1UVGA

Solution structure of the 15th domain of lekti
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
DSEMCKDYRVLPRIGYLCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRSTGKCEESSTPGTTAASMPPSDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEINASE INHIBITOR KAZAL TYPE 5
publication title The Solution Structure of a Chimeric Lekti Domain Reveals a Chameleon Sequence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine proteinase inhibitor
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1uvgA01
2KMRA 2SGPI 4HGUA 1M8BA 1TUSA 1TURA 1SGDI 1TBQR 4SGBI 2N17A 1AN1I 1BMOA 1UVGA 5DAEA 1KMAA 1MT1A 2BUSA 2GKRI 2GKVA 3SGQI 1SGYI 1CSOI 1SGEI 1UUCA 3B4VC 1UVFA 2OVOA 1HJAI 3HH2C 1LR7A 1HPTA 2ARPF 1CT4I 2NU3I 1NUBA 2QQDA 3QTLD 1CHOI 1YU6C 2M5XA 4OVOA 1CT0I 2KMQA 2V53A 1OMTA 1DS3I 1CGII 1PPFI 1PCEA 2XRCA 2NU4I 3SEKC 1HDLA 4GI3C 1OYVI 1DS2I 1TBRR 2KMOA 1SGNI 1SGRI 1R0RI 1IY6A 1PJUA 2B0UC 1CE3A 1Y1CA 2KMPA 1BUSA 1Y1BA 2NU2I 3TJQA 1IW4A 1TGSI 1OVOA 2NU1I 2SGEI 1H0ZA 1IY5A 2JZMA 1CGJI 2WCYA 2SGDI 2LEOA 2N52A 3SGBI 1FYBA 2GKTI 1M8CA 1LR9A 1SGQI 2QQCA 2SGQI 1OMUA 2KCXA 2SGFI 3OVOA 1YTPA 2P6AC 1LR8A 1TIHA 2ERWA 2NU0I 2JYYA 5JHWC 1N13A 1CT2I 2F3CI 2N71A 2JXDA 1Z7KB 1SGPI
chains in the Genus database with same CATH superfamily
3RU0A 2KMRA 2SGPI 3UOEA 4HGUA 1R79A 2J9RA 1M8BA 1TUSA 5CCMA 2ELIA 3KY9A 1TURA 1SGDI 2DIPA 2CWFA 1TBQR 4SGBI 2LUYA 1W3SA 2N17A 1Q9BA 1AN1I 1BMOA 2E73A 2J87A 1UVGA 3PDNA 5EX0A 2L8EA 3QWPA 5DAEA 5E3QA 2QQEA 1KMAA 3UFFA 1MT1A 2W0TA 1WKXA 2BUSA 3MEKA 1ULMA 2GKRI 1P9ZA 4A24A 2GKVA 5FUXA 3TOBA 3R5BA 3VDUA 3SGQI 2DKVA 1S20A 3UGDA 1SGYI 1CSOI 2ENNA 2PQ8A 4WP4A 1SGEI 1UUCA 3B4VC 2X52A 1UVFA 2UZ3A 2OVOA 1K7TA 2JA1A 3BJIA 1MJAA 5FUVA 1HJAI 2YUUA 1PTRA 1V1HA 1LR7A 3HH2C 1VDDA 1HPTA 1PTQA 1W4RA 2ARPF 1RFHA 1UHAA 1CT4I 2A20A 2NU3I 1NUBA 2QQDA 2RIJA 3QTLD 1CHOI 5J8FA 3GOXA 5HI7A 1YU6C 2M5XA 3OXLA 3TO6A 3UEYA 4JCVE 4OVOA 1Y8FA 1FARA 3CXLA 1CT0I 2KMQA 2V53A 3R5DA 2X3TA 1OMTA 1DS3I 4UXIA 1CGII 3E2IA 1KBEA 1PPFI 5E3PA 1PCEA 4B6DA 3UGIA 2XRCA 2NU4I 3QAHA 5EX3A 1NXUA 3SEKC 2Y0MA 2VRWB 3TO7A 1HDLA 2OZUA 3D00A 2L7XA 7WGAA 4GI3C 9WGAA 1WGTA 1WTJA 1OYVI 5FUYA 1DS2I 4AMLA 1TBRR 1WGCA 1SGNI 2KMOA 3UGLA 5HQ8A 1SGRI 2K9HA 1TBNA 1X74A 3E59A 2FNFX 1R0RI 2ORVA 4MPIA 4DNCA 1K7VA 1V1IA 1IY6A 1MJ9A 2ORWA 3FSXA 3R5CA 1MJBA 1PJUA 2B0UC 3TOAA 1CE3A 2B8TA 1K7UA 1Y1CA 1XA6A 2OD1A 2KMPA 1BUSA 1Y1BA 3TO9A 2NU2I 2WVJA 3TJQA 1IW4A 3FSYA 2ROWA 1TGSI 2YQPA 3VDPA 1OVOA 3VE5A 2CJSC 2NU1I 2SGEI 1H0ZA 1IY5A 5J8CA 2ENZA 2JZMA 1CGJI 2WCYA 2V1CC 2SGDI 4E1PA 2LEOA 2N52A 1XX6A 3SGBI 4E1RA 1FYBA 1Z2IA 4L9MA 2GIVA 3OXGA 2GKTI 2UVOA 3UEJA 2CWHA 1M8CA 3R5AA 1LR9A 2QQ0A 1SGQI 2QQCA 2SGQI 1OMUA 1ULNA 2KCXA 2SGFI 1HEVA 5CCLA 1TOTA 1XBTA 1YTPA 2ODDA 2QPOA 3OVOA 5FUWA 1KBFA 1ULKA 2JW6A 2P6AC 2V1CA 2RC4A 4UXJA 1LR8A 1X4SA 1TIHA 2CWGA 2ERWA 2NU0I 1FY7A 2JYYA 5JHWC 3FC3A 1P9GA 1N13A 3OL0A 1FAQA 2DB6A 2E5RA 2GVIA 1CT2I 2F3CI 2N71A 2JXDA 4FKDA 1TBOA 1Z7KB 4UXHA 1U5KA 2N1AB 2OU2A 3OXFA 2LB7A 5E3RA 1SGPI 2WGCA
chains in the Genus database with same CATH topology
3RU0A 2KMRA 2SGPI 4HGUA 1R79A 2J9RA 1M8BA 1TUSA 5CCMA 2ELIA 3KY9A 1TURA 1SGDI 2DIPA 1TBQR 4SGBI 2LUYA 1W3SA 2N17A 2E73A 1AN1I 1BMOA 2J87A 3PDNA 1UVGA 5EX0A 2L8EA 3QWPA 5DAEA 2QQEA 1KMAA 3UFFA 1MT1A 2W0TA 2BUSA 3MEKA 2GKRI 4A24A 2GKVA 5FUXA 3VDUA 3SGQI 3UGDA 1SGYI 1CSOI 2ENNA 1SGEI 1UUCA 3B4VC 1UVFA 2UZ3A 2OVOA 2JA1A 3BJIA 5FUVA 1HJAI 2YUUA 1PTRA 1V1HA 1LR7A 3HH2C 1VDDA 1HPTA 1PTQA 2ARPF 1W4RA 1RFHA 1CT4I 2A20A 2NU3I 1NUBA 2QQDA 3QTLD 1CHOI 3GOXA 5HI7A 1YU6C 2M5XA 3OXLA 3UEYA 4JCVE 4OVOA 1Y8FA 1FARA 3CXLA 1CT0I 2KMQA 2V53A 4UXIA 1OMTA 1DS3I 1CGII 3E2IA 1KBEA 1PPFI 1PCEA 4B6DA 3UGIA 2XRCA 2NU4I 5EX3A 3SEKC 2VRWB 1HDLA 3D00A 2L7XA 4GI3C 1OYVI 5FUYA 1DS2I 1TBRR 2KMOA 1SGNI 3UGLA 5HQ8A 1SGRI 2K9HA 1TBNA 1X74A 3E59A 2FNFX 1R0RI 2ORVA 1IY6A 1V1IA 2ORWA 1PJUA 2B0UC 1CE3A 2B8TA 1Y1CA 1XA6A 2OD1A 2KMPA 1BUSA 1Y1BA 2NU2I 2WVJA 3TJQA 1IW4A 2ROWA 1TGSI 2YQPA 3VDPA 1OVOA 3VE5A 2CJSC 2NU1I 2SGEI 1H0ZA 1IY5A 2ENZA 2JZMA 1CGJI 2WCYA 2V1CC 2SGDI 4E1PA 2LEOA 2N52A 1XX6A 3SGBI 4E1RA 1FYBA 4L9MA 3OXGA 2GKTI 3UEJA 1M8CA 1LR9A 2QQ0A 1SGQI 2QQCA 2SGQI 1OMUA 2KCXA 2SGFI 5CCLA 1TOTA 1XBTA 1YTPA 2ODDA 2QPOA 3OVOA 5FUWA 1KBFA 2JW6A 2P6AC 2V1CA 4UXJA 1LR8A 1X4SA 1TIHA 2ERWA 2NU0I 2JYYA 5JHWC 3FC3A 1N13A 3OL0A 1FAQA 2DB6A 2E5RA 2GVIA 1CT2I 2F3CI 2N71A 2JXDA 4FKDA 1TBOA 1Z7KB 4UXHA 1U5KA 2N1AB 3OXFA 1SGPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMR A;  2SGP I;  4HGU A;  1M8B A;  1TUS A;  1TUR A;  1SGD I;  1TBQ R;  4SGB I;  2N17 A;  1AN1 I;  1BMO A;  1UVG A;  5DAE A;  1KMA A;  1MT1 A;  2BUS A;  2GKR I;  2GKV A;  3SGQ I;  1SGY I;  1CSO I;  1SGE I;  1UUC A;  3B4V C;  1UVF A;  2OVO A;  1HJA I;  3HH2 C;  1LR7 A;  1HPT A;  2ARP F;  1CT4 I;  2NU3 I;  1NUB A;  2QQD A;  3QTL D;  1CHO I;  1YU6 C;  2M5X A;  4OVO A;  1CT0 I;  2KMQ A;  2V53 A;  1OMT A;  1DS3 I;  1CGI I;  1PPF I;  1PCE A;  2XRC A;  2NU4 I;  3SEK C;  1HDL A;  4GI3 C;  1OYV I;  1DS2 I;  1TBR R;  2KMO A;  1SGN I;  1SGR I;  1R0R I;  1IY6 A;  1PJU A;  2B0U C;  1CE3 A;  1Y1C A;  2KMP A;  1BUS A;  1Y1B A;  2NU2 I;  3TJQ A;  1IW4 A;  1TGS I;  1OVO A;  2NU1 I;  2SGE I;  1H0Z A;  1IY5 A;  2JZM A;  1CGJ I;  2WCY A;  2SGD I;  2LEO A;  2N52 A;  3SGB I;  1FYB A;  2GKT I;  1M8C A;  1LR9 A;  1SGQ I;  2QQC A;  2SGQ I;  1OMU A;  2KCX A;  2SGF I;  3OVO A;  1YTP A;  2P6A C;  1LR8 A;  1TIH A;  2ERW A;  2NU0 I;  2JYY A;  5JHW C;  1N13 A;  1CT2 I;  2F3C I;  2N71 A;  2JXD A;  1Z7K B;  1SGP I; 
#chains in the Genus database with same CATH topology
 3RU0 A;  2KMR A;  2SGP I;  3UOE A;  4HGU A;  1R79 A;  2J9R A;  1M8B A;  1TUS A;  5CCM A;  2ELI A;  3KY9 A;  1TUR A;  1SGD I;  2DIP A;  2CWF A;  1TBQ R;  4SGB I;  2LUY A;  1W3S A;  2N17 A;  1Q9B A;  1AN1 I;  1BMO A;  2E73 A;  2J87 A;  1UVG A;  3PDN A;  5EX0 A;  2L8E A;  3QWP A;  5DAE A;  5E3Q A;  2QQE A;  1KMA A;  3UFF A;  1MT1 A;  2W0T A;  1WKX A;  2BUS A;  3MEK A;  1ULM A;  2GKR I;  1P9Z A;  4A24 A;  2GKV A;  5FUX A;  3TOB A;  3R5B A;  3VDU A;  3SGQ I;  2DKV A;  1S20 A;  3UGD A;  1SGY I;  1CSO I;  2ENN A;  2PQ8 A;  4WP4 A;  1SGE I;  1UUC A;  3B4V C;  2X52 A;  1UVF A;  2UZ3 A;  2OVO A;  1K7T A;  2JA1 A;  3BJI A;  1MJA A;  5FUV A;  1HJA I;  2YUU A;  1PTR A;  1V1H A;  1LR7 A;  3HH2 C;  1VDD A;  1HPT A;  1PTQ A;  1W4R A;  2ARP F;  1RFH A;  1UHA A;  1CT4 I;  2A20 A;  2NU3 I;  1NUB A;  2QQD A;  2RIJ A;  3QTL D;  1CHO I;  5J8F A;  3GOX A;  5HI7 A;  1YU6 C;  2M5X A;  3OXL A;  3TO6 A;  3UEY A;  4JCV E;  4OVO A;  1Y8F A;  1FAR A;  3CXL A;  1CT0 I;  2KMQ A;  2V53 A;  3R5D A;  2X3T A;  1OMT A;  1DS3 I;  4UXI A;  1CGI I;  3E2I A;  1KBE A;  1PPF I;  5E3P A;  1PCE A;  4B6D A;  3UGI A;  2XRC A;  2NU4 I;  3QAH A;  5EX3 A;  1NXU A;  3SEK C;  2Y0M A;  2VRW B;  3TO7 A;  1HDL A;  2OZU A;  3D00 A;  2L7X A;  7WGA A;  4GI3 C;  9WGA A;  1WGT A;  1WTJ A;  1OYV I;  5FUY A;  1DS2 I;  4AML A;  1TBR R;  1WGC A;  1SGN I;  2KMO A;  3UGL A;  5HQ8 A;  1SGR I;  2K9H A;  1TBN A;  1X74 A;  3E59 A;  2FNF X;  1R0R I;  2ORV A;  4MPI A;  4DNC A;  1K7V A;  1V1I A;  1IY6 A;  1MJ9 A;  2ORW A;  3FSX A;  3R5C A;  1MJB A;  1PJU A;  2B0U C;  3TOA A;  1CE3 A;  2B8T A;  1K7U A;  1Y1C A;  1XA6 A;  2OD1 A;  2KMP A;  1BUS A;  1Y1B A;  3TO9 A;  2NU2 I;  2WVJ A;  3TJQ A;  1IW4 A;  3FSY A;  2ROW A;  1TGS I;  2YQP A;  3VDP A;  1OVO A;  3VE5 A;  2CJS C;  2NU1 I;  2SGE I;  1H0Z A;  1IY5 A;  5J8C A;  2ENZ A;  2JZM A;  1CGJ I;  2WCY A;  2V1C C;  2SGD I;  4E1P A;  2LEO A;  2N52 A;  1XX6 A;  3SGB I;  4E1R A;  1FYB A;  1Z2I A;  4L9M A;  2GIV A;  3OXG A;  2GKT I;  2UVO A;  3UEJ A;  2CWH A;  1M8C A;  3R5A A;  1LR9 A;  2QQ0 A;  1SGQ I;  2QQC A;  2SGQ I;  1OMU A;  1ULN A;  2KCX A;  2SGF I;  1HEV A;  5CCL A;  1TOT A;  1XBT A;  1YTP A;  2ODD A;  2QPO A;  3OVO A;  5FUW A;  1KBF A;  1ULK A;  2JW6 A;  2P6A C;  2V1C A;  2RC4 A;  4UXJ A;  1LR8 A;  1X4S A;  1TIH A;  2CWG A;  2ERW A;  2NU0 I;  1FY7 A;  2JYY A;  5JHW C;  3FC3 A;  1P9G A;  1N13 A;  3OL0 A;  1FAQ A;  2DB6 A;  2E5R A;  2GVI A;  1CT2 I;  2F3C I;  2N71 A;  2JXD A;  4FKD A;  1TBO A;  1Z7K B;  4UXH A;  1U5K A;  2N1A B;  2OU2 A;  3OXF A;  2LB7 A;  5E3R A;  1SGP I;  2WGC A; 
#chains in the Genus database with same CATH homology
 3RU0 A;  2KMR A;  2SGP I;  4HGU A;  1R79 A;  2J9R A;  1M8B A;  1TUS A;  5CCM A;  2ELI A;  3KY9 A;  1TUR A;  1SGD I;  2DIP A;  1TBQ R;  4SGB I;  2LUY A;  1W3S A;  2N17 A;  2E73 A;  1AN1 I;  1BMO A;  2J87 A;  3PDN A;  1UVG A;  5EX0 A;  2L8E A;  3QWP A;  5DAE A;  2QQE A;  1KMA A;  3UFF A;  1MT1 A;  2W0T A;  2BUS A;  3MEK A;  2GKR I;  4A24 A;  2GKV A;  5FUX A;  3VDU A;  3SGQ I;  3UGD A;  1SGY I;  1CSO I;  2ENN A;  1SGE I;  1UUC A;  3B4V C;  1UVF A;  2UZ3 A;  2OVO A;  2JA1 A;  3BJI A;  5FUV A;  1HJA I;  2YUU A;  1PTR A;  1V1H A;  1LR7 A;  3HH2 C;  1VDD A;  1HPT A;  1PTQ A;  2ARP F;  1W4R A;  1RFH A;  1CT4 I;  2A20 A;  2NU3 I;  1NUB A;  2QQD A;  3QTL D;  1CHO I;  3GOX A;  5HI7 A;  1YU6 C;  2M5X A;  3OXL A;  3UEY A;  4JCV E;  4OVO A;  1Y8F A;  1FAR A;  3CXL A;  1CT0 I;  2KMQ A;  2V53 A;  4UXI A;  1OMT A;  1DS3 I;  1CGI I;  3E2I A;  1KBE A;  1PPF I;  1PCE A;  4B6D A;  3UGI A;  2XRC A;  2NU4 I;  5EX3 A;  3SEK C;  2VRW B;  1HDL A;  3D00 A;  2L7X A;  4GI3 C;  1OYV I;  5FUY A;  1DS2 I;  1TBR R;  2KMO A;  1SGN I;  3UGL A;  5HQ8 A;  1SGR I;  2K9H A;  1TBN A;  1X74 A;  3E59 A;  2FNF X;  1R0R I;  2ORV A;  1IY6 A;  1V1I A;  2ORW A;  1PJU A;  2B0U C;  1CE3 A;  2B8T A;  1Y1C A;  1XA6 A;  2OD1 A;  2KMP A;  1BUS A;  1Y1B A;  2NU2 I;  2WVJ A;  3TJQ A;  1IW4 A;  2ROW A;  1TGS I;  2YQP A;  3VDP A;  1OVO A;  3VE5 A;  2CJS C;  2NU1 I;  2SGE I;  1H0Z A;  1IY5 A;  2ENZ A;  2JZM A;  1CGJ I;  2WCY A;  2V1C C;  2SGD I;  4E1P A;  2LEO A;  2N52 A;  1XX6 A;  3SGB I;  4E1R A;  1FYB A;  4L9M A;  3OXG A;  2GKT I;  3UEJ A;  1M8C A;  1LR9 A;  2QQ0 A;  1SGQ I;  2QQC A;  2SGQ I;  1OMU A;  2KCX A;  2SGF I;  5CCL A;  1TOT A;  1XBT A;  1YTP A;  2ODD A;  2QPO A;  3OVO A;  5FUW A;  1KBF A;  2JW6 A;  2P6A C;  2V1C A;  4UXJ A;  1LR8 A;  1X4S A;  1TIH A;  2ERW A;  2NU0 I;  2JYY A;  5JHW C;  3FC3 A;  1N13 A;  3OL0 A;  1FAQ A;  2DB6 A;  2E5R A;  2GVI A;  1CT2 I;  2F3C I;  2N71 A;  2JXD A;  4FKD A;  1TBO A;  1Z7K B;  4UXH A;  1U5K A;  2N1A B;  3OXF A;  1SGP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...