1LR7A

Crystal structure of fs1, the heparin-binding domain of follistatin, complexed with the heparin analogue sucrose octasulphate (sos)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
ETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords follistatin
publication title Crystal Structures of the Heparan Sulfate-binding Domain of Follistatin: Insights into ligand binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hormone/growth factor
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1lr7A00
2OVOA 2M5XA 2WCYA 2NU0I 1SGYI 3SGQI 1Y1CA 2KMQA 2B0UC 2NU4I 2KMRA 2JZMA 4HGUA 1SGEI 4SGBI 2N52A 1KMAA 1DS2I 2SGQI 1CT4I 1TUSA 1Z7KB 2SGEI 2SGDI 2SGPI 2F3CI 4OVOA 1CE3A 2ARPF 2LEOA 1OVOA 1PJUA 1M8BA 2NU2I 3TJQA 3SEKC 1CT0I 1UUCA 1SGNI 1CSOI 1HPTA 1TBQR 1OYVI 1N13A 1CHOI 2N71A 2V53A 1DS3I 5JHWC 1LR8A 1TIHA 2BUSA 1CGII 2JYYA 1CT2I 1SGDI 2GKTI 1Y1BA 2JXDA 2N17A 3OVOA 1LR9A 1SGRI 1M8CA 3HH2C 1SGQI 2SGFI 3SGBI 1CGJI 1IY6A 2KCXA 1OMTA 1IW4A 1YU6C 1MT1A 2NU3I 1AN1I 2KMOA 1BMOA 1YTPA 1OMUA 2XRCA 2P6AC 2GKVA 1H0ZA 1HJAI 1PCEA 2KMPA 1NUBA 5DAEA 1TGSI 1TBRR 3B4VC 1TURA 1UVFA 2NU1I 2ERWA 1PPFI 1R0RI 2GKRI 1BUSA 2QQCA 1HDLA 2QQDA 3QTLD 1IY5A 1FYBA 1SGPI 4GI3C 1LR7A 1UVGA
chains in the Genus database with same CATH superfamily
2OVOA 2M5XA 1RFHA 4UXIA 1VDDA 2J9RA 2WCYA 2PQ8A 3FC3A 2NU0I 5HQ8A 1FY7A 1SGYI 1V1IA 3SGQI 1Y1CA 2KMQA 3TOBA 2ROWA 3R5AA 1X74A 2B0UC 3UEYA 2NU4I 2KMRA 1X4SA 2OZUA 1K7VA 1Q9BA 2DB6A 1FAQA 1HEVA 2JZMA 4HGUA 2ODDA 2QQEA 1WTJA 3PDNA 1FARA 2K9HA 1SGEI 2QQ0A 7WGAA 2YUUA 5CCMA 4SGBI 4FKDA 2UZ3A 2N52A 1KMAA 1DS2I 1MJAA 1CT4I 1TUSA 2SGQI 1Z7KB 2L8EA 2SGEI 3OL0A 2N1AB 1R79A 2SGDI 2X3TA 2OU2A 1PTRA 2SGPI 2ENZA 3TO9A 2F3CI 4OVOA 2DIPA 5FUXA 1P9GA 1CE3A 2ARPF 2LEOA 4WP4A 1OVOA 1PJUA 2QPOA 2Y0MA 1KBEA 3MEKA 3UGLA 4E1PA 1M8BA 2OD1A 2V1CA 4A24A 2NU2I 1WKXA 2ENNA 2CWGA 3OXFA 3TJQA 2W0TA 3SEKC 1CT0I 1UUCA 3VE5A 1SGNI 2VRWB 1CSOI 1HPTA 1TBQR 5E3PA 1OYVI 1K7UA 1P9ZA 3E2IA 1N13A 1CHOI 2N71A 2V53A 1DS3I 1V1HA 5E3QA 3OXLA 5JHWC 1LR8A 1TIHA 2BUSA 1NXUA 3VDPA 1CGII 1XBTA 2JYYA 2L7XA 4UXJA 1MJBA 1PTQA 1CT2I 1UHAA 2WGCA 2CJSC 1SGDI 3VDUA 1MJ9A 2GKTI 1WGTA 5FUWA 1Y1BA 2JXDA 4AMLA 2N17A 2ORWA 1LR9A 1SGRI 1TBNA 1M8CA 3OVOA 3HH2C 3R5BA 5E3RA 1SGQI 2SGFI 9WGAA 3R5DA 3SGBI 1CGJI 3R5CA 2FNFX 3TO6A 2LB7A 3RU0A 2ORVA 2DKVA 2E73A 3TOAA 4E1RA 1IY6A 1Y8FA 2E5RA 2V1CC 3QAHA 3UFFA 3UOEA 2KCXA 1OMTA 2JA1A 1Z2IA 2A20A 2CWHA 2UVOA 2YQPA 5EX0A 1WGCA 1S20A 1ULMA 2B8TA 2JW6A 1IW4A 1YU6C 1KBFA 5EX3A 1MT1A 4DNCA 2CWFA 2NU3I 2GVIA 1AN1I 4B6DA 2KMOA 1BMOA 2GIVA 1YTPA 1OMUA 2RC4A 2XRCA 4UXHA 2P6AC 4JCVE 2GKVA 3E59A 5HI7A 1H0ZA 1HJAI 2RIJA 1PCEA 2J87A 2KMPA 3D00A 3OXGA 1U5KA 1NUBA 5DAEA 1TGSI 5FUYA 1TBRR 3B4VC 1TURA 3BJIA 3KY9A 5FUVA 5J8CA 3UGDA 1TOTA 1XX6A 4MPIA 1UVFA 1W3SA 5CCLA 2NU1I 3UEJA 1ULNA 2ELIA 1K7TA 3FSYA 3QWPA 5J8FA 2ERWA 1PPFI 1R0RI 1ULKA 2GKRI 2X52A 3UGIA 2QQCA 1BUSA 3FSXA 3TO7A 1HDLA 3CXLA 1W4RA 2QQDA 3QTLD 3GOXA 1IY5A 1FYBA 1SGPI 4GI3C 1XA6A 1TBOA 1LR7A 2LUYA 2WVJA 1UVGA 4L9MA
chains in the Genus database with same CATH topology
2OVOA 2M5XA 1RFHA 4UXIA 1VDDA 2J9RA 2WCYA 3FC3A 2NU0I 5HQ8A 1SGYI 1V1IA 3SGQI 1Y1CA 2KMQA 2ROWA 1X74A 2B0UC 3UEYA 2NU4I 2KMRA 1X4SA 1FAQA 2DB6A 2JZMA 4HGUA 2ODDA 2QQEA 3PDNA 1FARA 2K9HA 1SGEI 2QQ0A 2YUUA 5CCMA 4SGBI 4FKDA 2UZ3A 2N52A 1KMAA 1DS2I 2SGQI 1CT4I 1TUSA 1Z7KB 2L8EA 2SGEI 3OL0A 2N1AB 1R79A 2SGDI 1PTRA 2SGPI 2ENZA 2F3CI 4OVOA 2DIPA 5FUXA 1CE3A 2ARPF 2LEOA 1OVOA 1PJUA 2QPOA 3MEKA 1KBEA 3UGLA 4E1PA 1M8BA 2OD1A 2V1CA 4A24A 2NU2I 2ENNA 3OXFA 3TJQA 2W0TA 3SEKC 1CT0I 1UUCA 3VE5A 1SGNI 2VRWB 1CSOI 1HPTA 1TBQR 1OYVI 3E2IA 1N13A 1CHOI 2N71A 2V53A 1DS3I 1V1HA 3OXLA 5JHWC 1LR8A 1TIHA 2BUSA 3VDPA 1CGII 1XBTA 2JYYA 2L7XA 4UXJA 1PTQA 1CT2I 2CJSC 1SGDI 3VDUA 2GKTI 5FUWA 1Y1BA 2JXDA 2N17A 2ORWA 1LR9A 1SGRI 1TBNA 1M8CA 3OVOA 3HH2C 1SGQI 2SGFI 3SGBI 1CGJI 2FNFX 3RU0A 2ORVA 4E1RA 2E73A 1IY6A 1Y8FA 2E5RA 2V1CC 3UFFA 2KCXA 1OMTA 2JA1A 2YQPA 2A20A 5EX0A 2B8TA 2JW6A 1IW4A 1KBFA 1YU6C 5EX3A 1MT1A 2NU3I 2GVIA 1AN1I 4B6DA 2KMOA 1BMOA 1YTPA 1OMUA 2XRCA 4UXHA 2P6AC 4JCVE 2GKVA 3E59A 5HI7A 1H0ZA 1HJAI 1PCEA 2J87A 2KMPA 3D00A 3OXGA 1U5KA 1NUBA 5DAEA 1TGSI 5FUYA 1TBRR 3B4VC 1TURA 3BJIA 3KY9A 5FUVA 3UGDA 1TOTA 1XX6A 1UVFA 1W3SA 5CCLA 2NU1I 3UEJA 2ELIA 3QWPA 2ERWA 1PPFI 1R0RI 2GKRI 3UGIA 1BUSA 2QQCA 1HDLA 3CXLA 1W4RA 2QQDA 3QTLD 3GOXA 1IY5A 1FYBA 1SGPI 4GI3C 1XA6A 1TBOA 1LR7A 2LUYA 2WVJA 1UVGA 4L9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OVO A;  2M5X A;  2WCY A;  2NU0 I;  1SGY I;  3SGQ I;  1Y1C A;  2KMQ A;  2B0U C;  2NU4 I;  2KMR A;  2JZM A;  4HGU A;  1SGE I;  4SGB I;  2N52 A;  1KMA A;  1DS2 I;  2SGQ I;  1CT4 I;  1TUS A;  1Z7K B;  2SGE I;  2SGD I;  2SGP I;  2F3C I;  4OVO A;  1CE3 A;  2ARP F;  2LEO A;  1OVO A;  1PJU A;  1M8B A;  2NU2 I;  3TJQ A;  3SEK C;  1CT0 I;  1UUC A;  1SGN I;  1CSO I;  1HPT A;  1TBQ R;  1OYV I;  1N13 A;  1CHO I;  2N71 A;  2V53 A;  1DS3 I;  5JHW C;  1LR8 A;  1TIH A;  2BUS A;  1CGI I;  2JYY A;  1CT2 I;  1SGD I;  2GKT I;  1Y1B A;  2JXD A;  2N17 A;  3OVO A;  1LR9 A;  1SGR I;  1M8C A;  3HH2 C;  1SGQ I;  2SGF I;  3SGB I;  1CGJ I;  1IY6 A;  2KCX A;  1OMT A;  1IW4 A;  1YU6 C;  1MT1 A;  2NU3 I;  1AN1 I;  2KMO A;  1BMO A;  1YTP A;  1OMU A;  2XRC A;  2P6A C;  2GKV A;  1H0Z A;  1HJA I;  1PCE A;  2KMP A;  1NUB A;  5DAE A;  1TGS I;  1TBR R;  3B4V C;  1TUR A;  1UVF A;  2NU1 I;  2ERW A;  1PPF I;  1R0R I;  2GKR I;  1BUS A;  2QQC A;  1HDL A;  2QQD A;  3QTL D;  1IY5 A;  1FYB A;  1SGP I;  4GI3 C;  1LR7 A;  1UVG A; 
#chains in the Genus database with same CATH topology
 2OVO A;  2M5X A;  1RFH A;  4UXI A;  1VDD A;  2J9R A;  2WCY A;  2PQ8 A;  3FC3 A;  2NU0 I;  5HQ8 A;  1FY7 A;  1SGY I;  1V1I A;  3SGQ I;  1Y1C A;  2KMQ A;  3TOB A;  2ROW A;  3R5A A;  1X74 A;  2B0U C;  3UEY A;  2NU4 I;  2KMR A;  1X4S A;  2OZU A;  1K7V A;  1Q9B A;  2DB6 A;  1FAQ A;  1HEV A;  2JZM A;  4HGU A;  2ODD A;  2QQE A;  1WTJ A;  3PDN A;  1FAR A;  2K9H A;  1SGE I;  2QQ0 A;  7WGA A;  2YUU A;  5CCM A;  4SGB I;  4FKD A;  2UZ3 A;  2N52 A;  1KMA A;  1DS2 I;  1MJA A;  1CT4 I;  1TUS A;  2SGQ I;  1Z7K B;  2L8E A;  2SGE I;  3OL0 A;  2N1A B;  1R79 A;  2SGD I;  2X3T A;  2OU2 A;  1PTR A;  2SGP I;  2ENZ A;  3TO9 A;  2F3C I;  4OVO A;  2DIP A;  5FUX A;  1P9G A;  1CE3 A;  2ARP F;  2LEO A;  4WP4 A;  1OVO A;  1PJU A;  2QPO A;  2Y0M A;  1KBE A;  3MEK A;  3UGL A;  4E1P A;  1M8B A;  2OD1 A;  2V1C A;  4A24 A;  2NU2 I;  1WKX A;  2ENN A;  2CWG A;  3OXF A;  3TJQ A;  2W0T A;  3SEK C;  1CT0 I;  1UUC A;  3VE5 A;  1SGN I;  2VRW B;  1CSO I;  1HPT A;  1TBQ R;  5E3P A;  1OYV I;  1K7U A;  1P9Z A;  3E2I A;  1N13 A;  1CHO I;  2N71 A;  2V53 A;  1DS3 I;  1V1H A;  5E3Q A;  3OXL A;  5JHW C;  1LR8 A;  1TIH A;  2BUS A;  1NXU A;  3VDP A;  1CGI I;  1XBT A;  2JYY A;  2L7X A;  4UXJ A;  1MJB A;  1PTQ A;  1CT2 I;  1UHA A;  2WGC A;  2CJS C;  1SGD I;  3VDU A;  1MJ9 A;  2GKT I;  1WGT A;  5FUW A;  1Y1B A;  2JXD A;  4AML A;  2N17 A;  2ORW A;  1LR9 A;  1SGR I;  1TBN A;  1M8C A;  3OVO A;  3HH2 C;  3R5B A;  5E3R A;  1SGQ I;  2SGF I;  9WGA A;  3R5D A;  3SGB I;  1CGJ I;  3R5C A;  2FNF X;  3TO6 A;  2LB7 A;  3RU0 A;  2ORV A;  2DKV A;  2E73 A;  3TOA A;  4E1R A;  1IY6 A;  1Y8F A;  2E5R A;  2V1C C;  3QAH A;  3UFF A;  3UOE A;  2KCX A;  1OMT A;  2JA1 A;  1Z2I A;  2A20 A;  2CWH A;  2UVO A;  2YQP A;  5EX0 A;  1WGC A;  1S20 A;  1ULM A;  2B8T A;  2JW6 A;  1IW4 A;  1YU6 C;  1KBF A;  5EX3 A;  1MT1 A;  4DNC A;  2CWF A;  2NU3 I;  2GVI A;  1AN1 I;  4B6D A;  2KMO A;  1BMO A;  2GIV A;  1YTP A;  1OMU A;  2RC4 A;  2XRC A;  4UXH A;  2P6A C;  4JCV E;  2GKV A;  3E59 A;  5HI7 A;  1H0Z A;  1HJA I;  2RIJ A;  1PCE A;  2J87 A;  2KMP A;  3D00 A;  3OXG A;  1U5K A;  1NUB A;  5DAE A;  1TGS I;  5FUY A;  1TBR R;  3B4V C;  1TUR A;  3BJI A;  3KY9 A;  5FUV A;  5J8C A;  3UGD A;  1TOT A;  1XX6 A;  4MPI A;  1UVF A;  1W3S A;  5CCL A;  2NU1 I;  3UEJ A;  1ULN A;  2ELI A;  1K7T A;  3FSY A;  3QWP A;  5J8F A;  2ERW A;  1PPF I;  1R0R I;  1ULK A;  2GKR I;  2X52 A;  3UGI A;  2QQC A;  1BUS A;  3FSX A;  3TO7 A;  1HDL A;  3CXL A;  1W4R A;  2QQD A;  3QTL D;  3GOX A;  1IY5 A;  1FYB A;  1SGP I;  4GI3 C;  1XA6 A;  1TBO A;  1LR7 A;  2LUY A;  2WVJ A;  1UVG A;  4L9M A; 
#chains in the Genus database with same CATH homology
 2OVO A;  2M5X A;  1RFH A;  4UXI A;  1VDD A;  2J9R A;  2WCY A;  3FC3 A;  2NU0 I;  5HQ8 A;  1SGY I;  1V1I A;  3SGQ I;  1Y1C A;  2KMQ A;  2ROW A;  1X74 A;  2B0U C;  3UEY A;  2NU4 I;  2KMR A;  1X4S A;  1FAQ A;  2DB6 A;  2JZM A;  4HGU A;  2ODD A;  2QQE A;  3PDN A;  1FAR A;  2K9H A;  1SGE I;  2QQ0 A;  2YUU A;  5CCM A;  4SGB I;  4FKD A;  2UZ3 A;  2N52 A;  1KMA A;  1DS2 I;  2SGQ I;  1CT4 I;  1TUS A;  1Z7K B;  2L8E A;  2SGE I;  3OL0 A;  2N1A B;  1R79 A;  2SGD I;  1PTR A;  2SGP I;  2ENZ A;  2F3C I;  4OVO A;  2DIP A;  5FUX A;  1CE3 A;  2ARP F;  2LEO A;  1OVO A;  1PJU A;  2QPO A;  3MEK A;  1KBE A;  3UGL A;  4E1P A;  1M8B A;  2OD1 A;  2V1C A;  4A24 A;  2NU2 I;  2ENN A;  3OXF A;  3TJQ A;  2W0T A;  3SEK C;  1CT0 I;  1UUC A;  3VE5 A;  1SGN I;  2VRW B;  1CSO I;  1HPT A;  1TBQ R;  1OYV I;  3E2I A;  1N13 A;  1CHO I;  2N71 A;  2V53 A;  1DS3 I;  1V1H A;  3OXL A;  5JHW C;  1LR8 A;  1TIH A;  2BUS A;  3VDP A;  1CGI I;  1XBT A;  2JYY A;  2L7X A;  4UXJ A;  1PTQ A;  1CT2 I;  2CJS C;  1SGD I;  3VDU A;  2GKT I;  5FUW A;  1Y1B A;  2JXD A;  2N17 A;  2ORW A;  1LR9 A;  1SGR I;  1TBN A;  1M8C A;  3OVO A;  3HH2 C;  1SGQ I;  2SGF I;  3SGB I;  1CGJ I;  2FNF X;  3RU0 A;  2ORV A;  4E1R A;  2E73 A;  1IY6 A;  1Y8F A;  2E5R A;  2V1C C;  3UFF A;  2KCX A;  1OMT A;  2JA1 A;  2YQP A;  2A20 A;  5EX0 A;  2B8T A;  2JW6 A;  1IW4 A;  1KBF A;  1YU6 C;  5EX3 A;  1MT1 A;  2NU3 I;  2GVI A;  1AN1 I;  4B6D A;  2KMO A;  1BMO A;  1YTP A;  1OMU A;  2XRC A;  4UXH A;  2P6A C;  4JCV E;  2GKV A;  3E59 A;  5HI7 A;  1H0Z A;  1HJA I;  1PCE A;  2J87 A;  2KMP A;  3D00 A;  3OXG A;  1U5K A;  1NUB A;  5DAE A;  1TGS I;  5FUY A;  1TBR R;  3B4V C;  1TUR A;  3BJI A;  3KY9 A;  5FUV A;  3UGD A;  1TOT A;  1XX6 A;  1UVF A;  1W3S A;  5CCL A;  2NU1 I;  3UEJ A;  2ELI A;  3QWP A;  2ERW A;  1PPF I;  1R0R I;  2GKR I;  3UGI A;  1BUS A;  2QQC A;  1HDL A;  3CXL A;  1W4R A;  2QQD A;  3QTL D;  3GOX A;  1IY5 A;  1FYB A;  1SGP I;  4GI3 C;  1XA6 A;  1TBO A;  1LR7 A;  2LUY A;  2WVJ A;  1UVG A;  4L9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...