1MT1A

The crystal structure of pyruvoyl-dependent arginine decarboxylase from methanococcus jannaschii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
PLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVNLIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRUVOYL-DEPENDENT ARGININE DECARBOXYLASE BETA CHAIN
publication title Pyruvoyl-Dependent Arginine Decarboxylase from Methanococcus jannaschii: Crystal Structures of the Self-Cleaved and S53A Proenzyme Forms
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
total genus 6
structure length 46
sequence length 46
chains with identical sequence C, E, G, I, K
ec nomenclature ec 4.1.1.19: Arginine decarboxylase.
pdb deposition date 2002-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1mt1A00
1Y1BA 2KMOA 1UUCA 3SEKC 4HGUA 2GKRI 2P6AC 2KCXA 3TJQA 2NU4I 2NU2I 5JHWC 2JZMA 1FYBA 1SGYI 2BUSA 2V53A 2KMPA 1CSOI 1OVOA 2JYYA 2KMQA 2QQCA 2ERWA 3QTLD 1BMOA 1SGEI 4SGBI 1UVFA 1LR8A 1H0ZA 1N13A 2NU1I 1Z7KB 2OVOA 2F3CI 1SGNI 1OYVI 2JXDA 1CT0I 1NUBA 1SGQI 2SGEI 1PJUA 3SGBI 1KMAA 1LR9A 3HH2C 1DS3I 1YU6C 2N52A 2GKVA 2NU3I 1TBQR 1SGPI 2SGQI 1PCEA 3B4VC 1HDLA 1BUSA 1CHOI 2SGPI 2M5XA 1PPFI 1OMUA 2KMRA 1R0RI 2B0UC 1M8CA 1MT1A 2ARPF 1CT4I 4OVOA 1UVGA 1Y1CA 2NU0I 1TURA 2LEOA 1IW4A 2N71A 1HJAI 4GI3C 2QQDA 2GKTI 2N17A 3OVOA 1SGDI 2SGFI 1CT2I 1HPTA 1AN1I 1DS2I 1CGJI 1TBRR 2WCYA 1M8BA 1TGSI 1LR7A 1TUSA 1CGII 1OMTA 3SGQI 5DAEA 1IY5A 1TIHA 1CE3A 1SGRI 1YTPA 2XRCA 2SGDI 1IY6A
chains in the Genus database with same CATH superfamily
1ULNA 1Q9BA 3E59A 2ROWA 2WGCA 1KBFA 1K7VA 1Y1BA 5FUVA 3UOEA 1FARA 2JW6A 2KMOA 1R79A 1TBNA 1MJ9A 2ENNA 2L7XA 3QWPA 1UUCA 2N1AB 4HGUA 3SEKC 2GKRI 1W3SA 2J87A 4WP4A 2P6AC 3TO9A 2KCXA 3UEYA 5E3RA 2CWGA 3TJQA 2ORVA 2GIVA 1FY7A 2NU4I 3KY9A 4UXHA 2UVOA 3R5AA 2NU2I 3FC3A 5JHWC 2JZMA 1X74A 2RC4A 2W0TA 2B8TA 3UGDA 2PQ8A 1FYBA 1SGYI 2BUSA 2V53A 1Z2IA 2ELIA 2KMPA 3UGIA 2CWFA 1CSOI 2OZUA 1OVOA 2JYYA 4AMLA 1WGCA 2KMQA 2ODDA 2ORWA 2ERWA 2QQCA 4L9MA 1K7TA 3QTLD 1V1HA 1BMOA 3UFFA 1K7UA 1PTQA 3RU0A 1SGEI 4UXJA 4SGBI 2V1CA 1TOTA 5E3QA 2FNFX 2E5RA 1UVFA 2DIPA 4E1RA 2QQ0A 4E1PA 4UXIA 3TOBA 1LR8A 1H0ZA 3R5DA 3OXFA 1N13A 2X3TA 1VDDA 2NU1I 3OL0A 2A20A 1UHAA 2X52A 9WGAA 1FAQA 1Z7KB 1WKXA 2OVOA 2F3CI 1SGNI 2E73A 7WGAA 1OYVI 2YQPA 3PDNA 3R5CA 2JXDA 1CT0I 2V1CC 1NUBA 1SGQI 1X4SA 2SGEI 3VDUA 2DKVA 2LUYA 3SGBI 1KMAA 1LR9A 2K9HA 2DB6A 2UZ3A 3HH2C 2CJSC 1DS3I 1YU6C 5HQ8A 2N52A 2GVIA 2GKVA 2JA1A 2NU3I 3CXLA 3UGLA 3OXGA 1TBQR 1SGPI 1XBTA 2SGQI 5J8FA 1XX6A 1MJAA 1PCEA 5J8CA 3B4VC 1HDLA 3QAHA 1BUSA 1CHOI 2SGPI 1PTRA 3R5BA 5HI7A 2L8EA 5FUYA 3TOAA 2M5XA 1PPFI 3E2IA 1WGTA 3GOXA 1OMUA 1P9ZA 1RFHA 4A24A 5CCLA 1MJBA 1W4RA 1NXUA 1U5KA 2KMRA 1R0RI 2B0UC 2RIJA 3MEKA 4DNCA 1M8CA 1MT1A 2ENZA 5FUXA 2ARPF 1CT4I 2J9RA 4OVOA 1UVGA 1WTJA 1Y1CA 2NU0I 3TO6A 5EX3A 1TURA 2LEOA 5E3PA 3TO7A 1IW4A 2N71A 1HJAI 3OXLA 2QQEA 2LB7A 4GI3C 1Y8FA 1P9GA 2GKTI 2QQDA 1HEVA 2N17A 1V1IA 1ULMA 3OVOA 1SGDI 1TBOA 2SGFI 3D00A 4B6DA 1CT2I 1HPTA 1AN1I 3BJIA 4JCVE 1DS2I 2OU2A 1ULKA 1CGJI 1XA6A 2CWHA 5FUWA 5CCMA 1TBRR 1YTPA 2VRWB 2WCYA 1M8BA 3UEJA 1TGSI 1LR7A 1TUSA 2QPOA 1S20A 3FSXA 3FSYA 4MPIA 5EX0A 1CGII 3VE5A 1KBEA 1OMTA 2OD1A 2WVJA 3SGQI 2Y0MA 5DAEA 4FKDA 3VDPA 1IY5A 1TIHA 1CE3A 1SGRI 1PJUA 2XRCA 2YUUA 2SGDI 1IY6A
chains in the Genus database with same CATH topology
3E59A 2ROWA 1KBFA 1Y1BA 5FUVA 1FARA 2JW6A 2KMOA 1R79A 1TBNA 2ENNA 2L7XA 3QWPA 1UUCA 2N1AB 4HGUA 3SEKC 2GKRI 1W3SA 2J87A 2P6AC 2KCXA 3UEYA 3TJQA 2ORVA 3KY9A 2NU4I 4UXHA 2NU2I 5JHWC 2JZMA 1X74A 2W0TA 2B8TA 3UGDA 1FYBA 1SGYI 2BUSA 2V53A 2ELIA 2KMPA 3UGIA 1CSOI 1OVOA 2JYYA 3FC3A 2ODDA 2KMQA 2ORWA 2QQCA 2ERWA 4L9MA 3QTLD 1V1HA 1BMOA 3UFFA 1PTQA 3RU0A 1SGEI 4UXJA 4SGBI 2V1CA 1TOTA 2FNFX 2E5RA 1UVFA 2DIPA 4E1RA 2QQ0A 4E1PA 4UXIA 1LR8A 1H0ZA 3OXFA 1N13A 1VDDA 2NU1I 3OL0A 2A20A 1FAQA 1Z7KB 2OVOA 2F3CI 1SGNI 2E73A 1OYVI 2YQPA 3PDNA 2JXDA 1CT0I 2V1CC 1NUBA 1SGQI 1X4SA 2SGEI 3VDUA 1PJUA 2LUYA 3SGBI 1KMAA 1LR9A 2K9HA 2DB6A 2UZ3A 3HH2C 2CJSC 1DS3I 1YU6C 5HQ8A 2N52A 2GVIA 2GKVA 2JA1A 2NU3I 3CXLA 3UGLA 3OXGA 1TBQR 1SGPI 1XBTA 2SGQI 1XX6A 1PCEA 3B4VC 1HDLA 1BUSA 1CHOI 2SGPI 1PTRA 5HI7A 2L8EA 5FUYA 2M5XA 1PPFI 3E2IA 3GOXA 1OMUA 1RFHA 4A24A 5CCLA 1W4RA 1U5KA 2KMRA 1R0RI 2B0UC 3MEKA 1M8CA 1MT1A 2ENZA 5FUXA 2ARPF 1CT4I 2J9RA 4OVOA 1UVGA 1Y1CA 2NU0I 5EX3A 1TURA 2LEOA 1IW4A 2N71A 1HJAI 3OXLA 2QQEA 4GI3C 1Y8FA 2GKTI 2QQDA 2N17A 1V1IA 3OVOA 1SGDI 1TBOA 2SGFI 3D00A 4B6DA 1CT2I 1HPTA 1AN1I 3BJIA 4JCVE 1DS2I 5FUWA 5CCMA 1CGJI 1XA6A 1TBRR 2VRWB 2WCYA 1M8BA 3UEJA 1TGSI 1LR7A 1TUSA 2QPOA 5EX0A 1CGII 3VE5A 1KBEA 1OMTA 2OD1A 2WVJA 3SGQI 5DAEA 3VDPA 4FKDA 1IY5A 1TIHA 1CE3A 1SGRI 1YTPA 2XRCA 2YUUA 2SGDI 1IY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1B A;  2KMO A;  1UUC A;  3SEK C;  4HGU A;  2GKR I;  2P6A C;  2KCX A;  3TJQ A;  2NU4 I;  2NU2 I;  5JHW C;  2JZM A;  1FYB A;  1SGY I;  2BUS A;  2V53 A;  2KMP A;  1CSO I;  1OVO A;  2JYY A;  2KMQ A;  2QQC A;  2ERW A;  3QTL D;  1BMO A;  1SGE I;  4SGB I;  1UVF A;  1LR8 A;  1H0Z A;  1N13 A;  2NU1 I;  1Z7K B;  2OVO A;  2F3C I;  1SGN I;  1OYV I;  2JXD A;  1CT0 I;  1NUB A;  1SGQ I;  2SGE I;  1PJU A;  3SGB I;  1KMA A;  1LR9 A;  3HH2 C;  1DS3 I;  1YU6 C;  2N52 A;  2GKV A;  2NU3 I;  1TBQ R;  1SGP I;  2SGQ I;  1PCE A;  3B4V C;  1HDL A;  1BUS A;  1CHO I;  2SGP I;  2M5X A;  1PPF I;  1OMU A;  2KMR A;  1R0R I;  2B0U C;  1M8C A;  1MT1 A;  2ARP F;  1CT4 I;  4OVO A;  1UVG A;  1Y1C A;  2NU0 I;  1TUR A;  2LEO A;  1IW4 A;  2N71 A;  1HJA I;  4GI3 C;  2QQD A;  2GKT I;  2N17 A;  3OVO A;  1SGD I;  2SGF I;  1CT2 I;  1HPT A;  1AN1 I;  1DS2 I;  1CGJ I;  1TBR R;  2WCY A;  1M8B A;  1TGS I;  1LR7 A;  1TUS A;  1CGI I;  1OMT A;  3SGQ I;  5DAE A;  1IY5 A;  1TIH A;  1CE3 A;  1SGR I;  1YTP A;  2XRC A;  2SGD I;  1IY6 A; 
#chains in the Genus database with same CATH topology
 1ULN A;  1Q9B A;  3E59 A;  2ROW A;  2WGC A;  1KBF A;  1K7V A;  1Y1B A;  5FUV A;  3UOE A;  1FAR A;  2JW6 A;  2KMO A;  1R79 A;  1TBN A;  1MJ9 A;  2ENN A;  2L7X A;  3QWP A;  1UUC A;  2N1A B;  4HGU A;  3SEK C;  2GKR I;  1W3S A;  2J87 A;  4WP4 A;  2P6A C;  3TO9 A;  2KCX A;  3UEY A;  5E3R A;  2CWG A;  3TJQ A;  2ORV A;  2GIV A;  1FY7 A;  2NU4 I;  3KY9 A;  4UXH A;  2UVO A;  3R5A A;  2NU2 I;  3FC3 A;  5JHW C;  2JZM A;  1X74 A;  2RC4 A;  2W0T A;  2B8T A;  3UGD A;  2PQ8 A;  1FYB A;  1SGY I;  2BUS A;  2V53 A;  1Z2I A;  2ELI A;  2KMP A;  3UGI A;  2CWF A;  1CSO I;  2OZU A;  1OVO A;  2JYY A;  4AML A;  1WGC A;  2KMQ A;  2ODD A;  2ORW A;  2ERW A;  2QQC A;  4L9M A;  1K7T A;  3QTL D;  1V1H A;  1BMO A;  3UFF A;  1K7U A;  1PTQ A;  3RU0 A;  1SGE I;  4UXJ A;  4SGB I;  2V1C A;  1TOT A;  5E3Q A;  2FNF X;  2E5R A;  1UVF A;  2DIP A;  4E1R A;  2QQ0 A;  4E1P A;  4UXI A;  3TOB A;  1LR8 A;  1H0Z A;  3R5D A;  3OXF A;  1N13 A;  2X3T A;  1VDD A;  2NU1 I;  3OL0 A;  2A20 A;  1UHA A;  2X52 A;  9WGA A;  1FAQ A;  1Z7K B;  1WKX A;  2OVO A;  2F3C I;  1SGN I;  2E73 A;  7WGA A;  1OYV I;  2YQP A;  3PDN A;  3R5C A;  2JXD A;  1CT0 I;  2V1C C;  1NUB A;  1SGQ I;  1X4S A;  2SGE I;  3VDU A;  2DKV A;  2LUY A;  3SGB I;  1KMA A;  1LR9 A;  2K9H A;  2DB6 A;  2UZ3 A;  3HH2 C;  2CJS C;  1DS3 I;  1YU6 C;  5HQ8 A;  2N52 A;  2GVI A;  2GKV A;  2JA1 A;  2NU3 I;  3CXL A;  3UGL A;  3OXG A;  1TBQ R;  1SGP I;  1XBT A;  2SGQ I;  5J8F A;  1XX6 A;  1MJA A;  1PCE A;  5J8C A;  3B4V C;  1HDL A;  3QAH A;  1BUS A;  1CHO I;  2SGP I;  1PTR A;  3R5B A;  5HI7 A;  2L8E A;  5FUY A;  3TOA A;  2M5X A;  1PPF I;  3E2I A;  1WGT A;  3GOX A;  1OMU A;  1P9Z A;  1RFH A;  4A24 A;  5CCL A;  1MJB A;  1W4R A;  1NXU A;  1U5K A;  2KMR A;  1R0R I;  2B0U C;  2RIJ A;  3MEK A;  4DNC A;  1M8C A;  1MT1 A;  2ENZ A;  5FUX A;  2ARP F;  1CT4 I;  2J9R A;  4OVO A;  1UVG A;  1WTJ A;  1Y1C A;  2NU0 I;  3TO6 A;  5EX3 A;  1TUR A;  2LEO A;  5E3P A;  3TO7 A;  1IW4 A;  2N71 A;  1HJA I;  3OXL A;  2QQE A;  2LB7 A;  4GI3 C;  1Y8F A;  1P9G A;  2GKT I;  2QQD A;  1HEV A;  2N17 A;  1V1I A;  1ULM A;  3OVO A;  1SGD I;  1TBO A;  2SGF I;  3D00 A;  4B6D A;  1CT2 I;  1HPT A;  1AN1 I;  3BJI A;  4JCV E;  1DS2 I;  2OU2 A;  1ULK A;  1CGJ I;  1XA6 A;  2CWH A;  5FUW A;  5CCM A;  1TBR R;  1YTP A;  2VRW B;  2WCY A;  1M8B A;  3UEJ A;  1TGS I;  1LR7 A;  1TUS A;  2QPO A;  1S20 A;  3FSX A;  3FSY A;  4MPI A;  5EX0 A;  1CGI I;  3VE5 A;  1KBE A;  1OMT A;  2OD1 A;  2WVJ A;  3SGQ I;  2Y0M A;  5DAE A;  4FKD A;  3VDP A;  1IY5 A;  1TIH A;  1CE3 A;  1SGR I;  1PJU A;  2XRC A;  2YUU A;  2SGD I;  1IY6 A; 
#chains in the Genus database with same CATH homology
 3E59 A;  2ROW A;  1KBF A;  1Y1B A;  5FUV A;  1FAR A;  2JW6 A;  2KMO A;  1R79 A;  1TBN A;  2ENN A;  2L7X A;  3QWP A;  1UUC A;  2N1A B;  4HGU A;  3SEK C;  2GKR I;  1W3S A;  2J87 A;  2P6A C;  2KCX A;  3UEY A;  3TJQ A;  2ORV A;  3KY9 A;  2NU4 I;  4UXH A;  2NU2 I;  5JHW C;  2JZM A;  1X74 A;  2W0T A;  2B8T A;  3UGD A;  1FYB A;  1SGY I;  2BUS A;  2V53 A;  2ELI A;  2KMP A;  3UGI A;  1CSO I;  1OVO A;  2JYY A;  3FC3 A;  2ODD A;  2KMQ A;  2ORW A;  2QQC A;  2ERW A;  4L9M A;  3QTL D;  1V1H A;  1BMO A;  3UFF A;  1PTQ A;  3RU0 A;  1SGE I;  4UXJ A;  4SGB I;  2V1C A;  1TOT A;  2FNF X;  2E5R A;  1UVF A;  2DIP A;  4E1R A;  2QQ0 A;  4E1P A;  4UXI A;  1LR8 A;  1H0Z A;  3OXF A;  1N13 A;  1VDD A;  2NU1 I;  3OL0 A;  2A20 A;  1FAQ A;  1Z7K B;  2OVO A;  2F3C I;  1SGN I;  2E73 A;  1OYV I;  2YQP A;  3PDN A;  2JXD A;  1CT0 I;  2V1C C;  1NUB A;  1SGQ I;  1X4S A;  2SGE I;  3VDU A;  1PJU A;  2LUY A;  3SGB I;  1KMA A;  1LR9 A;  2K9H A;  2DB6 A;  2UZ3 A;  3HH2 C;  2CJS C;  1DS3 I;  1YU6 C;  5HQ8 A;  2N52 A;  2GVI A;  2GKV A;  2JA1 A;  2NU3 I;  3CXL A;  3UGL A;  3OXG A;  1TBQ R;  1SGP I;  1XBT A;  2SGQ I;  1XX6 A;  1PCE A;  3B4V C;  1HDL A;  1BUS A;  1CHO I;  2SGP I;  1PTR A;  5HI7 A;  2L8E A;  5FUY A;  2M5X A;  1PPF I;  3E2I A;  3GOX A;  1OMU A;  1RFH A;  4A24 A;  5CCL A;  1W4R A;  1U5K A;  2KMR A;  1R0R I;  2B0U C;  3MEK A;  1M8C A;  1MT1 A;  2ENZ A;  5FUX A;  2ARP F;  1CT4 I;  2J9R A;  4OVO A;  1UVG A;  1Y1C A;  2NU0 I;  5EX3 A;  1TUR A;  2LEO A;  1IW4 A;  2N71 A;  1HJA I;  3OXL A;  2QQE A;  4GI3 C;  1Y8F A;  2GKT I;  2QQD A;  2N17 A;  1V1I A;  3OVO A;  1SGD I;  1TBO A;  2SGF I;  3D00 A;  4B6D A;  1CT2 I;  1HPT A;  1AN1 I;  3BJI A;  4JCV E;  1DS2 I;  5FUW A;  5CCM A;  1CGJ I;  1XA6 A;  1TBR R;  2VRW B;  2WCY A;  1M8B A;  3UEJ A;  1TGS I;  1LR7 A;  1TUS A;  2QPO A;  5EX0 A;  1CGI I;  3VE5 A;  1KBE A;  1OMT A;  2OD1 A;  2WVJ A;  3SGQ I;  5DAE A;  3VDP A;  4FKD A;  1IY5 A;  1TIH A;  1CE3 A;  1SGR I;  1YTP A;  2XRC A;  2YUU A;  2SGD I;  1IY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...