1MT1A

The crystal structure of pyruvoyl-dependent arginine decarboxylase from methanococcus jannaschii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
PLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVNLIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PYRUVOYL-DEPENDENT ARGININE DECARBOXYLASE BETA CHAIN
publication title Pyruvoyl-Dependent Arginine Decarboxylase from Methanococcus jannaschii: Crystal Structures of the Self-Cleaved and S53A Proenzyme Forms
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 6
structure length 46
sequence length 46
chains with identical sequence C, E, G, I, K
ec nomenclature ec 4.1.1.19: Arginine decarboxylase.
pdb deposition date 2002-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1mt1A00
1BUSA 3OVOA 1NUBA 5DAEA 4HGUA 1CSOI 1TBQR 1M8CA 2SGFI 1UVGA 1M8BA 2QQDA 2BUSA 1DS3I 2KMQA 1IY5A 2GKTI 2OVOA 1HPTA 2N17A 2JYYA 1LR8A 2N71A 1IY6A 2ERWA 1BMOA 2SGQI 2KMOA 3TJQA 2NU4I 2P6AC 1IW4A 1SGEI 1Z7KB 1CGJI 1HDLA 2F3CI 1SGRI 4SGBI 1SGYI 1LR7A 1CT4I 2NU2I 1PCEA 2KMRA 1YTPA 1TURA 3SGBI 1Y1CA 1N13A 1SGNI 1TGSI 2SGEI 2JXDA 1CT0I 1FYBA 2N52A 3HH2C 1OVOA 1R0RI 2WCYA 4OVOA 2JZMA 2SGDI 2XRCA 1UUCA 1YU6C 1CGII 1LR9A 1CT2I 2M5XA 3SGQI 1SGQI 2KMPA 5JHWC 2GKVA 3SEKC 4GI3C 3B4VC 1DS2I 1SGPI 1CHOI 1HJAI 1H0ZA 2NU3I 1Y1BA 1CE3A 2ARPF 1PJUA 1TBRR 1OMUA 1OMTA 1SGDI 2V53A 1OYVI 1AN1I 2SGPI 2NU0I 3QTLD 2B0UC 1PPFI 1MT1A 2GKRI 2LEOA 1UVFA 2KCXA 2NU1I 2QQCA 1KMAA 1TIHA 1TUSA
chains in the Genus database with same CATH superfamily
1BUSA 3OVOA 3D00A 3KY9A 2J87A 3E2IA 1NUBA 3TO7A 5DAEA 1MJAA 2B8TA 5FUXA 2CWGA 3TOBA 1Y8FA 2QPOA 2OD1A 4HGUA 1CSOI 1TBQR 2GIVA 3OXFA 1M8CA 2QQEA 1UVGA 2SGFI 1X74A 2X52A 4DNCA 1M8BA 1TOTA 2QQDA 5FUWA 2BUSA 1DS3I 3QAHA 2KMQA 1IY5A 2GKTI 2V1CA 2OVOA 1HPTA 2GVIA 2PQ8A 2N17A 3VDPA 2JYYA 5J8CA 1LR8A 2N71A 1IY6A 4L9MA 2A20A 1BMOA 2ERWA 5EX0A 2SGQI 4E1RA 2KMOA 3TJQA 5CCLA 2ODDA 2NU4I 1HEVA 4E1PA 2ROWA 3UGDA 1K7VA 2L7XA 2P6AC 2E5RA 1IW4A 1SGEI 3VE5A 1Z7KB 1CGJI 5FUYA 1HDLA 5E3QA 2F3CI 5CCMA 1SGRI 1PTRA 3FSYA 4SGBI 5HI7A 1SGYI 1XBTA 3E59A 1LR7A 4UXIA 2UZ3A 1UHAA 1CT4I 2ORWA 1XX6A 1FY7A 2NU2I 2K9HA 3R5CA 4WP4A 1P9GA 1PCEA 4MPIA 5J8FA 2KMRA 2VRWB 1K7TA 1YTPA 2N1AB 1TURA 3SGBI 3CXLA 9WGAA 1Y1CA 2DIPA 1N13A 1SGNI 3UGIA 3FC3A 2LUYA 1Z2IA 1KBFA 1TGSI 2WVJA 2QQ0A 2JXDA 1CT0I 2SGEI 2DB6A 3TO9A 1MJBA 1R79A 2ENZA 1FYBA 2N52A 4B6DA 3HH2C 4UXHA 5HQ8A 1OVOA 1FARA 5E3RA 3UEJA 1P9ZA 1R0RI 2WCYA 4OVOA 3UOEA 2JZMA 2W0TA 5FUVA 1FAQA 3UFFA 2SGDI 2XRCA 1UUCA 1YU6C 7WGAA 1CGII 3UEYA 1K7UA 1LR9A 1CT2I 2M5XA 3UGLA 2YQPA 3SGQI 4UXJA 1SGQI 1TBOA 1WGCA 2KMPA 5JHWC 3OXGA 2GKVA 3R5AA 2Y0MA 4GI3C 3B4VC 3SEKC 1Q9BA 5EX3A 1DS2I 4A24A 1SGPI 1CHOI 1HJAI 2CWHA 3QWPA 1V1IA 4FKDA 1H0ZA 2NU3I 3TO6A 1Y1BA 2FNFX 3R5BA 1TBNA 1W3SA 1CE3A 2ARPF 1RFHA 1MJ9A 2ELIA 1NXUA 2X3TA 1PJUA 1PTQA 2ORVA 1W4RA 1TBRR 1OMUA 2V1CC 3OL0A 3BJIA 3TOAA 2RC4A 1OMTA 1SGDI 2ENNA 3R5DA 2YUUA 2V53A 1S20A 3PDNA 1ULNA 1OYVI 1AN1I 2SGPI 2NU0I 1KBEA 2LB7A 2L8EA 3QTLD 2B0UC 1PPFI 2CWFA 1MT1A 1XA6A 1WGTA 2JA1A 2OZUA 4JCVE 2GKRI 2LEOA 1X4SA 1UVFA 2J9RA 2CJSC 2JW6A 3OXLA 1U5KA 1V1HA 2KCXA 2OU2A 3MEKA 1WKXA 1WTJA 2E73A 2NU1I 2QQCA 2UVOA 3FSXA 1KMAA 1TIHA 1TUSA 2RIJA 3VDUA 4AMLA 5E3PA 1ULKA 1VDDA 3GOXA 1ULMA 3RU0A 2WGCA 2DKVA
chains in the Genus database with same CATH topology
1BUSA 3OVOA 3D00A 3KY9A 2J87A 3E2IA 1NUBA 5DAEA 2B8TA 5FUXA 1Y8FA 2QPOA 2OD1A 4HGUA 1CSOI 1TBQR 3OXFA 1M8CA 2QQEA 1UVGA 2SGFI 1X74A 1M8BA 1TOTA 2QQDA 5FUWA 2BUSA 1DS3I 2KMQA 1IY5A 2GKTI 2V1CA 2OVOA 1HPTA 2GVIA 2N17A 3VDPA 2JYYA 1LR8A 2N71A 1IY6A 4L9MA 2A20A 1BMOA 2ERWA 5EX0A 2SGQI 4E1RA 2KMOA 3TJQA 5CCLA 2ODDA 2NU4I 4E1PA 2ROWA 3UGDA 2P6AC 2L7XA 2E5RA 1IW4A 1SGEI 3VE5A 1Z7KB 1CGJI 5FUYA 1HDLA 2F3CI 5CCMA 1SGRI 1PTRA 4SGBI 5HI7A 1SGYI 1XBTA 3E59A 1LR7A 4UXIA 2UZ3A 1CT4I 2ORWA 1XX6A 2NU2I 2K9HA 1PCEA 2KMRA 2VRWB 1YTPA 2N1AB 1TURA 3SGBI 3CXLA 1Y1CA 2DIPA 1N13A 1SGNI 3UGIA 3FC3A 2LUYA 1TGSI 2WVJA 2QQ0A 2JXDA 1CT0I 2SGEI 2DB6A 1R79A 2ENZA 1FYBA 2N52A 4B6DA 3HH2C 4UXHA 5HQ8A 1OVOA 1FARA 3UEJA 1R0RI 2WCYA 4OVOA 2JZMA 2W0TA 5FUVA 1FAQA 3UFFA 2SGDI 2XRCA 1UUCA 1YU6C 1CGII 3UEYA 1LR9A 1CT2I 2M5XA 3UGLA 2YQPA 3SGQI 4UXJA 1SGQI 1TBOA 2KMPA 5JHWC 3OXGA 2GKVA 3SEKC 4GI3C 3B4VC 5EX3A 1DS2I 4A24A 1SGPI 1CHOI 1HJAI 3QWPA 1V1IA 4FKDA 1H0ZA 2NU3I 1Y1BA 2FNFX 1TBNA 1W3SA 1CE3A 2ARPF 1RFHA 2ELIA 1PJUA 1PTQA 2ORVA 1W4RA 1TBRR 1OMUA 2V1CC 3OL0A 3BJIA 1KBFA 1OMTA 1SGDI 2ENNA 2YUUA 2V53A 3PDNA 1OYVI 1AN1I 2SGPI 2NU0I 1KBEA 2L8EA 3QTLD 2B0UC 1PPFI 1MT1A 1XA6A 2JA1A 4JCVE 2GKRI 2LEOA 1X4SA 1UVFA 2J9RA 2CJSC 2JW6A 3OXLA 1U5KA 1V1HA 2KCXA 3MEKA 2E73A 2NU1I 2QQCA 1KMAA 1TIHA 1TUSA 3VDUA 1VDDA 3GOXA 3RU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUS A;  3OVO A;  1NUB A;  5DAE A;  4HGU A;  1CSO I;  1TBQ R;  1M8C A;  2SGF I;  1UVG A;  1M8B A;  2QQD A;  2BUS A;  1DS3 I;  2KMQ A;  1IY5 A;  2GKT I;  2OVO A;  1HPT A;  2N17 A;  2JYY A;  1LR8 A;  2N71 A;  1IY6 A;  2ERW A;  1BMO A;  2SGQ I;  2KMO A;  3TJQ A;  2NU4 I;  2P6A C;  1IW4 A;  1SGE I;  1Z7K B;  1CGJ I;  1HDL A;  2F3C I;  1SGR I;  4SGB I;  1SGY I;  1LR7 A;  1CT4 I;  2NU2 I;  1PCE A;  2KMR A;  1YTP A;  1TUR A;  3SGB I;  1Y1C A;  1N13 A;  1SGN I;  1TGS I;  2SGE I;  2JXD A;  1CT0 I;  1FYB A;  2N52 A;  3HH2 C;  1OVO A;  1R0R I;  2WCY A;  4OVO A;  2JZM A;  2SGD I;  2XRC A;  1UUC A;  1YU6 C;  1CGI I;  1LR9 A;  1CT2 I;  2M5X A;  3SGQ I;  1SGQ I;  2KMP A;  5JHW C;  2GKV A;  3SEK C;  4GI3 C;  3B4V C;  1DS2 I;  1SGP I;  1CHO I;  1HJA I;  1H0Z A;  2NU3 I;  1Y1B A;  1CE3 A;  2ARP F;  1PJU A;  1TBR R;  1OMU A;  1OMT A;  1SGD I;  2V53 A;  1OYV I;  1AN1 I;  2SGP I;  2NU0 I;  3QTL D;  2B0U C;  1PPF I;  1MT1 A;  2GKR I;  2LEO A;  1UVF A;  2KCX A;  2NU1 I;  2QQC A;  1KMA A;  1TIH A;  1TUS A; 
#chains in the Genus database with same CATH topology
 1BUS A;  3OVO A;  3D00 A;  3KY9 A;  2J87 A;  3E2I A;  1NUB A;  3TO7 A;  5DAE A;  1MJA A;  2B8T A;  5FUX A;  2CWG A;  3TOB A;  1Y8F A;  2QPO A;  2OD1 A;  4HGU A;  1CSO I;  1TBQ R;  2GIV A;  3OXF A;  1M8C A;  2QQE A;  1UVG A;  2SGF I;  1X74 A;  2X52 A;  4DNC A;  1M8B A;  1TOT A;  2QQD A;  5FUW A;  2BUS A;  1DS3 I;  3QAH A;  2KMQ A;  1IY5 A;  2GKT I;  2V1C A;  2OVO A;  1HPT A;  2GVI A;  2PQ8 A;  2N17 A;  3VDP A;  2JYY A;  5J8C A;  1LR8 A;  2N71 A;  1IY6 A;  4L9M A;  2A20 A;  1BMO A;  2ERW A;  5EX0 A;  2SGQ I;  4E1R A;  2KMO A;  3TJQ A;  5CCL A;  2ODD A;  2NU4 I;  1HEV A;  4E1P A;  2ROW A;  3UGD A;  1K7V A;  2L7X A;  2P6A C;  2E5R A;  1IW4 A;  1SGE I;  3VE5 A;  1Z7K B;  1CGJ I;  5FUY A;  1HDL A;  5E3Q A;  2F3C I;  5CCM A;  1SGR I;  1PTR A;  3FSY A;  4SGB I;  5HI7 A;  1SGY I;  1XBT A;  3E59 A;  1LR7 A;  4UXI A;  2UZ3 A;  1UHA A;  1CT4 I;  2ORW A;  1XX6 A;  1FY7 A;  2NU2 I;  2K9H A;  3R5C A;  4WP4 A;  1P9G A;  1PCE A;  4MPI A;  5J8F A;  2KMR A;  2VRW B;  1K7T A;  1YTP A;  2N1A B;  1TUR A;  3SGB I;  3CXL A;  9WGA A;  1Y1C A;  2DIP A;  1N13 A;  1SGN I;  3UGI A;  3FC3 A;  2LUY A;  1Z2I A;  1KBF A;  1TGS I;  2WVJ A;  2QQ0 A;  2JXD A;  1CT0 I;  2SGE I;  2DB6 A;  3TO9 A;  1MJB A;  1R79 A;  2ENZ A;  1FYB A;  2N52 A;  4B6D A;  3HH2 C;  4UXH A;  5HQ8 A;  1OVO A;  1FAR A;  5E3R A;  3UEJ A;  1P9Z A;  1R0R I;  2WCY A;  4OVO A;  3UOE A;  2JZM A;  2W0T A;  5FUV A;  1FAQ A;  3UFF A;  2SGD I;  2XRC A;  1UUC A;  1YU6 C;  7WGA A;  1CGI I;  3UEY A;  1K7U A;  1LR9 A;  1CT2 I;  2M5X A;  3UGL A;  2YQP A;  3SGQ I;  4UXJ A;  1SGQ I;  1TBO A;  1WGC A;  2KMP A;  5JHW C;  3OXG A;  2GKV A;  3R5A A;  2Y0M A;  4GI3 C;  3B4V C;  3SEK C;  1Q9B A;  5EX3 A;  1DS2 I;  4A24 A;  1SGP I;  1CHO I;  1HJA I;  2CWH A;  3QWP A;  1V1I A;  4FKD A;  1H0Z A;  2NU3 I;  3TO6 A;  1Y1B A;  2FNF X;  3R5B A;  1TBN A;  1W3S A;  1CE3 A;  2ARP F;  1RFH A;  1MJ9 A;  2ELI A;  1NXU A;  2X3T A;  1PJU A;  1PTQ A;  2ORV A;  1W4R A;  1TBR R;  1OMU A;  2V1C C;  3OL0 A;  3BJI A;  3TOA A;  2RC4 A;  1OMT A;  1SGD I;  2ENN A;  3R5D A;  2YUU A;  2V53 A;  1S20 A;  3PDN A;  1ULN A;  1OYV I;  1AN1 I;  2SGP I;  2NU0 I;  1KBE A;  2LB7 A;  2L8E A;  3QTL D;  2B0U C;  1PPF I;  2CWF A;  1MT1 A;  1XA6 A;  1WGT A;  2JA1 A;  2OZU A;  4JCV E;  2GKR I;  2LEO A;  1X4S A;  1UVF A;  2J9R A;  2CJS C;  2JW6 A;  3OXL A;  1U5K A;  1V1H A;  2KCX A;  2OU2 A;  3MEK A;  1WKX A;  1WTJ A;  2E73 A;  2NU1 I;  2QQC A;  2UVO A;  3FSX A;  1KMA A;  1TIH A;  1TUS A;  2RIJ A;  3VDU A;  4AML A;  5E3P A;  1ULK A;  1VDD A;  3GOX A;  1ULM A;  3RU0 A;  2WGC A;  2DKV A; 
#chains in the Genus database with same CATH homology
 1BUS A;  3OVO A;  3D00 A;  3KY9 A;  2J87 A;  3E2I A;  1NUB A;  5DAE A;  2B8T A;  5FUX A;  1Y8F A;  2QPO A;  2OD1 A;  4HGU A;  1CSO I;  1TBQ R;  3OXF A;  1M8C A;  2QQE A;  1UVG A;  2SGF I;  1X74 A;  1M8B A;  1TOT A;  2QQD A;  5FUW A;  2BUS A;  1DS3 I;  2KMQ A;  1IY5 A;  2GKT I;  2V1C A;  2OVO A;  1HPT A;  2GVI A;  2N17 A;  3VDP A;  2JYY A;  1LR8 A;  2N71 A;  1IY6 A;  4L9M A;  2A20 A;  1BMO A;  2ERW A;  5EX0 A;  2SGQ I;  4E1R A;  2KMO A;  3TJQ A;  5CCL A;  2ODD A;  2NU4 I;  4E1P A;  2ROW A;  3UGD A;  2P6A C;  2L7X A;  2E5R A;  1IW4 A;  1SGE I;  3VE5 A;  1Z7K B;  1CGJ I;  5FUY A;  1HDL A;  2F3C I;  5CCM A;  1SGR I;  1PTR A;  4SGB I;  5HI7 A;  1SGY I;  1XBT A;  3E59 A;  1LR7 A;  4UXI A;  2UZ3 A;  1CT4 I;  2ORW A;  1XX6 A;  2NU2 I;  2K9H A;  1PCE A;  2KMR A;  2VRW B;  1YTP A;  2N1A B;  1TUR A;  3SGB I;  3CXL A;  1Y1C A;  2DIP A;  1N13 A;  1SGN I;  3UGI A;  3FC3 A;  2LUY A;  1TGS I;  2WVJ A;  2QQ0 A;  2JXD A;  1CT0 I;  2SGE I;  2DB6 A;  1R79 A;  2ENZ A;  1FYB A;  2N52 A;  4B6D A;  3HH2 C;  4UXH A;  5HQ8 A;  1OVO A;  1FAR A;  3UEJ A;  1R0R I;  2WCY A;  4OVO A;  2JZM A;  2W0T A;  5FUV A;  1FAQ A;  3UFF A;  2SGD I;  2XRC A;  1UUC A;  1YU6 C;  1CGI I;  3UEY A;  1LR9 A;  1CT2 I;  2M5X A;  3UGL A;  2YQP A;  3SGQ I;  4UXJ A;  1SGQ I;  1TBO A;  2KMP A;  5JHW C;  3OXG A;  2GKV A;  3SEK C;  4GI3 C;  3B4V C;  5EX3 A;  1DS2 I;  4A24 A;  1SGP I;  1CHO I;  1HJA I;  3QWP A;  1V1I A;  4FKD A;  1H0Z A;  2NU3 I;  1Y1B A;  2FNF X;  1TBN A;  1W3S A;  1CE3 A;  2ARP F;  1RFH A;  2ELI A;  1PJU A;  1PTQ A;  2ORV A;  1W4R A;  1TBR R;  1OMU A;  2V1C C;  3OL0 A;  3BJI A;  1KBF A;  1OMT A;  1SGD I;  2ENN A;  2YUU A;  2V53 A;  3PDN A;  1OYV I;  1AN1 I;  2SGP I;  2NU0 I;  1KBE A;  2L8E A;  3QTL D;  2B0U C;  1PPF I;  1MT1 A;  1XA6 A;  2JA1 A;  4JCV E;  2GKR I;  2LEO A;  1X4S A;  1UVF A;  2J9R A;  2CJS C;  2JW6 A;  3OXL A;  1U5K A;  1V1H A;  2KCX A;  3MEK A;  2E73 A;  2NU1 I;  2QQC A;  1KMA A;  1TIH A;  1TUS A;  3VDU A;  1VDD A;  3GOX A;  3RU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...