1LR7A

Crystal structure of fs1, the heparin-binding domain of follistatin, complexed with the heparin analogue sucrose octasulphate (sos)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
ETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords follistatin
publication title Crystal Structures of the Heparan Sulfate-binding Domain of Follistatin: Insights into ligand binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hormone/growth factor
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1lr7A00
1YU6C 1SGEI 1MT1A 1FYBA 1CT0I 1SGNI 2QQCA 1SGDI 1SGRI 1UVFA 2SGDI 3QTLD 1DS2I 2NU0I 3OVOA 1CE3A 1N13A 2SGPI 1TGSI 1CT2I 4HGUA 2KMQA 1Y1BA 1OYVI 2KMOA 1OVOA 2SGQI 1DS3I 4GI3C 2V53A 1BUSA 1SGPI 1LR9A 2XRCA 2P6AC 3SGQI 2SGFI 1OMTA 1CGII 2JZMA 4SGBI 1H0ZA 1NUBA 1SGQI 1TUSA 3HH2C 1TBRR 2ARPF 2WCYA 1Y1CA 1CHOI 5JHWC 2M5XA 2QQDA 1TURA 2N52A 2GKTI 1TBQR 1M8BA 5DAEA 1M8CA 1CSOI 1SGYI 2JXDA 1CGJI 2BUSA 2NU3I 3B4VC 1CT4I 2JYYA 2NU4I 4OVOA 1HJAI 2KCXA 1LR8A 1IY6A 2NU1I 3TJQA 2B0UC 1IY5A 1PPFI 1AN1I 1HDLA 1UVGA 2GKRI 1OMUA 2LEOA 2ERWA 1IW4A 2F3CI 1YTPA 2NU2I 2GKVA 1UUCA 2KMRA 2N17A 1LR7A 2SGEI 1BMOA 2N71A 1HPTA 1PCEA 1TIHA 2KMPA 3SEKC 2OVOA 1PJUA 1KMAA 1R0RI 3SGBI 1Z7KB
chains in the Genus database with same CATH superfamily
1YU6C 1SGEI 1MT1A 2WGCA 1FYBA 1CT0I 3FSXA 1ULNA 1SGNI 2QQCA 1SGDI 1SGRI 3OXFA 5EX0A 3VDPA 3QAHA 2DB6A 3D00A 3MEKA 1UVFA 3R5AA 2SGDI 2PQ8A 3OL0A 3QTLD 4UXHA 3UOEA 1K7UA 1DS2I 2NU0I 3OVOA 3TO7A 1CE3A 1N13A 3TOAA 2SGPI 1TGSI 1FARA 1P9GA 2B8TA 1Q9BA 2J9RA 2LB7A 2LUYA 1MJ9A 2GIVA 1CT2I 2K9HA 4HGUA 2KMQA 1Y1BA 2JA1A 5HI7A 2ENNA 2ORVA 1PTQA 2UVOA 1XX6A 3RU0A 4UXIA 1WGTA 3TO6A 1OYVI 1OVOA 2KMOA 1W4RA 1XBTA 3VE5A 5CCLA 5J8FA 2QPOA 1DS3I 2SGQI 1HEVA 2CWHA 3TO9A 4GI3C 3R5CA 5E3PA 1KBEA 2ODDA 2V53A 3E59A 1PTRA 7WGAA 1SGPI 1FY7A 2RIJA 1BUSA 2DKVA 1U5KA 2CJSC 1LR9A 2N1AB 2FNFX 2X3TA 2XRCA 2P6AC 5FUYA 3SGQI 3KY9A 3UGIA 2SGFI 4WP4A 2ENZA 2OU2A 3UEYA 1OMTA 2CWFA 1CGII 2JZMA 4SGBI 1H0ZA 1P9ZA 4FKDA 1R79A 1NUBA 1SGQI 2ROWA 1K7VA 1WKXA 1TUSA 3HH2C 1TBRR 1ULKA 2QQ0A 1RFHA 3QWPA 1WGCA 2YQPA 1Y8FA 2ARPF 2WCYA 1UHAA 3TOBA 4A24A 1Y1CA 3PDNA 1S20A 1CHOI 5J8CA 3UGDA 5JHWC 2QQEA 2M5XA 3UEJA 1VDDA 5FUWA 5HQ8A 2QQDA 4UXJA 4JCVE 1TURA 2L7XA 2N52A 2GKTI 1TBQR 3UGLA 1M8BA 5DAEA 2VRWB 4AMLA 2ELIA 1M8CA 1CSOI 1SGYI 2E73A 2GVIA 2JXDA 5E3RA 3FSYA 1CGJI 2J87A 2L8EA 2BUSA 2NU3I 3B4VC 1CT4I 4E1RA 3FC3A 2JYYA 2Y0MA 2NU4I 4OVOA 2W0TA 1V1IA 1TBNA 1HJAI 2RC4A 2KCXA 3E2IA 2CWGA 1LR8A 2X52A 3UFFA 9WGAA 1IY6A 2ORWA 2OD1A 1V1HA 5CCMA 2NU1I 4DNCA 2JW6A 1TBOA 2YUUA 3TJQA 2B0UC 1IY5A 1PPFI 1WTJA 4L9MA 1X4SA 1AN1I 5E3QA 4MPIA 2DIPA 1HDLA 1K7TA 1UVGA 2A20A 2GKRI 1MJBA 1OMUA 1TOTA 2ERWA 2LEOA 2WVJA 3OXGA 2F3CI 1IW4A 2OZUA 1FAQA 1YTPA 1MJAA 3R5BA 2NU2I 2V1CC 2GKVA 1UUCA 2KMRA 2N17A 2UZ3A 1Z2IA 1LR7A 2E5RA 5FUVA 4E1PA 1W3SA 2SGEI 5EX3A 1BMOA 1KBFA 2N71A 1HPTA 1PCEA 1X74A 3VDUA 3R5DA 1TIHA 2V1CA 2KMPA 3SEKC 1ULMA 3OXLA 3CXLA 2OVOA 3GOXA 1PJUA 1KMAA 1R0RI 1XA6A 4B6DA 3SGBI 1Z7KB 3BJIA 5FUXA 1NXUA
chains in the Genus database with same CATH topology
1YU6C 1SGEI 1MT1A 1FYBA 1CT0I 5EX0A 3OXFA 1SGNI 2QQCA 1SGDI 1SGRI 3VDPA 2DB6A 3D00A 3MEKA 1UVFA 2SGDI 3QTLD 3OL0A 4UXHA 1DS2I 2NU0I 3OVOA 1CE3A 1N13A 2SGPI 1TGSI 1FARA 2B8TA 2J9RA 2LUYA 1CT2I 2K9HA 4HGUA 2KMQA 1Y1BA 2JA1A 5HI7A 2ENNA 2ORVA 1PTQA 1XX6A 3RU0A 4UXIA 1OYVI 1OVOA 2KMOA 1W4RA 1XBTA 3VE5A 5CCLA 2QPOA 1DS3I 2SGQI 4GI3C 1KBEA 2ODDA 2V53A 3E59A 1PTRA 1BUSA 1SGPI 2N1AB 1U5KA 2CJSC 1LR9A 2XRCA 2FNFX 5FUYA 2P6AC 3SGQI 3KY9A 3UGIA 2SGFI 2ENZA 3UEYA 1OMTA 1CGII 2JZMA 4SGBI 1H0ZA 4FKDA 1R79A 1NUBA 1SGQI 2ROWA 1TUSA 3HH2C 1TBRR 2QQ0A 3QWPA 1RFHA 2YQPA 1Y8FA 2ARPF 2WCYA 4A24A 1Y1CA 3PDNA 1CHOI 3UGDA 5JHWC 2QQEA 2M5XA 3UEJA 1VDDA 5FUWA 5HQ8A 2QQDA 4UXJA 4JCVE 1TURA 2L7XA 2N52A 2GKTI 1TBQR 3UGLA 1M8BA 5DAEA 2VRWB 2ELIA 1M8CA 1CSOI 1SGYI 2E73A 2GVIA 2JXDA 1CGJI 2J87A 2L8EA 2BUSA 2NU3I 3B4VC 1CT4I 4E1RA 3FC3A 2JYYA 2NU4I 4OVOA 2W0TA 1V1IA 1TBNA 1HJAI 2KCXA 3E2IA 1LR8A 3UFFA 1IY6A 2ORWA 2OD1A 1V1HA 5CCMA 2NU1I 2JW6A 1TBOA 2YUUA 3TJQA 2B0UC 1IY5A 1PPFI 4L9MA 1X4SA 1AN1I 2DIPA 1HDLA 1UVGA 2A20A 2GKRI 1OMUA 2LEOA 1TOTA 2ERWA 2WVJA 3OXGA 1IW4A 2F3CI 1FAQA 1YTPA 2NU2I 2V1CC 2GKVA 1UUCA 2KMRA 2N17A 2UZ3A 2E5RA 1LR7A 5FUVA 4E1PA 1W3SA 2SGEI 5EX3A 1BMOA 1KBFA 2N71A 1HPTA 1PCEA 1X74A 3VDUA 1TIHA 2V1CA 2KMPA 3SEKC 3OXLA 3CXLA 2OVOA 3GOXA 1PJUA 1KMAA 1R0RI 1XA6A 4B6DA 3SGBI 1Z7KB 3BJIA 5FUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YU6 C;  1SGE I;  1MT1 A;  1FYB A;  1CT0 I;  1SGN I;  2QQC A;  1SGD I;  1SGR I;  1UVF A;  2SGD I;  3QTL D;  1DS2 I;  2NU0 I;  3OVO A;  1CE3 A;  1N13 A;  2SGP I;  1TGS I;  1CT2 I;  4HGU A;  2KMQ A;  1Y1B A;  1OYV I;  2KMO A;  1OVO A;  2SGQ I;  1DS3 I;  4GI3 C;  2V53 A;  1BUS A;  1SGP I;  1LR9 A;  2XRC A;  2P6A C;  3SGQ I;  2SGF I;  1OMT A;  1CGI I;  2JZM A;  4SGB I;  1H0Z A;  1NUB A;  1SGQ I;  1TUS A;  3HH2 C;  1TBR R;  2ARP F;  2WCY A;  1Y1C A;  1CHO I;  5JHW C;  2M5X A;  2QQD A;  1TUR A;  2N52 A;  2GKT I;  1TBQ R;  1M8B A;  5DAE A;  1M8C A;  1CSO I;  1SGY I;  2JXD A;  1CGJ I;  2BUS A;  2NU3 I;  3B4V C;  1CT4 I;  2JYY A;  2NU4 I;  4OVO A;  1HJA I;  2KCX A;  1LR8 A;  1IY6 A;  2NU1 I;  3TJQ A;  2B0U C;  1IY5 A;  1PPF I;  1AN1 I;  1HDL A;  1UVG A;  2GKR I;  1OMU A;  2LEO A;  2ERW A;  1IW4 A;  2F3C I;  1YTP A;  2NU2 I;  2GKV A;  1UUC A;  2KMR A;  2N17 A;  1LR7 A;  2SGE I;  1BMO A;  2N71 A;  1HPT A;  1PCE A;  1TIH A;  2KMP A;  3SEK C;  2OVO A;  1PJU A;  1KMA A;  1R0R I;  3SGB I;  1Z7K B; 
#chains in the Genus database with same CATH topology
 1YU6 C;  1SGE I;  1MT1 A;  2WGC A;  1FYB A;  1CT0 I;  3FSX A;  1ULN A;  1SGN I;  2QQC A;  1SGD I;  1SGR I;  3OXF A;  5EX0 A;  3VDP A;  3QAH A;  2DB6 A;  3D00 A;  3MEK A;  1UVF A;  3R5A A;  2SGD I;  2PQ8 A;  3OL0 A;  3QTL D;  4UXH A;  3UOE A;  1K7U A;  1DS2 I;  2NU0 I;  3OVO A;  3TO7 A;  1CE3 A;  1N13 A;  3TOA A;  2SGP I;  1TGS I;  1FAR A;  1P9G A;  2B8T A;  1Q9B A;  2J9R A;  2LB7 A;  2LUY A;  1MJ9 A;  2GIV A;  1CT2 I;  2K9H A;  4HGU A;  2KMQ A;  1Y1B A;  2JA1 A;  5HI7 A;  2ENN A;  2ORV A;  1PTQ A;  2UVO A;  1XX6 A;  3RU0 A;  4UXI A;  1WGT A;  3TO6 A;  1OYV I;  1OVO A;  2KMO A;  1W4R A;  1XBT A;  3VE5 A;  5CCL A;  5J8F A;  2QPO A;  1DS3 I;  2SGQ I;  1HEV A;  2CWH A;  3TO9 A;  4GI3 C;  3R5C A;  5E3P A;  1KBE A;  2ODD A;  2V53 A;  3E59 A;  1PTR A;  7WGA A;  1SGP I;  1FY7 A;  2RIJ A;  1BUS A;  2DKV A;  1U5K A;  2CJS C;  1LR9 A;  2N1A B;  2FNF X;  2X3T A;  2XRC A;  2P6A C;  5FUY A;  3SGQ I;  3KY9 A;  3UGI A;  2SGF I;  4WP4 A;  2ENZ A;  2OU2 A;  3UEY A;  1OMT A;  2CWF A;  1CGI I;  2JZM A;  4SGB I;  1H0Z A;  1P9Z A;  4FKD A;  1R79 A;  1NUB A;  1SGQ I;  2ROW A;  1K7V A;  1WKX A;  1TUS A;  3HH2 C;  1TBR R;  1ULK A;  2QQ0 A;  1RFH A;  3QWP A;  1WGC A;  2YQP A;  1Y8F A;  2ARP F;  2WCY A;  1UHA A;  3TOB A;  4A24 A;  1Y1C A;  3PDN A;  1S20 A;  1CHO I;  5J8C A;  3UGD A;  5JHW C;  2QQE A;  2M5X A;  3UEJ A;  1VDD A;  5FUW A;  5HQ8 A;  2QQD A;  4UXJ A;  4JCV E;  1TUR A;  2L7X A;  2N52 A;  2GKT I;  1TBQ R;  3UGL A;  1M8B A;  5DAE A;  2VRW B;  4AML A;  2ELI A;  1M8C A;  1CSO I;  1SGY I;  2E73 A;  2GVI A;  2JXD A;  5E3R A;  3FSY A;  1CGJ I;  2J87 A;  2L8E A;  2BUS A;  2NU3 I;  3B4V C;  1CT4 I;  4E1R A;  3FC3 A;  2JYY A;  2Y0M A;  2NU4 I;  4OVO A;  2W0T A;  1V1I A;  1TBN A;  1HJA I;  2RC4 A;  2KCX A;  3E2I A;  2CWG A;  1LR8 A;  2X52 A;  3UFF A;  9WGA A;  1IY6 A;  2ORW A;  2OD1 A;  1V1H A;  5CCM A;  2NU1 I;  4DNC A;  2JW6 A;  1TBO A;  2YUU A;  3TJQ A;  2B0U C;  1IY5 A;  1PPF I;  1WTJ A;  4L9M A;  1X4S A;  1AN1 I;  5E3Q A;  4MPI A;  2DIP A;  1HDL A;  1K7T A;  1UVG A;  2A20 A;  2GKR I;  1MJB A;  1OMU A;  1TOT A;  2ERW A;  2LEO A;  2WVJ A;  3OXG A;  2F3C I;  1IW4 A;  2OZU A;  1FAQ A;  1YTP A;  1MJA A;  3R5B A;  2NU2 I;  2V1C C;  2GKV A;  1UUC A;  2KMR A;  2N17 A;  2UZ3 A;  1Z2I A;  1LR7 A;  2E5R A;  5FUV A;  4E1P A;  1W3S A;  2SGE I;  5EX3 A;  1BMO A;  1KBF A;  2N71 A;  1HPT A;  1PCE A;  1X74 A;  3VDU A;  3R5D A;  1TIH A;  2V1C A;  2KMP A;  3SEK C;  1ULM A;  3OXL A;  3CXL A;  2OVO A;  3GOX A;  1PJU A;  1KMA A;  1R0R I;  1XA6 A;  4B6D A;  3SGB I;  1Z7K B;  3BJI A;  5FUX A;  1NXU A; 
#chains in the Genus database with same CATH homology
 1YU6 C;  1SGE I;  1MT1 A;  1FYB A;  1CT0 I;  5EX0 A;  3OXF A;  1SGN I;  2QQC A;  1SGD I;  1SGR I;  3VDP A;  2DB6 A;  3D00 A;  3MEK A;  1UVF A;  2SGD I;  3QTL D;  3OL0 A;  4UXH A;  1DS2 I;  2NU0 I;  3OVO A;  1CE3 A;  1N13 A;  2SGP I;  1TGS I;  1FAR A;  2B8T A;  2J9R A;  2LUY A;  1CT2 I;  2K9H A;  4HGU A;  2KMQ A;  1Y1B A;  2JA1 A;  5HI7 A;  2ENN A;  2ORV A;  1PTQ A;  1XX6 A;  3RU0 A;  4UXI A;  1OYV I;  1OVO A;  2KMO A;  1W4R A;  1XBT A;  3VE5 A;  5CCL A;  2QPO A;  1DS3 I;  2SGQ I;  4GI3 C;  1KBE A;  2ODD A;  2V53 A;  3E59 A;  1PTR A;  1BUS A;  1SGP I;  2N1A B;  1U5K A;  2CJS C;  1LR9 A;  2XRC A;  2FNF X;  5FUY A;  2P6A C;  3SGQ I;  3KY9 A;  3UGI A;  2SGF I;  2ENZ A;  3UEY A;  1OMT A;  1CGI I;  2JZM A;  4SGB I;  1H0Z A;  4FKD A;  1R79 A;  1NUB A;  1SGQ I;  2ROW A;  1TUS A;  3HH2 C;  1TBR R;  2QQ0 A;  3QWP A;  1RFH A;  2YQP A;  1Y8F A;  2ARP F;  2WCY A;  4A24 A;  1Y1C A;  3PDN A;  1CHO I;  3UGD A;  5JHW C;  2QQE A;  2M5X A;  3UEJ A;  1VDD A;  5FUW A;  5HQ8 A;  2QQD A;  4UXJ A;  4JCV E;  1TUR A;  2L7X A;  2N52 A;  2GKT I;  1TBQ R;  3UGL A;  1M8B A;  5DAE A;  2VRW B;  2ELI A;  1M8C A;  1CSO I;  1SGY I;  2E73 A;  2GVI A;  2JXD A;  1CGJ I;  2J87 A;  2L8E A;  2BUS A;  2NU3 I;  3B4V C;  1CT4 I;  4E1R A;  3FC3 A;  2JYY A;  2NU4 I;  4OVO A;  2W0T A;  1V1I A;  1TBN A;  1HJA I;  2KCX A;  3E2I A;  1LR8 A;  3UFF A;  1IY6 A;  2ORW A;  2OD1 A;  1V1H A;  5CCM A;  2NU1 I;  2JW6 A;  1TBO A;  2YUU A;  3TJQ A;  2B0U C;  1IY5 A;  1PPF I;  4L9M A;  1X4S A;  1AN1 I;  2DIP A;  1HDL A;  1UVG A;  2A20 A;  2GKR I;  1OMU A;  2LEO A;  1TOT A;  2ERW A;  2WVJ A;  3OXG A;  1IW4 A;  2F3C I;  1FAQ A;  1YTP A;  2NU2 I;  2V1C C;  2GKV A;  1UUC A;  2KMR A;  2N17 A;  2UZ3 A;  2E5R A;  1LR7 A;  5FUV A;  4E1P A;  1W3S A;  2SGE I;  5EX3 A;  1BMO A;  1KBF A;  2N71 A;  1HPT A;  1PCE A;  1X74 A;  3VDU A;  1TIH A;  2V1C A;  2KMP A;  3SEK C;  3OXL A;  3CXL A;  2OVO A;  3GOX A;  1PJU A;  1KMA A;  1R0R I;  1XA6 A;  4B6D A;  3SGB I;  1Z7K B;  3BJI A;  5FUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...