I;  2OZU A;  5HI7 A;  4B6D A;  2WGC A;  1Y1B A;  3UOE A;  1TUS A;  2CWG A;  2UVO A;  4L9M A;  1U5K A;  1W4R A;  4UXJ A;  2W0T A;  2ORV A;  1N13 A;  3OVO A;  3OXG A;  2B0U C;  2V53 A;  3TOA A;  4A24 A;  1UZK A;  2X52 A;  2GKV A;  4MPI A;  1CT0 I;  1K7V A;  3R5A A;  3VDP A;  3VDU A;  2L8E A;  2SGF I;  3CXL A;  3HH2 C;  3QTL D;  1SGY I;  1PCE A;  1RFH A;  1W3S A;  1TBR R;  3FSX A;  3TO9 A;  2RIJ A;  3UGD A;  1H0Z A;  2GKT I;  1HEV A;  2W86 A;  2VRW B;  3MEK A;  1TGS I;  1WTJ A;  5DAE A;  3E59 A;  3TJQ A;  2ARP F;  4UXH A;  4JCV E;  2JXD A;  1LR8 A;  1UUC A;  2KMR A;  1PTR A;  1KSQ A;  2GVI A;  2K9H A;  1IW4 A;  2N52 A;  2KMO A;  4DNC A;  3FC3 A;  2KMQ A;  1DS3 I;  2CJS C;  3PDN A;  1Z2I A;  5FUW A;  1WKX A;  2CWF A;  1K7U A;  1KBE A;  1PPF I;  1TIH A;  1FY7 A;  1XX6 A;  2JA1 A;  3OXF A;  2P6A C;  5E3Q A;  1MJB A;  2E5R A;  2YQP A;  1R79 A;  3SGB I;  4AML A;  2NU1 I;  1S20 A;  1OVO A;  1IY5 A;  1UVF A;  2LUY A;  1CT2 I;  2ENN A;  2E73 A;  1DS2 I;  2SGD I;  2V1C C;  1LR7 A;  2OVO A;  3R5C A;  4SGB I;  1NUB A;  1CSO I;  4HGU A;  3OXL A;  3SEK C;  1XA6 A;  1FAR A;  2DIP A;  4WP4 A;  3GOX A;  1Z7K B;  2ENZ A;  1R0R I;  2SGE I;  2YUU A;  5EX3 A;  2JW6 A;  1TBN A;  1MJA A;  1TBO A;  1PTQ A;  7WGA A;  2XRC A;  1SGR I;  2GIV A;  2NU3 I;  1YU6 C;  1ULK A;  2DB6 A;  1CT4 I;  2ELI A;  2J87 A;  1Q9B A;  2NU2 I;  2ODD A;  2QQC A;  2QQE A;  2ROW A;  2RC4 A;  3R5B A;  1P9G A;  3SGQ I;  1UZP A;  2LEO A;  1BMO A;  1OMT A;  3BJI A;  5FUV A;  3VE5 A;  3UEY A;  1V1H A;  3QWP A;  1BUS A;  1M8C A;  3D00 A;  2KMP A;  2ORW A;  1WGC A;  9WGA A;  2N17 A;  5J8C A;  1NXU A;  1WGT A;  3B4V C;  1TUR A;  3OL0 A;  2L7X A;  2N1A B;  2JZM A;  2PQ8 A;  1P9Z A;  2DKV A;  1V1I A;  2KCX A;  5CCL A;  4FKD A;  1CHO I;  2FNF X;  1LR9 A;  4GI3 C;  3RU0 A;  5CCM A;  5E3R A;  1TBQ R;  1ULM A;  3KY9 A;  1CGJ I;  2SGP I;  2B8T A;  1OYV I;  1PJU A;  4E1P A;  2JYY A;  1X74 A;  3UGL A;  1X4S A;  5EX0 A;  1UZQ A;  1M8B A;  2QQ0 A;  1FAQ A;  2SGQ I;  2CWH A;  2M5X A;  1XBT A;  1Y8F A;  2Y0M A;  1SGP I;  2N71 A;  2A20 A;  1CE3 A;  3E2I A;  1AN1 I;  1HJA I;  1SGN I;  1SGD I;  5JHW C;  4OVO A;  1ULN A;  2J9R A;  1TOT A;  1FYB A;  1Y1C A;  1VDD A;  2BUS A;  2GKR I;  1KBF A;  1UZJ A;  4E1R A;  2QPO A;  3TOB A;  2F3C I;  3UFF A;  3TO6 A;  3R5D A;  4UXI A;  1HPT A;  5HQ8 A;  3TO7 A;  1KMA A;  3UGI A;  2WCY A;  5FUX A;  2X3T A;  1K7T A;  1UVG A;  2OU2 A;  1MT1 A;  1YTP A;  5FUY A;  2V1C A;  2ERW A;  1IY6 A; 
#chains in the Genus database with same CATH homology
 1HDL A;  1APJ A;  1CGI I;  1OMU A;  1SGQ I;  2OD1 A;  2UZ3 A;  2WVJ A;  3UEJ A;  2NU4 I;  2QQD A;  1SGE I;  2NU0 I;  5HI7 A;  4B6D A;  1Y1B A;  1TUS A;  4L9M A;  1U5K A;  1W4R A;  4UXJ A;  2W0T A;  2ORV A;  1N13 A;  3OVO A;  3OXG A;  2B0U C;  2V53 A;  4A24 A;  1UZK A;  2GKV A;  1CT0 I;  3VDP A;  3VDU A;  2L8E A;  2SGF I;  3CXL A;  3HH2 C;  3QTL D;  1SGY I;  1PCE A;  1RFH A;  1W3S A;  1TBR R;  3UGD A;  1H0Z A;  2GKT I;  2W86 A;  2VRW B;  3MEK A;  1TGS I;  5DAE A;  3E59 A;  3TJQ A;  2ARP F;  4UXH A;  4JCV E;  2JXD A;  1LR8 A;  1UUC A;  2KMR A;  1PTR A;  1KSQ A;  2GVI A;  2K9H A;  1IW4 A;  2N52 A;  2KMO A;  3FC3 A;  2KMQ A;  1DS3 I;  2CJS C;  3PDN A;  5FUW A;  1KBE A;  1PPF I;  1TIH A;  2JA1 A;  1XX6 A;  3OXF A;  2P6A C;  2E5R A;  2YQP A;  1R79 A;  3SGB I;  2NU1 I;  1OVO A;  1IY5 A;  1UVF A;  2LUY A;  1CT2 I;  2ENN A;  2E73 A;  1DS2 I;  2SGD I;  2V1C C;  1LR7 A;  2OVO A;  4SGB I;  1NUB A;  1CSO I;  4HGU A;  3OXL A;  3SEK C;  1XA6 A;  1FAR A;  2DIP A;  3GOX A;  1Z7K B;  2ENZ A;  1R0R I;  2SGE I;  2YUU A;  5EX3 A;  2JW6 A;  1TBN A;  1TBO A;  1PTQ A;  2XRC A;  1SGR I;  2NU3 I;  1YU6 C;  2DB6 A;  1CT4 I;  2ELI A;  2J87 A;  2ODD A;  2NU2 I;  2QQC A;  2QQE A;  2ROW A;  3SGQ I;  1UZP A;  2LEO A;  1BMO A;  1OMT A;  3BJI A;  5FUV A;  3VE5 A;  3UEY A;  1V1H A;  3QWP A;  1BUS A;  1M8C A;  3D00 A;  2KMP A;  2ORW A;  2N17 A;  3B4V C;  1TUR A;  3OL0 A;  2L7X A;  2N1A B;  2JZM A;  2KCX A;  1V1I A;  5CCL A;  4FKD A;  1CHO I;  2FNF X;  1LR9 A;  4GI3 C;  3RU0 A;  5CCM A;  1TBQ R;  3KY9 A;  1CGJ I;  2SGP I;  2B8T A;  1OYV I;  1PJU A;  4E1P A;  2JYY A;  1X74 A;  3UGL A;  1X4S A;  5EX0 A;  1UZQ A;  1M8B A;  2QQ0 A;  1FAQ A;  2SGQ I;  2M5X A;  1XBT A;  1Y8F A;  1SGP I;  2N71 A;  2A20 A;  1CE3 A;  3E2I A;  1AN1 I;  1HJA I;  1SGN I;  1SGD I;  5JHW C;  4OVO A;  2J9R A;  1TOT A;  1FYB A;  1Y1C A;  1VDD A;  2BUS A;  2GKR I;  1KBF A;  1UZJ A;  4E1R A;  2QPO A;  2F3C I;  3UFF A;  4UXI A;  1HPT A;  5HQ8 A;  1KMA A;  3UGI A;  2WCY A;  5FUX A;  1UVG A;  1MT1 A;  1YTP A;  5FUY A;  2V1C A;  2ERW A;  1IY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...