1UHAA

Crystal structure of pokeweed lectin-d2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
APECGERASGKRCPNGKCCSQWGYCGTTDNYCGQGCQSQCDYWRCGRDFGGRLCEEDMCCSKYGWCGYSDDHCEDGCQSQCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin-D2
publication title Structures of two lectins from the roots of pokeweed (Phytolacca americana).
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 26
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1uhaA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1uhaA01
4WP4A 1K7TA 1ULNA 2X52A 4MPIA 2UVOA 1WGTA 9WGAA 1K7UA 1P9GA 2X3TA 1P9ZA 1Q9BA 2LB7A 1ULMA 4AMLA 1UHAA 2WGCA 2CWGA 1ULKA 1HEVA 1K7VA 1WKXA 1WGCA 2DKVA 7WGAA
chains in the Genus database with same CATH superfamily
4A24A 1TUSA 2GKVA 1X74A 2GKRI 4WP4A 2W0TA 1CGJI 1S20A 3E59A 5FUWA 3SGBI 1RFHA 4MPIA 2LUYA 1Y1BA 2N17A 5EX3A 4UXIA 1SGRI 5DAEA 1LR7A 3UGLA 2UVOA 1OVOA 2QQCA 3E2IA 2WCYA 3HH2C 3UEYA 2V1CA 3GOXA 1PCEA 2ROWA 1TURA 2JZMA 4OVOA 2X3TA 4E1PA 1OMTA 2NU3I 2OVOA 2CWFA 2XRCA 1HJAI 1TBRR 5EX0A 1OYVI 1ULMA 2VRWB 1PPFI 1MJAA 1YTPA 2KMPA 2SGQI 1M8BA 1PTQA 1Y8FA 2CWGA 2WGCA 3R5BA 2QPOA 1K7VA 1NXUA 1W3SA 5E3RA 3KY9A 1CT2I 1KMAA 1X4SA 1MJ9A 1IY6A 1CT4I 2ELIA 3OL0A 4JCVE 2V1CC 2SGDI 1SGNI 2NU1I 2KMRA 5HQ8A 2CWHA 2QQDA 2F3CI 1XA6A 2L8EA 2N1AB 2M5XA 1DS3I 1V1HA 1HPTA 3UOEA 2E5RA 1TGSI 2GIVA 1YU6C 2OZUA 1SGQI 1UVFA 2V53A 3OXGA 2B8TA 2QQEA 4SGBI 3SGQI 2A20A 2ENNA 1FAQA 3B4VC 3UGDA 3TOAA 2JA1A 2DB6A 1N13A 1ULKA 2GKTI 1CE3A 3FC3A 2DKVA 1WGCA 2ODDA 1LR9A 2Y0MA 2OD1A 5E3PA 2SGFI 7WGAA 2CJSC 2NU2I 1TOTA 1UVGA 1IY5A 1M8CA 1ULNA 3R5CA 3TO7A 1BUSA 2JXDA 2P6AC 4UXJA 1R79A 3QAHA 4UXHA 3VE5A 5CCLA 1WGTA 5JHWC 2K9HA 1FARA 1PTRA 1H0ZA 1TIHA 2ORVA 3BJIA 2JYYA 3VDPA 5FUYA 1P9GA 2NU4I 4L9MA 5FUVA 5J8CA 2BUSA 3UGIA 1AN1I 1BMOA 2N52A 2YUUA 1Q9BA 4E1RA 1SGYI 2ORWA 1Y1CA 1KBFA 1CSOI 4B6DA 3FSXA 1TBQR 2UZ3A 3CXLA 1DS2I 1LR8A 1SGDI 3OVOA 3OXFA 3SEKC 3TO6A 2PQ8A 4HGUA 1CT0I 3TJQA 1HEVA 2KMOA 1U5KA 1WTJA 3FSYA 2ARPF 3QTLD 3OXLA 5J8FA 2J9RA 1K7TA 3QWPA 2X52A 1XX6A 2L7XA 1CGII 2RIJA 4FKDA 1R0RI 1SGPI 1TBNA 3MEKA 9WGAA 5CCMA 1PJUA 2FNFX 2J87A 5FUXA 3RU0A 1FYBA 1CHOI 1UUCA 1K7UA 1HDLA 2B0UC 2KCXA 2RC4A 2NU0I 2YQPA 3TO9A 3UFFA 2KMQA 2LEOA 1W4RA 1Z7KB 2QQ0A 2SGPI 1P9ZA 2ERWA 2WVJA 4GI3C 1MT1A 3VDUA 1Z2IA 3R5AA 2LB7A 2GVIA 1OMUA 2N71A 5E3QA 4AMLA 2E73A 3R5DA 1NUBA 1UHAA 5HI7A 2SGEI 3UEJA 1IW4A 1XBTA 1TBOA 1VDDA 1V1IA 2OU2A 1SGEI 1WKXA 1KBEA 2DIPA 3TOBA 2JW6A 1FY7A 1MJBA 2ENZA 3D00A 4DNCA 3PDNA
chains in the Genus database with same CATH topology
4WP4A 1K7TA 1ULNA 2X52A 4MPIA 2UVOA 1WGTA 9WGAA 1K7UA 1P9GA 2X3TA 1P9ZA 1Q9BA 2LB7A 1ULMA 4AMLA 1UHAA 2WGCA 2CWGA 1ULKA 1HEVA 1K7VA 1WKXA 1WGCA 2DKVA 7WGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WP4 A;  1K7T A;  1ULN A;  2X52 A;  4MPI A;  2UVO A;  1WGT A;  9WGA A;  1K7U A;  1P9G A;  2X3T A;  1P9Z A;  1Q9B A;  2LB7 A;  1ULM A;  4AML A;  1UHA A;  2WGC A;  2CWG A;  1ULK A;  1HEV A;  1K7V A;  1WKX A;  1WGC A;  2DKV A;  7WGA A; 
#chains in the Genus database with same CATH topology
 4A24 A;  1TUS A;  2GKV A;  1X74 A;  2GKR I;  4WP4 A;  2W0T A;  1CGJ I;  1S20 A;  3E59 A;  5FUW A;  3SGB I;  1RFH A;  4MPI A;  2LUY A;  1Y1B A;  2N17 A;  5EX3 A;  4UXI A;  1SGR I;  5DAE A;  1LR7 A;  3UGL A;  2UVO A;  1OVO A;  2QQC A;  3E2I A;  2WCY A;  3HH2 C;  3UEY A;  2V1C A;  3GOX A;  1PCE A;  2ROW A;  1TUR A;  2JZM A;  4OVO A;  2X3T A;  4E1P A;  1OMT A;  2NU3 I;  2OVO A;  2CWF A;  2XRC A;  1HJA I;  1TBR R;  5EX0 A;  1OYV I;  1ULM A;  2VRW B;  1PPF I;  1MJA A;  1YTP A;  2KMP A;  2SGQ I;  1M8B A;  1PTQ A;  1Y8F A;  2CWG A;  2WGC A;  3R5B A;  2QPO A;  1K7V A;  1NXU A;  1W3S A;  5E3R A;  3KY9 A;  1CT2 I;  1KMA A;  1X4S A;  1MJ9 A;  1IY6 A;  1CT4 I;  2ELI A;  3OL0 A;  4JCV E;  2V1C C;  2SGD I;  1SGN I;  2NU1 I;  2KMR A;  5HQ8 A;  2CWH A;  2QQD A;  2F3C I;  1XA6 A;  2L8E A;  2N1A B;  2M5X A;  1DS3 I;  1V1H A;  1HPT A;  3UOE A;  2E5R A;  1TGS I;  2GIV A;  1YU6 C;  2OZU A;  1SGQ I;  1UVF A;  2V53 A;  3OXG A;  2B8T A;  2QQE A;  4SGB I;  3SGQ I;  2A20 A;  2ENN A;  1FAQ A;  3B4V C;  3UGD A;  3TOA A;  2JA1 A;  2DB6 A;  1N13 A;  1ULK A;  2GKT I;  1CE3 A;  3FC3 A;  2DKV A;  1WGC A;  2ODD A;  1LR9 A;  2Y0M A;  2OD1 A;  5E3P A;  2SGF I;  7WGA A;  2CJS C;  2NU2 I;  1TOT A;  1UVG A;  1IY5 A;  1M8C A;  1ULN A;  3R5C A;  3TO7 A;  1BUS A;  2JXD A;  2P6A C;  4UXJ A;  1R79 A;  3QAH A;  4UXH A;  3VE5 A;  5CCL A;  1WGT A;  5JHW C;  2K9H A;  1FAR A;  1PTR A;  1H0Z A;  1TIH A;  2ORV A;  3BJI A;  2JYY A;  3VDP A;  5FUY A;  1P9G A;  2NU4 I;  4L9M A;  5FUV A;  5J8C A;  2BUS A;  3UGI A;  1AN1 I;  1BMO A;  2N52 A;  2YUU A;  1Q9B A;  4E1R A;  1SGY I;  2ORW A;  1Y1C A;  1KBF A;  1CSO I;  4B6D A;  3FSX A;  1TBQ R;  2UZ3 A;  3CXL A;  1DS2 I;  1LR8 A;  1SGD I;  3OVO A;  3OXF A;  3SEK C;  3TO6 A;  2PQ8 A;  4HGU A;  1CT0 I;  3TJQ A;  1HEV A;  2KMO A;  1U5K A;  1WTJ A;  3FSY A;  2ARP F;  3QTL D;  3OXL A;  5J8F A;  2J9R A;  1K7T A;  3QWP A;  2X52 A;  1XX6 A;  2L7X A;  1CGI I;  2RIJ A;  4FKD A;  1R0R I;  1SGP I;  1TBN A;  3MEK A;  9WGA A;  5CCM A;  1PJU A;  2FNF X;  2J87 A;  5FUX A;  3RU0 A;  1FYB A;  1CHO I;  1UUC A;  1K7U A;  1HDL A;  2B0U C;  2KCX A;  2RC4 A;  2NU0 I;  2YQP A;  3TO9 A;  3UFF A;  2KMQ A;  2LEO A;  1W4R A;  1Z7K B;  2QQ0 A;  2SGP I;  1P9Z A;  2ERW A;  2WVJ A;  4GI3 C;  1MT1 A;  3VDU A;  1Z2I A;  3R5A A;  2LB7 A;  2GVI A;  1OMU A;  2N71 A;  5E3Q A;  4AML A;  2E73 A;  3R5D A;  1NUB A;  1UHA A;  5HI7 A;  2SGE I;  3UEJ A;  1IW4 A;  1XBT A;  1TBO A;  1VDD A;  1V1I A;  2OU2 A;  1SGE I;  1WKX A;  1KBE A;  2DIP A;  3TOB A;  2JW6 A;  1FY7 A;  1MJB A;  2ENZ A;  3D00 A;  4DNC A;  3PDN A; 
#chains in the Genus database with same CATH homology
 4WP4 A;  1K7T A;  1ULN A;  2X52 A;  4MPI A;  2UVO A;  1WGT A;  9WGA A;  1K7U A;  1P9G A;  2X3T A;  1P9Z A;  1Q9B A;  2LB7 A;  1ULM A;  4AML A;  1UHA A;  2WGC A;  2CWG A;  1ULK A;  1HEV A;  1K7V A;  1WKX A;  1WGC A;  2DKV A;  7WGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...