1LR7A

Crystal structure of fs1, the heparin-binding domain of follistatin, complexed with the heparin analogue sucrose octasulphate (sos)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
ETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords follistatin
publication title Crystal Structures of the Heparan Sulfate-binding Domain of Follistatin: Insights into ligand binding.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1lr7A00
3TJQA 1YTPA 2N71A 1LR8A 2KMRA 2SGFI 1R0RI 1DS2I 1FYBA 2BUSA 3QTLD 1DS3I 1Y1CA 1N13A 2QQDA 2NU3I 1IY5A 1LR7A 1Y1BA 1PPFI 1TGSI 2WCYA 2JXDA 2OVOA 1SGNI 1M8BA 2KMOA 2GKTI 1H0ZA 4HGUA 1M8CA 1HPTA 1SGYI 1TBRR 1BMOA 2KMPA 2QQCA 3OVOA 1AN1I 1SGEI 4SGBI 2JZMA 1TBQR 2SGEI 1SGDI 2LEOA 1OYVI 4OVOA 2F3CI 3SGQI 1IY6A 1SGQI 1PCEA 1CGJI 1TUSA 1UUCA 2NU1I 1CSOI 1BUSA 2GKVA 1MT1A 1CT0I 1CT2I 1SGRI 1TIHA 3SEKC 2ERWA 1PJUA 1TURA 4GI3C 2NU4I 2M5XA 1OMTA 3HH2C 2NU0I 1KMAA 1IW4A 1CT4I 1OVOA 1CGII 1CHOI 1OMUA 5JHWC 1YU6C 1Z7KB 2B0UC 2ARPF 1HJAI 2SGDI 3B4VC 1HDLA 2JYYA 3SGBI 1UVGA 2SGPI 1LR9A 5DAEA 1NUBA 2SGQI 2KMQA 2N52A 2KCXA 1UVFA 1CE3A 2N17A 2V53A 2XRCA 2GKRI 2P6AC 2NU2I 1SGPI
chains in the Genus database with same CATH superfamily
3TJQA 1YTPA 2N71A 2ODDA 2J9RA 3BJIA 2K9HA 1K7UA 1LR8A 3TOAA 4AMLA 2V1CC 2KMRA 2SGFI 2B8TA 1R0RI 1DS2I 3RU0A 5J8CA 1FYBA 1W3SA 1W4RA 1WGCA 3R5CA 2BUSA 3GOXA 3QTLD 2V1CA 1DS3I 3PDNA 1Y1CA 3D00A 1N13A 2JW6A 2ENZA 1TBNA 2J87A 2NU3I 2QQDA 1IY5A 1V1IA 2E5RA 1LR7A 1Y1BA 2YUUA 1PPFI 1U5KA 1TGSI 1FY7A 1V1HA 3FSYA 2WCYA 3R5BA 1X4SA 3UGLA 1X74A 2E73A 3UFFA 4MPIA 2ELIA 2LB7A 2OD1A 2JXDA 2OVOA 1NXUA 1SGNI 1M8BA 2DIPA 2GKTI 2KMOA 4WP4A 3QWPA 1K7VA 5EX3A 1WTJA 3UEJA 5J8FA 1H0ZA 3VDUA 4HGUA 2ENNA 1M8CA 1HPTA 3TO6A 1SGYI 1TBRR 1BMOA 2KMPA 5HQ8A 2L8EA 9WGAA 3R5AA 2QQCA 4DNCA 4UXIA 2CWGA 2GVIA 3OVOA 2UZ3A 5FUYA 1AN1I 4A24A 1MJ9A 1SGEI 4SGBI 2JZMA 1TBQR 1WKXA 2DKVA 2SGEI 5FUVA 1PTRA 2WGCA 1MJBA 3QAHA 1SGDI 2LEOA 3CXLA 5FUWA 1OYVI 1S20A 2WVJA 7WGAA 5EX0A 4OVOA 3FC3A 1HEVA 5E3RA 2F3CI 3VE5A 3SGQI 2RC4A 3TO9A 1SGQI 1ULNA 1PCEA 1CGJI 2CJSC 3MEKA 1IY6A 3OXFA 1ULMA 1TUSA 3E2IA 1UUCA 2A20A 2GIVA 1CSOI 2NU1I 1BUSA 2GKVA 2OZUA 1CT0I 1MT1A 1CT2I 1R79A 1SGRI 2ORVA 2UVOA 2FNFX 2X3TA 1TIHA 1KBFA 3SEKC 2OU2A 5CCMA 2ERWA 4FKDA 1PJUA 5HI7A 3UOEA 1KBEA 1ULKA 4UXJA 1XA6A 1TBOA 2RIJA 2JA1A 2W0TA 1TURA 2PQ8A 1FARA 2QQEA 2NU4I 4GI3C 4E1PA 1FAQA 2M5XA 1OMTA 3HH2C 1P9ZA 1UHAA 2NU0I 4JCVE 1KMAA 1Z2IA 1IW4A 1XX6A 1CT4I 1OVOA 2ROWA 5E3QA 1CGII 1CHOI 1OMUA 2CWHA 1YU6C 4L9MA 5JHWC 1Z7KB 3UGIA 2B0UC 2ARPF 1WGTA 1HJAI 2LUYA 3E59A 2SGDI 1PTQA 2L7XA 2N1AB 3B4VC 2X52A 1HDLA 2JYYA 4B6DA 2CWFA 3TO7A 2QPOA 2QQ0A 3SGBI 1UVGA 2SGPI 3UEYA 3UGDA 3VDPA 5E3PA 2DB6A 1LR9A 2Y0MA 3R5DA 5DAEA 1NUBA 3FSXA 2SGQI 2VRWB 2KMQA 1XBTA 2N52A 1Q9BA 1K7TA 1UVFA 2KCXA 3TOBA 1VDDA 3OL0A 5CCLA 1CE3A 2N17A 2V53A 2ORWA 4UXHA 1TOTA 4E1RA 3OXGA 3OXLA 5FUXA 2XRCA 1P9GA 1Y8FA 2GKRI 2P6AC 2YQPA 2NU2I 1RFHA 3KY9A 1SGPI 1MJAA
chains in the Genus database with same CATH topology
3TJQA 1YTPA 2N71A 2ODDA 2J9RA 3BJIA 2K9HA 1LR8A 2V1CC 2KMRA 2SGFI 2B8TA 1R0RI 1DS2I 3RU0A 1FYBA 1W3SA 1W4RA 2BUSA 3GOXA 3QTLD 2V1CA 1DS3I 3PDNA 1Y1CA 3D00A 1N13A 2JW6A 2ENZA 1TBNA 2J87A 2NU3I 2QQDA 1IY5A 1V1IA 2E5RA 1LR7A 1Y1BA 2YUUA 1PPFI 1U5KA 1TGSI 1V1HA 2WCYA 1X4SA 3UGLA 1X74A 2E73A 3UFFA 2ELIA 2OD1A 2JXDA 2OVOA 1SGNI 1M8BA 2GKTI 2DIPA 2KMOA 5EX3A 3QWPA 3UEJA 1H0ZA 3VDUA 4HGUA 2ENNA 1M8CA 1HPTA 1SGYI 1TBRR 1BMOA 2KMPA 5HQ8A 2L8EA 2QQCA 4UXIA 2GVIA 3OVOA 2UZ3A 5FUYA 1AN1I 1SGEI 4SGBI 2JZMA 1TBQR 2SGEI 5FUVA 1PTRA 1SGDI 2LEOA 3CXLA 5FUWA 1OYVI 2WVJA 5EX0A 4OVOA 3FC3A 2F3CI 3VE5A 3SGQI 1IY6A 1SGQI 2CJSC 1PCEA 1CGJI 3MEKA 3OXFA 1TUSA 3E2IA 1UUCA 2A20A 2NU1I 1CSOI 1BUSA 2GKVA 1CT0I 1MT1A 1CT2I 1R79A 1SGRI 2ORVA 2FNFX 1TIHA 1KBFA 3SEKC 5CCMA 2ERWA 4FKDA 1PJUA 5HI7A 1KBEA 4UXJA 1XA6A 1TBOA 2W0TA 2JA1A 1TURA 1FARA 2QQEA 2NU4I 4GI3C 4E1PA 1FAQA 2M5XA 1OMTA 3HH2C 4JCVE 2NU0I 1KMAA 1IW4A 1XX6A 1CT4I 1OVOA 2ROWA 1CGII 1CHOI 1OMUA 4L9MA 1YU6C 5JHWC 1Z7KB 3UGIA 2B0UC 2ARPF 1HJAI 2LUYA 3E59A 2SGDI 1PTQA 2L7XA 2N1AB 3B4VC 1HDLA 2JYYA 4B6DA 2QPOA 2QQ0A 3SGBI 1UVGA 2SGPI 3UEYA 3UGDA 3VDPA 2DB6A 1LR9A 5DAEA 1NUBA 2SGQI 2VRWB 2KMQA 1XBTA 2N52A 2KCXA 1UVFA 1VDDA 3OL0A 5CCLA 1CE3A 2N17A 2V53A 2ORWA 4UXHA 1TOTA 4E1RA 3OXGA 3OXLA 5FUXA 2XRCA 1Y8FA 2GKRI 2P6AC 2YQPA 2NU2I 1RFHA 3KY9A 1SGPI 4A24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJQ A;  1YTP A;  2N71 A;  1LR8 A;  2KMR A;  2SGF I;  1R0R I;  1DS2 I;  1FYB A;  2BUS A;  3QTL D;  1DS3 I;  1Y1C A;  1N13 A;  2QQD A;  2NU3 I;  1IY5 A;  1LR7 A;  1Y1B A;  1PPF I;  1TGS I;  2WCY A;  2JXD A;  2OVO A;  1SGN I;  1M8B A;  2KMO A;  2GKT I;  1H0Z A;  4HGU A;  1M8C A;  1HPT A;  1SGY I;  1TBR R;  1BMO A;  2KMP A;  2QQC A;  3OVO A;  1AN1 I;  1SGE I;  4SGB I;  2JZM A;  1TBQ R;  2SGE I;  1SGD I;  2LEO A;  1OYV I;  4OVO A;  2F3C I;  3SGQ I;  1IY6 A;  1SGQ I;  1PCE A;  1CGJ I;  1TUS A;  1UUC A;  2NU1 I;  1CSO I;  1BUS A;  2GKV A;  1MT1 A;  1CT0 I;  1CT2 I;  1SGR I;  1TIH A;  3SEK C;  2ERW A;  1PJU A;  1TUR A;  4GI3 C;  2NU4 I;  2M5X A;  1OMT A;  3HH2 C;  2NU0 I;  1KMA A;  1IW4 A;  1CT4 I;  1OVO A;  1CGI I;  1CHO I;  1OMU A;  5JHW C;  1YU6 C;  1Z7K B;  2B0U C;  2ARP F;  1HJA I;  2SGD I;  3B4V C;  1HDL A;  2JYY A;  3SGB I;  1UVG A;  2SGP I;  1LR9 A;  5DAE A;  1NUB A;  2SGQ I;  2KMQ A;  2N52 A;  2KCX A;  1UVF A;  1CE3 A;  2N17 A;  2V53 A;  2XRC A;  2GKR I;  2P6A C;  2NU2 I;  1SGP I; 
#chains in the Genus database with same CATH topology
 3TJQ A;  1YTP A;  2N71 A;  2ODD A;  2J9R A;  3BJI A;  2K9H A;  1K7U A;  1LR8 A;  3TOA A;  4AML A;  2V1C C;  2KMR A;  2SGF I;  2B8T A;  1R0R I;  1DS2 I;  3RU0 A;  5J8C A;  1FYB A;  1W3S A;  1W4R A;  1WGC A;  3R5C A;  2BUS A;  3GOX A;  3QTL D;  2V1C A;  1DS3 I;  3PDN A;  1Y1C A;  3D00 A;  1N13 A;  2JW6 A;  2ENZ A;  1TBN A;  2J87 A;  2NU3 I;  2QQD A;  1IY5 A;  1V1I A;  2E5R A;  1LR7 A;  1Y1B A;  2YUU A;  1PPF I;  1U5K A;  1TGS I;  1FY7 A;  1V1H A;  3FSY A;  2WCY A;  3R5B A;  1X4S A;  3UGL A;  1X74 A;  2E73 A;  3UFF A;  4MPI A;  2ELI A;  2LB7 A;  2OD1 A;  2JXD A;  2OVO A;  1NXU A;  1SGN I;  1M8B A;  2DIP A;  2GKT I;  2KMO A;  4WP4 A;  3QWP A;  1K7V A;  5EX3 A;  1WTJ A;  3UEJ A;  5J8F A;  1H0Z A;  3VDU A;  4HGU A;  2ENN A;  1M8C A;  1HPT A;  3TO6 A;  1SGY I;  1TBR R;  1BMO A;  2KMP A;  5HQ8 A;  2L8E A;  9WGA A;  3R5A A;  2QQC A;  4DNC A;  4UXI A;  2CWG A;  2GVI A;  3OVO A;  2UZ3 A;  5FUY A;  1AN1 I;  4A24 A;  1MJ9 A;  1SGE I;  4SGB I;  2JZM A;  1TBQ R;  1WKX A;  2DKV A;  2SGE I;  5FUV A;  1PTR A;  2WGC A;  1MJB A;  3QAH A;  1SGD I;  2LEO A;  3CXL A;  5FUW A;  1OYV I;  1S20 A;  2WVJ A;  7WGA A;  5EX0 A;  4OVO A;  3FC3 A;  1HEV A;  5E3R A;  2F3C I;  3VE5 A;  3SGQ I;  2RC4 A;  3TO9 A;  1SGQ I;  1ULN A;  1PCE A;  1CGJ I;  2CJS C;  3MEK A;  1IY6 A;  3OXF A;  1ULM A;  1TUS A;  3E2I A;  1UUC A;  2A20 A;  2GIV A;  1CSO I;  2NU1 I;  1BUS A;  2GKV A;  2OZU A;  1CT0 I;  1MT1 A;  1CT2 I;  1R79 A;  1SGR I;  2ORV A;  2UVO A;  2FNF X;  2X3T A;  1TIH A;  1KBF A;  3SEK C;  2OU2 A;  5CCM A;  2ERW A;  4FKD A;  1PJU A;  5HI7 A;  3UOE A;  1KBE A;  1ULK A;  4UXJ A;  1XA6 A;  1TBO A;  2RIJ A;  2JA1 A;  2W0T A;  1TUR A;  2PQ8 A;  1FAR A;  2QQE A;  2NU4 I;  4GI3 C;  4E1P A;  1FAQ A;  2M5X A;  1OMT A;  3HH2 C;  1P9Z A;  1UHA A;  2NU0 I;  4JCV E;  1KMA A;  1Z2I A;  1IW4 A;  1XX6 A;  1CT4 I;  1OVO A;  2ROW A;  5E3Q A;  1CGI I;  1CHO I;  1OMU A;  2CWH A;  1YU6 C;  4L9M A;  5JHW C;  1Z7K B;  3UGI A;  2B0U C;  2ARP F;  1WGT A;  1HJA I;  2LUY A;  3E59 A;  2SGD I;  1PTQ A;  2L7X A;  2N1A B;  3B4V C;  2X52 A;  1HDL A;  2JYY A;  4B6D A;  2CWF A;  3TO7 A;  2QPO A;  2QQ0 A;  3SGB I;  1UVG A;  2SGP I;  3UEY A;  3UGD A;  3VDP A;  5E3P A;  2DB6 A;  1LR9 A;  2Y0M A;  3R5D A;  5DAE A;  1NUB A;  3FSX A;  2SGQ I;  2VRW B;  2KMQ A;  1XBT A;  2N52 A;  1Q9B A;  1K7T A;  1UVF A;  2KCX A;  3TOB A;  1VDD A;  3OL0 A;  5CCL A;  1CE3 A;  2N17 A;  2V53 A;  2ORW A;  4UXH A;  1TOT A;  4E1R A;  3OXG A;  3OXL A;  5FUX A;  2XRC A;  1P9G A;  1Y8F A;  2GKR I;  2P6A C;  2YQP A;  2NU2 I;  1RFH A;  3KY9 A;  1SGP I;  1MJA A; 
#chains in the Genus database with same CATH homology
 3TJQ A;  1YTP A;  2N71 A;  2ODD A;  2J9R A;  3BJI A;  2K9H A;  1LR8 A;  2V1C C;  2KMR A;  2SGF I;  2B8T A;  1R0R I;  1DS2 I;  3RU0 A;  1FYB A;  1W3S A;  1W4R A;  2BUS A;  3GOX A;  3QTL D;  2V1C A;  1DS3 I;  3PDN A;  1Y1C A;  3D00 A;  1N13 A;  2JW6 A;  2ENZ A;  1TBN A;  2J87 A;  2NU3 I;  2QQD A;  1IY5 A;  1V1I A;  2E5R A;  1LR7 A;  1Y1B A;  2YUU A;  1PPF I;  1U5K A;  1TGS I;  1V1H A;  2WCY A;  1X4S A;  3UGL A;  1X74 A;  2E73 A;  3UFF A;  2ELI A;  2OD1 A;  2JXD A;  2OVO A;  1SGN I;  1M8B A;  2GKT I;  2DIP A;  2KMO A;  5EX3 A;  3QWP A;  3UEJ A;  1H0Z A;  3VDU A;  4HGU A;  2ENN A;  1M8C A;  1HPT A;  1SGY I;  1TBR R;  1BMO A;  2KMP A;  5HQ8 A;  2L8E A;  2QQC A;  4UXI A;  2GVI A;  3OVO A;  2UZ3 A;  5FUY A;  1AN1 I;  1SGE I;  4SGB I;  2JZM A;  1TBQ R;  2SGE I;  5FUV A;  1PTR A;  1SGD I;  2LEO A;  3CXL A;  5FUW A;  1OYV I;  2WVJ A;  5EX0 A;  4OVO A;  3FC3 A;  2F3C I;  3VE5 A;  3SGQ I;  1IY6 A;  1SGQ I;  2CJS C;  1PCE A;  1CGJ I;  3MEK A;  3OXF A;  1TUS A;  3E2I A;  1UUC A;  2A20 A;  2NU1 I;  1CSO I;  1BUS A;  2GKV A;  1CT0 I;  1MT1 A;  1CT2 I;  1R79 A;  1SGR I;  2ORV A;  2FNF X;  1TIH A;  1KBF A;  3SEK C;  5CCM A;  2ERW A;  4FKD A;  1PJU A;  5HI7 A;  1KBE A;  4UXJ A;  1XA6 A;  1TBO A;  2W0T A;  2JA1 A;  1TUR A;  1FAR A;  2QQE A;  2NU4 I;  4GI3 C;  4E1P A;  1FAQ A;  2M5X A;  1OMT A;  3HH2 C;  4JCV E;  2NU0 I;  1KMA A;  1IW4 A;  1XX6 A;  1CT4 I;  1OVO A;  2ROW A;  1CGI I;  1CHO I;  1OMU A;  4L9M A;  1YU6 C;  5JHW C;  1Z7K B;  3UGI A;  2B0U C;  2ARP F;  1HJA I;  2LUY A;  3E59 A;  2SGD I;  1PTQ A;  2L7X A;  2N1A B;  3B4V C;  1HDL A;  2JYY A;  4B6D A;  2QPO A;  2QQ0 A;  3SGB I;  1UVG A;  2SGP I;  3UEY A;  3UGD A;  3VDP A;  2DB6 A;  1LR9 A;  5DAE A;  1NUB A;  2SGQ I;  2VRW B;  2KMQ A;  1XBT A;  2N52 A;  2KCX A;  1UVF A;  1VDD A;  3OL0 A;  5CCL A;  1CE3 A;  2N17 A;  2V53 A;  2ORW A;  4UXH A;  1TOT A;  4E1R A;  3OXG A;  3OXL A;  5FUX A;  2XRC A;  1Y8F A;  2GKR I;  2P6A C;  2YQP A;  2NU2 I;  1RFH A;  3KY9 A;  1SGP I;  4A24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...