1UHAA

Crystal structure of pokeweed lectin-d2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
APECGERASGKRCPNGKCCSQWGYCGTTDNYCGQGCQSQCDYWRCGRDFGGRLCEEDMCCSKYGWCGYSDDHCEDGCQSQCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords lectin-D2
publication title Structures of two lectins from the roots of pokeweed (Phytolacca americana).
pubmed doi rcsb
total genus 26
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1uhaA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1uhaA01
1UHAA 1K7VA 2LB7A 1HEVA 4MPIA 2UVOA 2X3TA 2WGCA 1P9ZA 2CWGA 1ULMA 1WKXA 1Q9BA 1ULNA 2X52A 4WP4A 1P9GA 1WGCA 1WGTA 9WGAA 4AMLA 7WGAA 1K7UA 2DKVA 1K7TA 1ULKA
chains in the Genus database with same CATH superfamily
1FY7A 3KY9A 1TIHA 1UVFA 2ENZA 2GVIA 2LB7A 5DAEA 5EX0A 1VDDA 1HPTA 1XX6A 1Z7KB 1S20A 1CT2I 1TBRR 1BMOA 1SGEI 2ELIA 5E3PA 2GKRI 2WGCA 3B4VC 3TO7A 2ODDA 2KMQA 1WTJA 3FSYA 1CHOI 2JZMA 1SGNI 4E1RA 2DIPA 2QPOA 1ULNA 3UGDA 2P6AC 2K9HA 2V53A 2RIJA 1M8BA 2ENNA 4UXHA 3FC3A 1CE3A 2E73A 2QQEA 1IW4A 3UEYA 1LR7A 1CT0I 2F3CI 1TOTA 3OL0A 3GOXA 4DNCA 1P9GA 1RFHA 2JXDA 2LEOA 2KMPA 3HH2C 2NU3I 1K7UA 1NXUA 2KCXA 5J8FA 2ERWA 1LR9A 2Y0MA 1PTQA 1IY6A 3CXLA 1X4SA 2A20A 2DB6A 3TO6A 1Y1CA 1K7TA 2L7XA 2JW6A 5EX3A 3SEKC 7WGAA 1UHAA 1HEVA 2SGDI 2UZ3A 1MJAA 3E59A 1W3SA 3TO9A 3VDPA 4SGBI 4OVOA 1TUSA 1KBFA 1TBNA 1ULMA 5FUXA 2W0TA 3UEJA 1UVGA 1WKXA 2KMRA 1Q9BA 2OU2A 2WVJA 2X52A 5CCMA 1HJAI 3QWPA 3R5DA 1NUBA 1AN1I 5E3QA 2N71A 1X74A 4UXJA 3UGLA 2GKTI 1V1IA 1BUSA 1WGTA 2VRWB 3OXLA 4HGUA 3TOBA 1Y1BA 1DS3I 1PTRA 2NU4I 2YQPA 3UOEA 9WGAA 2J87A 2KMOA 2YUUA 2E5RA 1H0ZA 1Z2IA 2RC4A 2FNFX 2WCYA 4GI3C 2V1CC 1MJ9A 1SGRI 2QQDA 1ULKA 1CGII 1DS2I 2N52A 1SGDI 3OXFA 1M8CA 2JA1A 2UVOA 3OXGA 1Y8FA 2NU2I 1FAQA 2ORVA 1P9ZA 4L9MA 2GIVA 2CWGA 4JCVE 1PJUA 1YTPA 2V1CA 3FSXA 2ORWA 2M5XA 3R5BA 5HQ8A 1LR8A 2B0UC 3QAHA 1TGSI 5HI7A 1XA6A 3TJQA 1CSOI 1HDLA 1R79A 1SGQI 1OMTA 1PCEA 1R0RI 2QQ0A 1U5KA 2SGEI 3MEKA 1WGCA 1YU6C 2ROWA 3OVOA 2CJSC 2N17A 1OYVI 5JHWC 2QQCA 1OMUA 1OVOA 3QTLD 1KMAA 1TURA 2N1AB 4B6DA 2NU0I 2OD1A 5CCLA 5FUYA 1FYBA 3TOAA 1W4RA 2L8EA 1K7VA 1N13A 4MPIA 2NU1I 3VE5A 4A24A 2B8TA 2CWFA 2JYYA 5FUVA 1UUCA 1TBOA 2X3TA 1FARA 2OZUA 1SGPI 4FKDA 1MJBA 1PPFI 5FUWA 3RU0A 2SGPI 2XRCA 2SGFI 2SGQI 2OVOA 3SGBI 3R5CA 1IY5A 2BUSA 3PDNA 1CGJI 1V1HA 3D00A 4WP4A 1SGYI 4E1PA 1XBTA 2GKVA 4UXIA 1MT1A 2CWHA 4AMLA 1TBQR 3R5AA 2LUYA 2J9RA 3VDUA 2DKVA 3E2IA 1CT4I 5E3RA 3UGIA 2PQ8A 3UFFA 1KBEA 3SGQI 5J8CA 3BJIA 2ARPF
chains in the Genus database with same CATH topology
1UHAA 1K7VA 2LB7A 1HEVA 4MPIA 2UVOA 2X3TA 2WGCA 1P9ZA 2CWGA 1ULMA 1WKXA 1Q9BA 1ULNA 2X52A 4WP4A 1P9GA 1WGCA 1WGTA 9WGAA 4AMLA 7WGAA 1K7UA 2DKVA 1K7TA 1ULKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHA A;  1K7V A;  2LB7 A;  1HEV A;  4MPI A;  2UVO A;  2X3T A;  2WGC A;  1P9Z A;  2CWG A;  1ULM A;  1WKX A;  1Q9B A;  1ULN A;  2X52 A;  4WP4 A;  1P9G A;  1WGC A;  1WGT A;  9WGA A;  4AML A;  7WGA A;  1K7U A;  2DKV A;  1K7T A;  1ULK A; 
#chains in the Genus database with same CATH topology
 1FY7 A;  3KY9 A;  1TIH A;  1UVF A;  2ENZ A;  2GVI A;  2LB7 A;  5DAE A;  5EX0 A;  1VDD A;  1HPT A;  1XX6 A;  1Z7K B;  1S20 A;  1CT2 I;  1TBR R;  1BMO A;  1SGE I;  2ELI A;  5E3P A;  2GKR I;  2WGC A;  3B4V C;  3TO7 A;  2ODD A;  2KMQ A;  1WTJ A;  3FSY A;  1CHO I;  2JZM A;  1SGN I;  4E1R A;  2DIP A;  2QPO A;  1ULN A;  3UGD A;  2P6A C;  2K9H A;  2V53 A;  2RIJ A;  1M8B A;  2ENN A;  4UXH A;  3FC3 A;  1CE3 A;  2E73 A;  2QQE A;  1IW4 A;  3UEY A;  1LR7 A;  1CT0 I;  2F3C I;  1TOT A;  3OL0 A;  3GOX A;  4DNC A;  1P9G A;  1RFH A;  2JXD A;  2LEO A;  2KMP A;  3HH2 C;  2NU3 I;  1K7U A;  1NXU A;  2KCX A;  5J8F A;  2ERW A;  1LR9 A;  2Y0M A;  1PTQ A;  1IY6 A;  3CXL A;  1X4S A;  2A20 A;  2DB6 A;  3TO6 A;  1Y1C A;  1K7T A;  2L7X A;  2JW6 A;  5EX3 A;  3SEK C;  7WGA A;  1UHA A;  1HEV A;  2SGD I;  2UZ3 A;  1MJA A;  3E59 A;  1W3S A;  3TO9 A;  3VDP A;  4SGB I;  4OVO A;  1TUS A;  1KBF A;  1TBN A;  1ULM A;  5FUX A;  2W0T A;  3UEJ A;  1UVG A;  1WKX A;  2KMR A;  1Q9B A;  2OU2 A;  2WVJ A;  2X52 A;  5CCM A;  1HJA I;  3QWP A;  3R5D A;  1NUB A;  1AN1 I;  5E3Q A;  2N71 A;  1X74 A;  4UXJ A;  3UGL A;  2GKT I;  1V1I A;  1BUS A;  1WGT A;  2VRW B;  3OXL A;  4HGU A;  3TOB A;  1Y1B A;  1DS3 I;  1PTR A;  2NU4 I;  2YQP A;  3UOE A;  9WGA A;  2J87 A;  2KMO A;  2YUU A;  2E5R A;  1H0Z A;  1Z2I A;  2RC4 A;  2FNF X;  2WCY A;  4GI3 C;  2V1C C;  1MJ9 A;  1SGR I;  2QQD A;  1ULK A;  1CGI I;  1DS2 I;  2N52 A;  1SGD I;  3OXF A;  1M8C A;  2JA1 A;  2UVO A;  3OXG A;  1Y8F A;  2NU2 I;  1FAQ A;  2ORV A;  1P9Z A;  4L9M A;  2GIV A;  2CWG A;  4JCV E;  1PJU A;  1YTP A;  2V1C A;  3FSX A;  2ORW A;  2M5X A;  3R5B A;  5HQ8 A;  1LR8 A;  2B0U C;  3QAH A;  1TGS I;  5HI7 A;  1XA6 A;  3TJQ A;  1CSO I;  1HDL A;  1R79 A;  1SGQ I;  1OMT A;  1PCE A;  1R0R I;  2QQ0 A;  1U5K A;  2SGE I;  3MEK A;  1WGC A;  1YU6 C;  2ROW A;  3OVO A;  2CJS C;  2N17 A;  1OYV I;  5JHW C;  2QQC A;  1OMU A;  1OVO A;  3QTL D;  1KMA A;  1TUR A;  2N1A B;  4B6D A;  2NU0 I;  2OD1 A;  5CCL A;  5FUY A;  1FYB A;  3TOA A;  1W4R A;  2L8E A;  1K7V A;  1N13 A;  4MPI A;  2NU1 I;  3VE5 A;  4A24 A;  2B8T A;  2CWF A;  2JYY A;  5FUV A;  1UUC A;  1TBO A;  2X3T A;  1FAR A;  2OZU A;  1SGP I;  4FKD A;  1MJB A;  1PPF I;  5FUW A;  3RU0 A;  2SGP I;  2XRC A;  2SGF I;  2SGQ I;  2OVO A;  3SGB I;  3R5C A;  1IY5 A;  2BUS A;  3PDN A;  1CGJ I;  1V1H A;  3D00 A;  4WP4 A;  1SGY I;  4E1P A;  1XBT A;  2GKV A;  4UXI A;  1MT1 A;  2CWH A;  4AML A;  1TBQ R;  3R5A A;  2LUY A;  2J9R A;  3VDU A;  2DKV A;  3E2I A;  1CT4 I;  5E3R A;  3UGI A;  2PQ8 A;  3UFF A;  1KBE A;  3SGQ I;  5J8C A;  3BJI A;  2ARP F; 
#chains in the Genus database with same CATH homology
 1UHA A;  1K7V A;  2LB7 A;  1HEV A;  4MPI A;  2UVO A;  2X3T A;  2WGC A;  1P9Z A;  2CWG A;  1ULM A;  1WKX A;  1Q9B A;  1ULN A;  2X52 A;  4WP4 A;  1P9G A;  1WGC A;  1WGT A;  9WGA A;  4AML A;  7WGA A;  1K7U A;  2DKV A;  1K7T A;  1ULK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...