3SEKC

Crystal structure of the myostatin:follistatin-like 3 complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
201
Chain Sequence
GVCWLQATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth/differentiation factor 8
publication title Structure of myostatinfollistatin-like 3: N-terminal domains of follistatin-type molecules exhibit alternate modes of binding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 37
structure length 201
sequence length 209
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
C PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sekC02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sekC03
3.90.290.10 Alpha Beta Alpha-Beta Complex Extracellular Matrix Fibrillin TGF-beta binding (TB) domain 3sekC01
1SGRI 1OMUA 2M5XA 1PPFI 5JHWC 1MT1A 2SGEI 2F3CI 1SGNI 4SGBI 1IY6A 2B0UC 1OVOA 2NU1I 4GI3C 1CSOI 2GKTI 1NUBA 2QQDA 1TGSI 1UZQA 2NU2I 1UZKA 2ERWA 2N71A 1IY5A 1PCEA 2BUSA 2LEOA 3B4VC 1HDLA 3TJQA 1KSQA 1KMAA 1FYBA 2NU4I 2N52A 2SGPI 1TBQR 1LR9A 2GKVA 1HPTA 1OMTA 1SGQI 2WCYA 1BUSA 1TURA 1PJUA 1UVGA 1CE3A 1CT2I 1CT0I 1TUSA 2SGQI 2V53A 3OVOA 1SGPI 2KCXA 2SGDI 2KMRA 1UZJA 1M8BA 1CT4I 2JXDA 2NU3I 1N13A 3QTLD 3SGQI 1TBRR 2XRCA 2JYYA 2P6AC 1DS2I 1DS3I 4HGUA 1CGJI 5DAEA 1UUCA 1APJA 1OYVI 2N17A 1YU6C 1AN1I 2SGFI 1BMOA 2KMOA 1R0RI 1CHOI 1TIHA 1Z7KB 1UVFA 2JZMA 1HJAI 1M8CA 1LR8A 2QQCA 2W86A 2OVOA 1SGYI 2NU0I 3SEKC 3HH2C 1SGDI 1IW4A 2ARPF 1Y1BA 3SGBI 2KMPA 2KMQA 1SGEI 1H0ZA 1YTPA 2GKRI 1LR7A 4OVOA 1Y1CA 1UZPA 1CGII
chains in the Genus database with same CATH superfamily
1SGRI 5E3RA 1PTRA 1OMUA 2DB6A 2M5XA 1PPFI 3OXLA 2WGCA 1MT1A 4B6DA 2SGEI 5JHWC 2F3CI 5HQ8A 1SGNI 2W0TA 4SGBI 1IY6A 2L8EA 2ROWA 1Z2IA 2B0UC 1OVOA 1XA6A 1X4SA 2NU1I 2RIJA 4GI3C 2B8TA 2JA1A 1CSOI 2CWGA 5FUWA 2GKTI 1WTJA 4DNCA 1NUBA 2UVOA 2QQDA 2ORVA 5E3QA 9WGAA 1TGSI 1FY7A 2X52A 2NU2I 2GIVA 1UZQA 3UGLA 3OXFA 2Y0MA 1UZKA 2ERWA 2N71A 2J9RA 3GOXA 1IY5A 2CWFA 1PCEA 2BUSA 2LEOA 5EX0A 3B4VC 1HDLA 2UZ3A 2CWHA 3MEKA 3TJQA 3BJIA 2QQEA 1TBOA 2GVIA 1KSQA 1WGCA 1UZPA 1KMAA 1FYBA 2QPOA 2NU4I 3VDPA 3UFFA 2N52A 4WP4A 2SGPI 1TBQR 5FUYA 2RC4A 3QAHA 1LR9A 1V1IA 2GKVA 1HPTA 1OMTA 1SGQI 1MJBA 3UOEA 1MJAA 4AMLA 1S20A 3FC3A 2WCYA 1BUSA 5FUVA 3UGIA 2E73A 1V1HA 1TURA 2QQ0A 2N1AB 1PJUA 1UVGA 2ELIA 1CE3A 1CT2I 1CT0I 1TUSA 5EX3A 2E5RA 2SGQI 2OU2A 2V53A 3R5CA 3OVOA 2A20A 1WKXA 3E2IA 2ENNA 1SGPI 1TOTA 1P9ZA 2CJSC 2KCXA 2SGDI 5J8FA 2KMRA 3E59A 7WGAA 1FAQA 2OZUA 1UZJA 1K7TA 1M8BA 5HI7A 1KBFA 4MPIA 1CT4I 3FSXA 2JXDA 2NU3I 3R5DA 3QWPA 1N13A 2DIPA 3QTLD 4A24A 1ULNA 3UEJA 2FNFX 3SGQI 3TO7A 1P9GA 1TBRR 2XRCA 2JYYA 2ODDA 3OL0A 2P6AC 2YUUA 2LUYA 4FKDA 1DS2I 3VDUA 2DKVA 1WGTA 2V1CC 3R5AA 5CCLA 1DS3I 4HGUA 1CGJI 5DAEA 1ULKA 1UUCA 4JCVE 5CCMA 5J8CA 1APJA 1OYVI 2N17A 2JW6A 1YU6C 1X74A 2PQ8A 2YQPA 2K9HA 1FARA 2WVJA 5FUXA 4E1PA 1AN1I 2SGFI 1XBTA 1BMOA 1NXUA 2KMOA 1R0RI 3UGDA 1CHOI 3TO6A 1K7UA 3CXLA 1TIHA 1Z7KB 3TO9A 1UVFA 2VRWB 4E1RA 5E3PA 2JZMA 2ENZA 1HJAI 3PDNA 4UXJA 1M8CA 1LR8A 2QQCA 2W86A 1R79A 2LB7A 1Y8FA 2OD1A 3R5BA 2OVOA 4UXHA 1SGYI 1RFHA 2NU0I 1Q9BA 2V1CA 1SGDI 2J87A 3HH2C 3SEKC 3UEYA 2X3TA 1IW4A 1U5KA 1Y1BA 2ARPF 2L7XA 3SGBI 1VDDA 3D00A 3FSYA 3TOBA 2KMPA 2KMQA 1TBNA 4L9MA 1ULMA 1SGEI 1XX6A 1H0ZA 3VE5A 1YTPA 4UXIA 1UHAA 2ORWA 3RU0A 2GKRI 1HEVA 1K7VA 3OXGA 1W3SA 3KY9A 3TOAA 1KBEA 1LR7A 1MJ9A 4OVOA 1W4RA 1Y1CA 1PTQA 1CGII
chains in the Genus database with same CATH topology
1SGRI 1PTRA 1OMUA 2DB6A 2M5XA 1PPFI 3OXLA 4B6DA 1MT1A 5JHWC 2SGEI 2F3CI 5HQ8A 1SGNI 2W0TA 4SGBI 1IY6A 2L8EA 2ROWA 2B0UC 1OVOA 1XA6A 1X4SA 2NU1I 4GI3C 2B8TA 2JA1A 1CSOI 5FUWA 2GKTI 1NUBA 2QQDA 2ORVA 1TGSI 1UZQA 2NU2I 3UGLA 3OXFA 1UZKA 2ERWA 2N71A 2J9RA 3GOXA 1IY5A 1PCEA 2BUSA 2LEOA 5EX0A 3B4VC 1HDLA 2UZ3A 3MEKA 3TJQA 3BJIA 2QQEA 1TBOA 2GVIA 1KSQA 1UZPA 1KMAA 1FYBA 2QPOA 2NU4I 3VDPA 3UFFA 2N52A 2SGPI 1TBQR 5FUYA 1LR9A 1V1IA 2GKVA 1HPTA 1OMTA 1SGQI 3FC3A 2WCYA 1BUSA 5FUVA 3UGIA 2E73A 1V1HA 1TURA 2QQ0A 2N1AB 1PJUA 1UVGA 2ELIA 1CE3A 1CT2I 1CT0I 1TUSA 5EX3A 2E5RA 2SGQI 2V53A 3OVOA 2A20A 3E2IA 2ENNA 1SGPI 1TOTA 2KCXA 2CJSC 2SGDI 2KMRA 3E59A 1FAQA 1UZJA 1M8BA 5HI7A 1KBFA 1CT4I 2JXDA 2NU3I 3QWPA 1N13A 2DIPA 3QTLD 4A24A 3UEJA 2FNFX 3SGQI 1TBRR 2XRCA 2JYYA 2ODDA 3OL0A 2P6AC 2YUUA 2LUYA 4FKDA 1DS2I 3VDUA 5CCLA 2V1CC 1DS3I 4HGUA 1CGJI 5DAEA 1UUCA 4JCVE 5CCMA 1APJA 1OYVI 2N17A 2JW6A 1YU6C 1X74A 2YQPA 5FUXA 2K9HA 1FARA 2WVJA 4E1PA 1AN1I 2SGFI 1XBTA 1BMOA 2KMOA 1R0RI 3UGDA 1CHOI 3CXLA 1TIHA 1Z7KB 1UVFA 2VRWB 4E1RA 2JZMA 2ENZA 1HJAI 3PDNA 4UXJA 1M8CA 1LR8A 2QQCA 2W86A 1R79A 1Y8FA 2OD1A 2OVOA 4UXHA 1SGYI 1RFHA 2NU0I 2V1CA 3HH2C 1SGDI 2J87A 3SEKC 3UEYA 1IW4A 1U5KA 1Y1BA 2ARPF 2L7XA 3SGBI 1VDDA 3D00A 2KMPA 2KMQA 1TBNA 4L9MA 1SGEI 1XX6A 1H0ZA 3VE5A 1YTPA 4UXIA 2ORWA 3RU0A 2GKRI 3OXGA 1W3SA 3KY9A 1KBEA 1LR7A 4OVOA 1W4RA 1Y1CA 1PTQA 1CGII
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGR I;  1OMU A;  2M5X A;  1PPF I;  5JHW C;  1MT1 A;  2SGE I;  2F3C I;  1SGN I;  4SGB I;  1IY6 A;  2B0U C;  1OVO A;  2NU1 I;  4GI3 C;  1CSO I;  2GKT I;  1NUB A;  2QQD A;  1TGS I;  1UZQ A;  2NU2 I;  1UZK A;  2ERW A;  2N71 A;  1IY5 A;  1PCE A;  2BUS A;  2LEO A;  3B4V C;  1HDL A;  3TJQ A;  1KSQ A;  1KMA A;  1FYB A;  2NU4 I;  2N52 A;  2SGP I;  1TBQ R;  1LR9 A;  2GKV A;  1HPT A;  1OMT A;  1SGQ I;  2WCY A;  1BUS A;  1TUR A;  1PJU A;  1UVG A;  1CE3 A;  1CT2 I;  1CT0 I;  1TUS A;  2SGQ I;  2V53 A;  3OVO A;  1SGP I;  2KCX A;  2SGD I;  2KMR A;  1UZJ A;  1M8B A;  1CT4 I;  2JXD A;  2NU3 I;  1N13 A;  3QTL D;  3SGQ I;  1TBR R;  2XRC A;  2JYY A;  2P6A C;  1DS2 I;  1DS3 I;  4HGU A;  1CGJ I;  5DAE A;  1UUC A;  1APJ A;  1OYV I;  2N17 A;  1YU6 C;  1AN1 I;  2SGF I;  1BMO A;  2KMO A;  1R0R I;  1CHO I;  1TIH A;  1Z7K B;  1UVF A;  2JZM A;  1HJA I;  1M8C A;  1LR8 A;  2QQC A;  2W86 A;  2OVO A;  1SGY I;  2NU0 I;  3SEK C;  3HH2 C;  1SGD I;  1IW4 A;  2ARP F;  1Y1B A;  3SGB I;  2KMP A;  2KMQ A;  1SGE I;  1H0Z A;  1YTP A;  2GKR I;  1LR7 A;  4OVO A;  1Y1C A;  1UZP A;  1CGI I; 
#chains in the Genus database with same CATH topology
 1SGR I;  5E3R A;  1PTR A;  1OMU A;  2DB6 A;  2M5X A;  1PPF I;  3OXL A;  2WGC A;  1MT1 A;  4B6D A;  2SGE I;  5JHW C;  2F3C I;  5HQ8 A;  1SGN I;  2W0T A;  4SGB I;  1IY6 A;  2L8E A;  2ROW A;  1Z2I A;  2B0U C;  1OVO A;  1XA6 A;  1X4S A;  2NU1 I;  2RIJ A;  4GI3 C;  2B8T A;  2JA1 A;  1CSO I;  2CWG A;  5FUW A;  2GKT I;  1WTJ A;  4DNC A;  1NUB A;  2UVO A;  2QQD A;  2ORV A;  5E3Q A;  9WGA A;  1TGS I;  1FY7 A;  2X52 A;  2NU2 I;  2GIV A;  1UZQ A;  3UGL A;  3OXF A;  2Y0M A;  1UZK A;  2ERW A;  2N71 A;  2J9R A;  3GOX A;  1IY5 A;  2CWF A;  1PCE A;  2BUS A;  2LEO A;  5EX0 A;  3B4V C;  1HDL A;  2UZ3 A;  2CWH A;  3MEK A;  3TJQ A;  3BJI A;  2QQE A;  1TBO A;  2GVI A;  1KSQ A;  1WGC A;  1UZP A;  1KMA A;  1FYB A;  2QPO A;  2NU4 I;  3VDP A;  3UFF A;  2N52 A;  4WP4 A;  2SGP I;  1TBQ R;  5FUY A;  2RC4 A;  3QAH A;  1LR9 A;  1V1I A;  2GKV A;  1HPT A;  1OMT A;  1SGQ I;  1MJB A;  3UOE A;  1MJA A;  4AML A;  1S20 A;  3FC3 A;  2WCY A;  1BUS A;  5FUV A;  3UGI A;  2E73 A;  1V1H A;  1TUR A;  2QQ0 A;  2N1A B;  1PJU A;  1UVG A;  2ELI A;  1CE3 A;  1CT2 I;  1CT0 I;  1TUS A;  5EX3 A;  2E5R A;  2SGQ I;  2OU2 A;  2V53 A;  3R5C A;  3OVO A;  2A20 A;  1WKX A;  3E2I A;  2ENN A;  1SGP I;  1TOT A;  1P9Z A;  2CJS C;  2KCX A;  2SGD I;  5J8F A;  2KMR A;  3E59 A;  7WGA A;  1FAQ A;  2OZU A;  1UZJ A;  1K7T A;  1M8B A;  5HI7 A;  1KBF A;  4MPI A;  1CT4 I;  3FSX A;  2JXD A;  2NU3 I;  3R5D A;  3QWP A;  1N13 A;  2DIP A;  3QTL D;  4A24 A;  1ULN A;  3UEJ A;  2FNF X;  3SGQ I;  3TO7 A;  1P9G A;  1TBR R;  2XRC A;  2JYY A;  2ODD A;  3OL0 A;  2P6A C;  2YUU A;  2LUY A;  4FKD A;  1DS2 I;  3VDU A;  2DKV A;  1WGT A;  2V1C C;  3R5A A;  5CCL A;  1DS3 I;  4HGU A;  1CGJ I;  5DAE A;  1ULK A;  1UUC A;  4JCV E;  5CCM A;  5J8C A;  1APJ A;  1OYV I;  2N17 A;  2JW6 A;  1YU6 C;  1X74 A;  2PQ8 A;  2YQP A;  2K9H A;  1FAR A;  2WVJ A;  5FUX A;  4E1P A;  1AN1 I;  2SGF I;  1XBT A;  1BMO A;  1NXU A;  2KMO A;  1R0R I;  3UGD A;  1CHO I;  3TO6 A;  1K7U A;  3CXL A;  1TIH A;  1Z7K B;  3TO9 A;  1UVF A;  2VRW B;  4E1R A;  5E3P A;  2JZM A;  2ENZ A;  1HJA I;  3PDN A;  4UXJ A;  1M8C A;  1LR8 A;  2QQC A;  2W86 A;  1R79 A;  2LB7 A;  1Y8F A;  2OD1 A;  3R5B A;  2OVO A;  4UXH A;  1SGY I;  1RFH A;  2NU0 I;  1Q9B A;  2V1C A;  1SGD I;  2J87 A;  3HH2 C;  3SEK C;  3UEY A;  2X3T A;  1IW4 A;  1U5K A;  1Y1B A;  2ARP F;  2L7X A;  3SGB I;  1VDD A;  3D00 A;  3FSY A;  3TOB A;  2KMP A;  2KMQ A;  1TBN A;  4L9M A;  1ULM A;  1SGE I;  1XX6 A;  1H0Z A;  3VE5 A;  1YTP A;  4UXI A;  1UHA A;  2ORW A;  3RU0 A;  2GKR I;  1HEV A;  1K7V A;  3OXG A;  1W3S A;  3KY9 A;  3TOA A;  1KBE A;  1LR7 A;  1MJ9 A;  4OVO A;  1W4R A;  1Y1C A;  1PTQ A;  1CGI I; 
#chains in the Genus database with same CATH homology
 1SGR I;  1PTR A;  1OMU A;  2DB6 A;  2M5X A;  1PPF I;  3OXL A;  4B6D A;  1MT1 A;  5JHW C;  2SGE I;  2F3C I;  5HQ8 A;  1SGN I;  2W0T A;  4SGB I;  1IY6 A;  2L8E A;  2ROW A;  2B0U C;  1OVO A;  1XA6 A;  1X4S A;  2NU1 I;  4GI3 C;  2B8T A;  2JA1 A;  1CSO I;  5FUW A;  2GKT I;  1NUB A;  2QQD A;  2ORV A;  1TGS I;  1UZQ A;  2NU2 I;  3UGL A;  3OXF A;  1UZK A;  2ERW A;  2N71 A;  2J9R A;  3GOX A;  1IY5 A;  1PCE A;  2BUS A;  2LEO A;  5EX0 A;  3B4V C;  1HDL A;  2UZ3 A;  3MEK A;  3TJQ A;  3BJI A;  2QQE A;  1TBO A;  2GVI A;  1KSQ A;  1UZP A;  1KMA A;  1FYB A;  2QPO A;  2NU4 I;  3VDP A;  3UFF A;  2N52 A;  2SGP I;  1TBQ R;  5FUY A;  1LR9 A;  1V1I A;  2GKV A;  1HPT A;  1OMT A;  1SGQ I;  3FC3 A;  2WCY A;  1BUS A;  5FUV A;  3UGI A;  2E73 A;  1V1H A;  1TUR A;  2QQ0 A;  2N1A B;  1PJU A;  1UVG A;  2ELI A;  1CE3 A;  1CT2 I;  1CT0 I;  1TUS A;  5EX3 A;  2E5R A;  2SGQ I;  2V53 A;  3OVO A;  2A20 A;  3E2I A;  2ENN A;  1SGP I;  1TOT A;  2KCX A;  2CJS C;  2SGD I;  2KMR A;  3E59 A;  1FAQ A;  1UZJ A;  1M8B A;  5HI7 A;  1KBF A;  1CT4 I;  2JXD A;  2NU3 I;  3QWP A;  1N13 A;  2DIP A;  3QTL D;  4A24 A;  3UEJ A;  2FNF X;  3SGQ I;  1TBR R;  2XRC A;  2JYY A;  2ODD A;  3OL0 A;  2P6A C;  2YUU A;  2LUY A;  4FKD A;  1DS2 I;  3VDU A;  5CCL A;  2V1C C;  1DS3 I;  4HGU A;  1CGJ I;  5DAE A;  1UUC A;  4JCV E;  5CCM A;  1APJ A;  1OYV I;  2N17 A;  2JW6 A;  1YU6 C;  1X74 A;  2YQP A;  5FUX A;  2K9H A;  1FAR A;  2WVJ A;  4E1P A;  1AN1 I;  2SGF I;  1XBT A;  1BMO A;  2KMO A;  1R0R I;  3UGD A;  1CHO I;  3CXL A;  1TIH A;  1Z7K B;  1UVF A;  2VRW B;  4E1R A;  2JZM A;  2ENZ A;  1HJA I;  3PDN A;  4UXJ A;  1M8C A;  1LR8 A;  2QQC A;  2W86 A;  1R79 A;  1Y8F A;  2OD1 A;  2OVO A;  4UXH A;  1SGY I;  1RFH A;  2NU0 I;  2V1C A;  3HH2 C;  1SGD I;  2J87 A;  3SEK C;  3UEY A;  1IW4 A;  1U5K A;  1Y1B A;  2ARP F;  2L7X A;  3SGB I;  1VDD A;  3D00 A;  2KMP A;  2KMQ A;  1TBN A;  4L9M A;  1SGE I;  1XX6 A;  1H0Z A;  3VE5 A;  1YTP A;  4UXI A;  2ORW A;  3RU0 A;  2GKR I;  3OXG A;  1W3S A;  3KY9 A;  1KBE A;  1LR7 A;  4OVO A;  1W4R A;  1Y1C A;  1PTQ A;  1CGI I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...