1UHAA

Crystal structure of pokeweed lectin-d2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
b'APECGERASGKRCPNGKCCSQWGYCGTTDNYCGQGCQSQCDYWRCGRDFGGRLCEEDMCCSKYGWCGYSDDHCEDGCQSQCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin-D2
publication title Structures of two lectins from the roots of pokeweed (Phytolacca americana).
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 26
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1uhaA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1uhaA01
2DKVA 2WGCA 1ULKA 1Q9BA 2LB7A 2CWGA 2UVOA 1WGCA 1WGTA 2X52A 1ULNA 1K7TA 1P9ZA 1WKXA 9WGAA 1P9GA 2X3TA 1K7VA 4MPIA 1ULMA 1UHAA 4WP4A 4AMLA 7WGAA 1HEVA 1K7UA
chains in the Genus database with same CATH superfamily
1PJUA 3OXFA 2N71A 5EX0A 4GI3C 2B0UC 3SGQI 2ARPF 1TBQR 2W0TA 1ULKA 2P6AC 1R0RI 1KBEA 1NXUA 1TBOA 1YTPA 1Q9BA 2A20A 2E5RA 2LB7A 2JYYA 2QPOA 2ELIA 1YU6C 2L8EA 5FUVA 3TO7A 2CWFA 3D00A 1Y1CA 3E59A 1MJBA 1LR9A 1ULNA 2NU0I 1IY5A 1MT1A 2FNFX 2YUUA 3R5CA 1XBTA 2JA1A 1P9GA 2OD1A 1OMUA 2QQ0A 2ORVA 1K7VA 3SEKC 1IW4A 3FC3A 2Y0MA 2ENNA 2BUSA 3E2IA 3QAHA 1MJAA 3VDPA 1UVGA 3UOEA 2GVIA 4AMLA 1FAQA 3HH2C 2ODDA 1RFHA 1BMOA 1CHOI 1V1IA 2N17A 2QQCA 1TOTA 3PDNA 1N13A 1HJAI 1CGJI 3TJQA 1VDDA 3BJIA 1SGEI 5CCMA 1WGCA 1LR8A 1CT4I 4DNCA 2J87A 1BUSA 1KMAA 5HI7A 1R79A 3GOXA 2JXDA 1U5KA 2KMPA 1TGSI 5FUXA 4OVOA 5E3QA 2X3TA 5FUYA 2OZUA 1DS3I 1TUSA 2VRWB 2UZ3A 1DS2I 3UEYA 3UGDA 2GIVA 1IY6A 2KMRA 1ULMA 2N1AB 4SGBI 2KMOA 4WP4A 2RC4A 2ROWA 1WTJA 2V53A 1UUCA 2CJSC 2N52A 2RIJA 1CT0I 4UXIA 7WGAA 2ERWA 5HQ8A 5J8CA 3OL0A 1W3SA 1LR7A 1TBNA 1XX6A 1PCEA 1Y1BA 2SGEI 1SGYI 1CT2I 2DKVA 3TO9A 3FSXA 2WGCA 4JCVE 1NUBA 2DB6A 5E3PA 3RU0A 1PTQA 3TOAA 1Z2IA 3B4VC 5FUWA 3TOBA 5CCLA 3R5BA 2CWGA 5JHWC 2V1CA 1TIHA 3UEJA 2OVOA 1SGPI 1SGNI 2SGQI 4E1PA 1WGTA 3R5DA 2X52A 3MEKA 3R5AA 2NU1I 2NU4I 2PQ8A 1P9ZA 2WVJA 3TO6A 1WKXA 4B6DA 1KBFA 2OU2A 1MJ9A 1TBRR 2XRCA 1CSOI 3QTLD 2LUYA 1SGQI 2SGDI 1V1HA 4MPIA 3SGBI 5DAEA 4UXJA 1AN1I 3KY9A 2V1CC 1Z7KB 3OVOA 2B8TA 1SGRI 1OMTA 3VDUA 4A24A 1X74A 1HPTA 1PTRA 2F3CI 2ENZA 1HEVA 2LEOA 1M8CA 1SGDI 4E1RA 2JZMA 2KMQA 2GKTI 1XA6A 2CWHA 1HDLA 1UVFA 1OYVI 3QWPA 1W4RA 5J8FA 4HGUA 2KCXA 1FYBA 1FY7A 3CXLA 3VE5A 2UVOA 1S20A 5EX3A 3OXLA 2M5XA 2DIPA 2GKRI 2NU3I 1K7TA 2JW6A 2L7XA 2SGFI 1CE3A 1M8BA 1CGII 3FSYA 9WGAA 3OXGA 3UFFA 2WCYA 1PPFI 5E3RA 1TURA 1FARA 1OVOA 1UHAA 2J9RA 2K9HA 2QQEA 4L9MA 3UGLA 1X4SA 1Y8FA 2E73A 3UGIA 2ORWA 2GKVA 2QQDA 2SGPI 1K7UA 2NU2I 4UXHA 1H0ZA 2YQPA 4FKDA
chains in the Genus database with same CATH topology
2DKVA 2WGCA 1ULKA 1Q9BA 2LB7A 2CWGA 2UVOA 1WGCA 1WGTA 2X52A 1ULNA 1K7TA 1P9ZA 1WKXA 9WGAA 1P9GA 2X3TA 1K7VA 4MPIA 1ULMA 1UHAA 4WP4A 4AMLA 7WGAA 1HEVA 1K7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKV A;  2WGC A;  1ULK A;  1Q9B A;  2LB7 A;  2CWG A;  2UVO A;  1WGC A;  1WGT A;  2X52 A;  1ULN A;  1K7T A;  1P9Z A;  1WKX A;  9WGA A;  1P9G A;  2X3T A;  1K7V A;  4MPI A;  1ULM A;  1UHA A;  4WP4 A;  4AML A;  7WGA A;  1HEV A;  1K7U A; 
#chains in the Genus database with same CATH topology
 1PJU A;  3OXF A;  2N71 A;  5EX0 A;  4GI3 C;  2B0U C;  3SGQ I;  2ARP F;  1TBQ R;  2W0T A;  1ULK A;  2P6A C;  1R0R I;  1KBE A;  1NXU A;  1TBO A;  1YTP A;  1Q9B A;  2A20 A;  2E5R A;  2LB7 A;  2JYY A;  2QPO A;  2ELI A;  1YU6 C;  2L8E A;  5FUV A;  3TO7 A;  2CWF A;  3D00 A;  1Y1C A;  3E59 A;  1MJB A;  1LR9 A;  1ULN A;  2NU0 I;  1IY5 A;  1MT1 A;  2FNF X;  2YUU A;  3R5C A;  1XBT A;  2JA1 A;  1P9G A;  2OD1 A;  1OMU A;  2QQ0 A;  2ORV A;  1K7V A;  3SEK C;  1IW4 A;  3FC3 A;  2Y0M A;  2ENN A;  2BUS A;  3E2I A;  3QAH A;  1MJA A;  3VDP A;  1UVG A;  3UOE A;  2GVI A;  4AML A;  1FAQ A;  3HH2 C;  2ODD A;  1RFH A;  1BMO A;  1CHO I;  1V1I A;  2N17 A;  2QQC A;  1TOT A;  3PDN A;  1N13 A;  1HJA I;  1CGJ I;  3TJQ A;  1VDD A;  3BJI A;  1SGE I;  5CCM A;  1WGC A;  1LR8 A;  1CT4 I;  4DNC A;  2J87 A;  1BUS A;  1KMA A;  5HI7 A;  1R79 A;  3GOX A;  2JXD A;  1U5K A;  2KMP A;  1TGS I;  5FUX A;  4OVO A;  5E3Q A;  2X3T A;  5FUY A;  2OZU A;  1DS3 I;  1TUS A;  2VRW B;  2UZ3 A;  1DS2 I;  3UEY A;  3UGD A;  2GIV A;  1IY6 A;  2KMR A;  1ULM A;  2N1A B;  4SGB I;  2KMO A;  4WP4 A;  2RC4 A;  2ROW A;  1WTJ A;  2V53 A;  1UUC A;  2CJS C;  2N52 A;  2RIJ A;  1CT0 I;  4UXI A;  7WGA A;  2ERW A;  5HQ8 A;  5J8C A;  3OL0 A;  1W3S A;  1LR7 A;  1TBN A;  1XX6 A;  1PCE A;  1Y1B A;  2SGE I;  1SGY I;  1CT2 I;  2DKV A;  3TO9 A;  3FSX A;  2WGC A;  4JCV E;  1NUB A;  2DB6 A;  5E3P A;  3RU0 A;  1PTQ A;  3TOA A;  1Z2I A;  3B4V C;  5FUW A;  3TOB A;  5CCL A;  3R5B A;  2CWG A;  5JHW C;  2V1C A;  1TIH A;  3UEJ A;  2OVO A;  1SGP I;  1SGN I;  2SGQ I;  4E1P A;  1WGT A;  3R5D A;  2X52 A;  3MEK A;  3R5A A;  2NU1 I;  2NU4 I;  2PQ8 A;  1P9Z A;  2WVJ A;  3TO6 A;  1WKX A;  4B6D A;  1KBF A;  2OU2 A;  1MJ9 A;  1TBR R;  2XRC A;  1CSO I;  3QTL D;  2LUY A;  1SGQ I;  2SGD I;  1V1H A;  4MPI A;  3SGB I;  5DAE A;  4UXJ A;  1AN1 I;  3KY9 A;  2V1C C;  1Z7K B;  3OVO A;  2B8T A;  1SGR I;  1OMT A;  3VDU A;  4A24 A;  1X74 A;  1HPT A;  1PTR A;  2F3C I;  2ENZ A;  1HEV A;  2LEO A;  1M8C A;  1SGD I;  4E1R A;  2JZM A;  2KMQ A;  2GKT I;  1XA6 A;  2CWH A;  1HDL A;  1UVF A;  1OYV I;  3QWP A;  1W4R A;  5J8F A;  4HGU A;  2KCX A;  1FYB A;  1FY7 A;  3CXL A;  3VE5 A;  2UVO A;  1S20 A;  5EX3 A;  3OXL A;  2M5X A;  2DIP A;  2GKR I;  2NU3 I;  1K7T A;  2JW6 A;  2L7X A;  2SGF I;  1CE3 A;  1M8B A;  1CGI I;  3FSY A;  9WGA A;  3OXG A;  3UFF A;  2WCY A;  1PPF I;  5E3R A;  1TUR A;  1FAR A;  1OVO A;  1UHA A;  2J9R A;  2K9H A;  2QQE A;  4L9M A;  3UGL A;  1X4S A;  1Y8F A;  2E73 A;  3UGI A;  2ORW A;  2GKV A;  2QQD A;  2SGP I;  1K7U A;  2NU2 I;  4UXH A;  1H0Z A;  2YQP A;  4FKD A; 
#chains in the Genus database with same CATH homology
 2DKV A;  2WGC A;  1ULK A;  1Q9B A;  2LB7 A;  2CWG A;  2UVO A;  1WGC A;  1WGT A;  2X52 A;  1ULN A;  1K7T A;  1P9Z A;  1WKX A;  9WGA A;  1P9G A;  2X3T A;  1K7V A;  4MPI A;  1ULM A;  1UHA A;  4WP4 A;  4AML A;  7WGA A;  1HEV A;  1K7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...