1MT1A

The crystal structure of pyruvoyl-dependent arginine decarboxylase from methanococcus jannaschii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
PLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVNLIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyruvoyl-Dependent Arginine Decarboxylase from Methanococcus jannaschii: Crystal Structures of the Self-Cleaved and S53A Proenzyme Forms
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
molecule keywords PYRUVOYL-DEPENDENT ARGININE DECARBOXYLASE BETA CHAIN
total genus 6
structure length 46
sequence length 46
chains with identical sequence C, E, G, I, K
ec nomenclature ec 4.1.1.19: Arginine decarboxylase.
pdb deposition date 2002-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1mt1A00
2KMPA 1IY6A 1CE3A 2P6AC 1HJAI 2LEOA 1OYVI 1CGJI 1FYBA 1UVGA 2NU1I 4SGBI 1AN1I 1LR7A 1Y1CA 3B4VC 1LR9A 2N17A 2GKVA 2OVOA 2JYYA 3SEKC 1PJUA 1Y1BA 3SGBI 4OVOA 1CSOI 2NU4I 1YTPA 2BUSA 1M8BA 1PPFI 3TJQA 2KCXA 2N52A 1UUCA 2N71A 2NU0I 1TURA 1YU6C 1IW4A 2QQCA 1SGEI 1SGYI 2JZMA 2KMOA 2WCYA 1OMTA 2GKTI 1CHOI 2JXDA 1CT4I 2NU3I 1CT2I 2NU2I 1CT0I 1DS3I 2M5XA 2KMRA 1TBRR 2V53A 5JHWC 4HGUA 3QTLD 1CGII 3SGQI 2QQDA 2ARPF 1SGRI 2ERWA 1LR8A 1PCEA 2B0UC 1BUSA 1TUSA 1HDLA 2XRCA 1IY5A 1TIHA 1OVOA 1M8CA 3HH2C 2SGPI 1SGPI 1TGSI 1SGQI 1KMAA 1SGNI 1H0ZA 1R0RI 1OMUA 1TBQR 4GI3C 2GKRI 1NUBA 2SGEI 1UVFA 1MT1A 1HPTA 3OVOA 2SGQI 2F3CI 1BMOA 2SGFI 1Z7KB 2SGDI 1N13A 5DAEA 1DS2I 2KMQA 1SGDI
chains in the Genus database with same CATH superfamily
1NXUA 2KMPA 1IY6A 5EX0A 2DIPA 1CE3A 2P6AC 1HJAI 1XBTA 2LEOA 1OYVI 1CGJI 1FYBA 5J8CA 5HQ8A 1UVGA 2NU1I 1XA6A 4SGBI 3OXFA 1AN1I 1LR7A 1Y1CA 5FUXA 3D00A 3B4VC 1LR9A 1WKXA 2N17A 3BJIA 1ULNA 2GKVA 3R5DA 1W3SA 3R5CA 2OVOA 1Y8FA 4E1RA 2RIJA 2JYYA 4JCVE 2OD1A 4A24A 2QQ0A 1KBFA 3SEKC 3UEJA 1Q9BA 1FY7A 1R79A 9WGAA 1PJUA 1Y1BA 2QPOA 3OXGA 3SGBI 4OVOA 1CSOI 2NU4I 1YTPA 2BUSA 1SGDI 1M8BA 1V1IA 3UEYA 3TOBA 5CCMA 2JA1A 2DB6A 3UOEA 1PPFI 3TJQA 5CCLA 3FC3A 1P9GA 1TBOA 2WVJA 2OU2A 2KCXA 2ODDA 2N52A 3MEKA 5FUVA 3TO7A 1UUCA 2N71A 2NU0I 2ROWA 1TURA 2N1AB 2UZ3A 1YU6C 1IW4A 2QQCA 1SGEI 1SGYI 2Y0MA 3R5BA 1X4SA 1K7VA 4UXJA 3VE5A 2JZMA 2KMOA 1FAQA 1FARA 5E3QA 2E73A 2WCYA 3E59A 3KY9A 3OXLA 4AMLA 1ULMA 1OMTA 2L8EA 1HEVA 2GKTI 1CHOI 4B6DA 2ORVA 2JXDA 3FSYA 1CT4I 2NU3I 3R5AA 1CT2I 2GVIA 2J87A 4WP4A 1MJBA 2ORWA 1KBEA 2NU2I 1CT0I 3GOXA 2DKVA 1DS3I 2M5XA 2KMRA 1TBRR 2V53A 2VRWB 3TO9A 5JHWC 2J9RA 4HGUA 3QTLD 1CGII 1XX6A 2CWHA 2X3TA 3VDPA 3SGQI 2LB7A 2ARPF 2QQDA 1SGRI 1TOTA 1TBNA 2ERWA 2PQ8A 1LR8A 3CXLA 1PCEA 2B0UC 3E2IA 5E3PA 3UFFA 1BUSA 1TUSA 1UHAA 1K7TA 2L7XA 1HDLA 2XRCA 1IY5A 3UGIA 1TIHA 1PTRA 2V1CC 3QWPA 1OVOA 1M8CA 1WGCA 3HH2C 2GIVA 1ULKA 1SGPI 1TGSI 2ELIA 1SGQI 2OZUA 2SGPI 2W0TA 1KMAA 1SGNI 3UGDA 3VDUA 1H0ZA 1R0RI 1K7UA 2X52A 3TOAA 5E3RA 5EX3A 2FNFX 5FUWA 2CWGA 1OMUA 1TBQR 4GI3C 2ENNA 3OL0A 2GKRI 1NUBA 1MJAA 2JW6A 2SGEI 4MPIA 4UXHA 1W4RA 1V1HA 1VDDA 2YQPA 1UVFA 3FSXA 3TO6A 2A20A 5J8FA 1MT1A 1HPTA 2RC4A 2YUUA 3OVOA 1X74A 2SGQI 4FKDA 2CWFA 3QAHA 7WGAA 2E5RA 4DNCA 2F3CI 4E1PA 1BMOA 2WGCA 2ENZA 2V1CA 3PDNA 4L9MA 4UXIA 1RFHA 2LUYA 2CJSC 2SGFI 1Z7KB 1S20A 1WTJA 2B8TA 2SGDI 1MJ9A 1N13A 5DAEA 2QQEA 1DS2I 3RU0A 2UVOA 1PTQA 2K9HA 2KMQA 5FUYA 3UGLA 1P9ZA 1WGTA 1U5KA 1Z2IA 5HI7A
chains in the Genus database with same CATH topology
2KMPA 1IY6A 5EX0A 2DIPA 1CE3A 2P6AC 1HJAI 1XBTA 2LEOA 1OYVI 1CGJI 1FYBA 5HQ8A 1UVGA 2NU1I 1XA6A 4SGBI 3OXFA 1AN1I 1LR7A 1Y1CA 5FUXA 3D00A 3B4VC 1LR9A 2N17A 3BJIA 2GKVA 1W3SA 2OVOA 1Y8FA 4E1RA 2JYYA 4JCVE 2OD1A 4A24A 2QQ0A 1KBFA 3SEKC 3UEJA 1R79A 1PJUA 1Y1BA 2QPOA 3OXGA 3SGBI 4OVOA 1CSOI 2NU4I 1YTPA 2BUSA 1SGDI 1M8BA 1V1IA 3UEYA 5CCMA 2JA1A 2DB6A 5CCLA 1PPFI 3TJQA 3FC3A 1TBOA 2WVJA 3MEKA 2KCXA 2ODDA 2N52A 5FUVA 1UUCA 2N71A 2NU0I 2ROWA 1TURA 2N1AB 2UZ3A 1YU6C 1IW4A 2QQCA 1SGEI 1SGYI 1X4SA 4UXJA 3VE5A 2JZMA 2KMOA 1FAQA 1FARA 2E73A 2WCYA 3E59A 3KY9A 3OXLA 1OMTA 2L8EA 2GKTI 1CHOI 4B6DA 2ORVA 2JXDA 1CT4I 2NU3I 1CT2I 2GVIA 2J87A 2ORWA 1KBEA 2NU2I 1CT0I 3GOXA 1DS3I 2M5XA 2KMRA 1TBRR 2V53A 2VRWB 5JHWC 2J9RA 4HGUA 3QTLD 1CGII 1XX6A 3VDPA 3SGQI 2QQDA 2ARPF 1SGRI 1TOTA 1TBNA 2ERWA 1LR8A 3CXLA 1PCEA 2B0UC 3E2IA 3UFFA 1BUSA 1TUSA 2L7XA 1HDLA 2XRCA 1IY5A 3UGIA 1TIHA 2V1CC 3QWPA 1OVOA 1M8CA 3HH2C 2SGPI 1SGPI 1TGSI 2ELIA 1SGQI 2W0TA 1KMAA 1SGNI 3UGDA 3VDUA 1H0ZA 1R0RI 5FUWA 5EX3A 2FNFX 1OMUA 1TBQR 4GI3C 2ENNA 3OL0A 2GKRI 1NUBA 2JW6A 2SGEI 4UXHA 1W4RA 1V1HA 1VDDA 2YQPA 1UVFA 2A20A 1MT1A 1HPTA 2YUUA 3OVOA 1X74A 2SGQI 4FKDA 2E5RA 2F3CI 4E1PA 1BMOA 2ENZA 2V1CA 3PDNA 4L9MA 4UXIA 1RFHA 2LUYA 2CJSC 2SGFI 1Z7KB 2B8TA 2SGDI 1N13A 5DAEA 2QQEA 1DS2I 3RU0A 1PTQA 2K9HA 2KMQA 5FUYA 3UGLA 1PTRA 1U5KA 5HI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMP A;  1IY6 A;  1CE3 A;  2P6A C;  1HJA I;  2LEO A;  1OYV I;  1CGJ I;  1FYB A;  1UVG A;  2NU1 I;  4SGB I;  1AN1 I;  1LR7 A;  1Y1C A;  3B4V C;  1LR9 A;  2N17 A;  2GKV A;  2OVO A;  2JYY A;  3SEK C;  1PJU A;  1Y1B A;  3SGB I;  4OVO A;  1CSO I;  2NU4 I;  1YTP A;  2BUS A;  1M8B A;  1PPF I;  3TJQ A;  2KCX A;  2N52 A;  1UUC A;  2N71 A;  2NU0 I;  1TUR A;  1YU6 C;  1IW4 A;  2QQC A;  1SGE I;  1SGY I;  2JZM A;  2KMO A;  2WCY A;  1OMT A;  2GKT I;  1CHO I;  2JXD A;  1CT4 I;  2NU3 I;  1CT2 I;  2NU2 I;  1CT0 I;  1DS3 I;  2M5X A;  2KMR A;  1TBR R;  2V53 A;  5JHW C;  4HGU A;  3QTL D;  1CGI I;  3SGQ I;  2QQD A;  2ARP F;  1SGR I;  2ERW A;  1LR8 A;  1PCE A;  2B0U C;  1BUS A;  1TUS A;  1HDL A;  2XRC A;  1IY5 A;  1TIH A;  1OVO A;  1M8C A;  3HH2 C;  2SGP I;  1SGP I;  1TGS I;  1SGQ I;  1KMA A;  1SGN I;  1H0Z A;  1R0R I;  1OMU A;  1TBQ R;  4GI3 C;  2GKR I;  1NUB A;  2SGE I;  1UVF A;  1MT1 A;  1HPT A;  3OVO A;  2SGQ I;  2F3C I;  1BMO A;  2SGF I;  1Z7K B;  2SGD I;  1N13 A;  5DAE A;  1DS2 I;  2KMQ A;  1SGD I; 
#chains in the Genus database with same CATH topology
 1NXU A;  2KMP A;  1IY6 A;  5EX0 A;  2DIP A;  1CE3 A;  2P6A C;  1HJA I;  1XBT A;  2LEO A;  1OYV I;  1CGJ I;  1FYB A;  5J8C A;  5HQ8 A;  1UVG A;  2NU1 I;  1XA6 A;  4SGB I;  3OXF A;  1AN1 I;  1LR7 A;  1Y1C A;  5FUX A;  3D00 A;  3B4V C;  1LR9 A;  1WKX A;  2N17 A;  3BJI A;  1ULN A;  2GKV A;  3R5D A;  1W3S A;  3R5C A;  2OVO A;  1Y8F A;  4E1R A;  2RIJ A;  2JYY A;  4JCV E;  2OD1 A;  4A24 A;  2QQ0 A;  1KBF A;  3SEK C;  3UEJ A;  1Q9B A;  1FY7 A;  1R79 A;  9WGA A;  1PJU A;  1Y1B A;  2QPO A;  3OXG A;  3SGB I;  4OVO A;  1CSO I;  2NU4 I;  1YTP A;  2BUS A;  1SGD I;  1M8B A;  1V1I A;  3UEY A;  3TOB A;  5CCM A;  2JA1 A;  2DB6 A;  3UOE A;  1PPF I;  3TJQ A;  5CCL A;  3FC3 A;  1P9G A;  1TBO A;  2WVJ A;  2OU2 A;  2KCX A;  2ODD A;  2N52 A;  3MEK A;  5FUV A;  3TO7 A;  1UUC A;  2N71 A;  2NU0 I;  2ROW A;  1TUR A;  2N1A B;  2UZ3 A;  1YU6 C;  1IW4 A;  2QQC A;  1SGE I;  1SGY I;  2Y0M A;  3R5B A;  1X4S A;  1K7V A;  4UXJ A;  3VE5 A;  2JZM A;  2KMO A;  1FAQ A;  1FAR A;  5E3Q A;  2E73 A;  2WCY A;  3E59 A;  3KY9 A;  3OXL A;  4AML A;  1ULM A;  1OMT A;  2L8E A;  1HEV A;  2GKT I;  1CHO I;  4B6D A;  2ORV A;  2JXD A;  3FSY A;  1CT4 I;  2NU3 I;  3R5A A;  1CT2 I;  2GVI A;  2J87 A;  4WP4 A;  1MJB A;  2ORW A;  1KBE A;  2NU2 I;  1CT0 I;  3GOX A;  2DKV A;  1DS3 I;  2M5X A;  2KMR A;  1TBR R;  2V53 A;  2VRW B;  3TO9 A;  5JHW C;  2J9R A;  4HGU A;  3QTL D;  1CGI I;  1XX6 A;  2CWH A;  2X3T A;  3VDP A;  3SGQ I;  2LB7 A;  2ARP F;  2QQD A;  1SGR I;  1TOT A;  1TBN A;  2ERW A;  2PQ8 A;  1LR8 A;  3CXL A;  1PCE A;  2B0U C;  3E2I A;  5E3P A;  3UFF A;  1BUS A;  1TUS A;  1UHA A;  1K7T A;  2L7X A;  1HDL A;  2XRC A;  1IY5 A;  3UGI A;  1TIH A;  1PTR A;  2V1C C;  3QWP A;  1OVO A;  1M8C A;  1WGC A;  3HH2 C;  2GIV A;  1ULK A;  1SGP I;  1TGS I;  2ELI A;  1SGQ I;  2OZU A;  2SGP I;  2W0T A;  1KMA A;  1SGN I;  3UGD A;  3VDU A;  1H0Z A;  1R0R I;  1K7U A;  2X52 A;  3TOA A;  5E3R A;  5EX3 A;  2FNF X;  5FUW A;  2CWG A;  1OMU A;  1TBQ R;  4GI3 C;  2ENN A;  3OL0 A;  2GKR I;  1NUB A;  1MJA A;  2JW6 A;  2SGE I;  4MPI A;  4UXH A;  1W4R A;  1V1H A;  1VDD A;  2YQP A;  1UVF A;  3FSX A;  3TO6 A;  2A20 A;  5J8F A;  1MT1 A;  1HPT A;  2RC4 A;  2YUU A;  3OVO A;  1X74 A;  2SGQ I;  4FKD A;  2CWF A;  3QAH A;  7WGA A;  2E5R A;  4DNC A;  2F3C I;  4E1P A;  1BMO A;  2WGC A;  2ENZ A;  2V1C A;  3PDN A;  4L9M A;  4UXI A;  1RFH A;  2LUY A;  2CJS C;  2SGF I;  1Z7K B;  1S20 A;  1WTJ A;  2B8T A;  2SGD I;  1MJ9 A;  1N13 A;  5DAE A;  2QQE A;  1DS2 I;  3RU0 A;  2UVO A;  1PTQ A;  2K9H A;  2KMQ A;  5FUY A;  3UGL A;  1P9Z A;  1WGT A;  1U5K A;  1Z2I A;  5HI7 A; 
#chains in the Genus database with same CATH homology
 2KMP A;  1IY6 A;  5EX0 A;  2DIP A;  1CE3 A;  2P6A C;  1HJA I;  1XBT A;  2LEO A;  1OYV I;  1CGJ I;  1FYB A;  5HQ8 A;  1UVG A;  2NU1 I;  1XA6 A;  4SGB I;  3OXF A;  1AN1 I;  1LR7 A;  1Y1C A;  5FUX A;  3D00 A;  3B4V C;  1LR9 A;  2N17 A;  3BJI A;  2GKV A;  1W3S A;  2OVO A;  1Y8F A;  4E1R A;  2JYY A;  4JCV E;  2OD1 A;  4A24 A;  2QQ0 A;  1KBF A;  3SEK C;  3UEJ A;  1R79 A;  1PJU A;  1Y1B A;  2QPO A;  3OXG A;  3SGB I;  4OVO A;  1CSO I;  2NU4 I;  1YTP A;  2BUS A;  1SGD I;  1M8B A;  1V1I A;  3UEY A;  5CCM A;  2JA1 A;  2DB6 A;  5CCL A;  1PPF I;  3TJQ A;  3FC3 A;  1TBO A;  2WVJ A;  3MEK A;  2KCX A;  2ODD A;  2N52 A;  5FUV A;  1UUC A;  2N71 A;  2NU0 I;  2ROW A;  1TUR A;  2N1A B;  2UZ3 A;  1YU6 C;  1IW4 A;  2QQC A;  1SGE I;  1SGY I;  1X4S A;  4UXJ A;  3VE5 A;  2JZM A;  2KMO A;  1FAQ A;  1FAR A;  2E73 A;  2WCY A;  3E59 A;  3KY9 A;  3OXL A;  1OMT A;  2L8E A;  2GKT I;  1CHO I;  4B6D A;  2ORV A;  2JXD A;  1CT4 I;  2NU3 I;  1CT2 I;  2GVI A;  2J87 A;  2ORW A;  1KBE A;  2NU2 I;  1CT0 I;  3GOX A;  1DS3 I;  2M5X A;  2KMR A;  1TBR R;  2V53 A;  2VRW B;  5JHW C;  2J9R A;  4HGU A;  3QTL D;  1CGI I;  1XX6 A;  3VDP A;  3SGQ I;  2QQD A;  2ARP F;  1SGR I;  1TOT A;  1TBN A;  2ERW A;  1LR8 A;  3CXL A;  1PCE A;  2B0U C;  3E2I A;  3UFF A;  1BUS A;  1TUS A;  2L7X A;  1HDL A;  2XRC A;  1IY5 A;  3UGI A;  1TIH A;  2V1C C;  3QWP A;  1OVO A;  1M8C A;  3HH2 C;  2SGP I;  1SGP I;  1TGS I;  2ELI A;  1SGQ I;  2W0T A;  1KMA A;  1SGN I;  3UGD A;  3VDU A;  1H0Z A;  1R0R I;  5FUW A;  5EX3 A;  2FNF X;  1OMU A;  1TBQ R;  4GI3 C;  2ENN A;  3OL0 A;  2GKR I;  1NUB A;  2JW6 A;  2SGE I;  4UXH A;  1W4R A;  1V1H A;  1VDD A;  2YQP A;  1UVF A;  2A20 A;  1MT1 A;  1HPT A;  2YUU A;  3OVO A;  1X74 A;  2SGQ I;  4FKD A;  2E5R A;  2F3C I;  4E1P A;  1BMO A;  2ENZ A;  2V1C A;  3PDN A;  4L9M A;  4UXI A;  1RFH A;  2LUY A;  2CJS C;  2SGF I;  1Z7K B;  2B8T A;  2SGD I;  1N13 A;  5DAE A;  2QQE A;  1DS2 I;  3RU0 A;  1PTQ A;  2K9H A;  2KMQ A;  5FUY A;  3UGL A;  1PTR A;  1U5K A;  5HI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...