1UVGA

Solution structure of the 15th domain of lekti
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
DSEMCKDYRVLPRIGYLCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRSTGKCEESSTPGTTAASMPPSDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEINASE INHIBITOR KAZAL TYPE 5
publication title The Solution Structure of a Chimeric Lekti Domain Reveals a Chameleon Sequence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine proteinase inhibitor
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1uvgA01
1PPFI 3B4VC 1TIHA 1PCEA 1M8CA 2KMOA 1SGQI 3SGBI 1UVGA 1TUSA 1PJUA 1CHOI 2KMPA 1UUCA 2ERWA 1OVOA 1HPTA 1BUSA 1DS2I 1Z7KB 2BUSA 5DAEA 1OMTA 1HJAI 2NU1I 2WCYA 3TJQA 2SGDI 1SGPI 2B0UC 1H0ZA 3SGQI 1DS3I 1FYBA 2SGPI 1OYVI 1CGJI 1TURA 2SGFI 2JYYA 3HH2C 2SGQI 1HDLA 2XRCA 2OVOA 1LR7A 1TBRR 2M5XA 4GI3C 5JHWC 1IY6A 1OMUA 1IY5A 2P6AC 1LR8A 2LEOA 1SGYI 1CSOI 1CT4I 2JZMA 2KMQA 1LR9A 2NU3I 2ARPF 1KMAA 2N71A 1SGEI 2V53A 2GKVA 1M8BA 2QQDA 1YU6C 1SGRI 2GKTI 1CE3A 1CT2I 2NU0I 1N13A 1NUBA 4SGBI 2JXDA 1Y1BA 1SGNI 1SGDI 2QQCA 2F3CI 2KMRA 2N17A 1IW4A 4HGUA 1R0RI 3OVOA 1YTPA 2GKRI 3QTLD 1MT1A 1TGSI 1AN1I 1TBQR 2NU2I 1UVFA 1CGII 2SGEI 1CT0I 1Y1CA 4OVOA 1BMOA 2NU4I 2N52A 2KCXA 3SEKC
chains in the Genus database with same CATH superfamily
2V1CA 2WVJA 5FUXA 3UOEA 1XBTA 1PPFI 3B4VC 1K7UA 1TIHA 1R79A 3FSYA 1PCEA 1FAQA 1M8CA 2KMOA 1SGQI 3SGBI 2QQ0A 3UGLA 3GOXA 1UVGA 1TUSA 2DB6A 3QAHA 2X3TA 1PJUA 1CHOI 2JW6A 1UUCA 2ERWA 2KMPA 3RU0A 1HPTA 3PDNA 1BUSA 1DS2I 1Z7KB 1TBNA 2BUSA 5DAEA 1OMTA 2A20A 1HJAI 1FARA 2E5RA 3UFFA 3TO9A 2GVIA 2NU1I 3KY9A 5EX0A 3UEJA 1W4RA 2WCYA 2Y0MA 3R5CA 5E3RA 3TJQA 1PTQA 1ULMA 1W3SA 2FNFX 1SGPI 2L7XA 2SGDI 3R5AA 4E1RA 2ORVA 5E3QA 4JCVE 1S20A 2B0UC 5CCLA 1H0ZA 3SGQI 1DS3I 3R5DA 1FYBA 2WGCA 2UZ3A 2SGPI 3VE5A 1OYVI 1CGJI 1UHAA 1TURA 2SGFI 2JYYA 1Q9BA 1RFHA 9WGAA 1KBEA 7WGAA 1V1HA 3HH2C 2SGQI 3TOBA 1K7VA 1HDLA 2XRCA 2OVOA 4A24A 1LR7A 1P9ZA 1TBRR 4B6DA 5HQ8A 1Y8FA 2M5XA 3E59A 4GI3C 5JHWC 3OXFA 2DKVA 2OU2A 3VDPA 2N1AB 1OMUA 1IY5A 1IY6A 3QWPA 3D00A 1FY7A 2P6AC 2YUUA 1LR8A 2LEOA 4E1PA 1SGYI 1CSOI 1P9GA 2J9RA 2VRWB 1CT4I 1WKXA 2JZMA 3BJIA 1XX6A 2LUYA 2UVOA 2KMQA 3VDUA 2DIPA 1LR9A 1MJAA 1XA6A 2JA1A 2NU3I 2ARPF 1KMAA 1X74A 2N71A 1SGEI 2V53A 2CWFA 1TOTA 1TBOA 2X52A 4AMLA 2GKVA 3TO7A 3OL0A 1M8BA 4UXHA 3CXLA 2L8EA 2QQDA 1PTRA 2OD1A 2V1CC 1YU6C 2ORWA 1KBFA 3FSXA 1SGRI 2K9HA 4DNCA 2ENNA 2GKTI 2LB7A 1CE3A 5FUYA 2QQEA 1CT2I 2NU0I 2W0TA 2E73A 1N13A 2B8TA 1NUBA 1NXUA 2OZUA 4MPIA 4SGBI 5HI7A 2JXDA 3OXGA 2ODDA 1K7TA 1Y1BA 1SGNI 5CCMA 3UGDA 1SGDI 2CWHA 2F3CI 2QQCA 2CJSC 5FUVA 1VDDA 1WTJA 2KMRA 3R5BA 4FKDA 2ENZA 3FC3A 1WGTA 3E2IA 2N17A 1IW4A 3TOAA 4HGUA 1Z2IA 1HEVA 5E3PA 1R0RI 3OVOA 1YTPA 1U5KA 2J87A 2GKRI 1WGCA 1X4SA 2YQPA 4UXJA 3QTLD 1MT1A 1TGSI 1AN1I 1TBQR 2NU2I 2RC4A 3UEYA 4WP4A 5J8CA 2ELIA 5EX3A 1MJ9A 1ULKA 1UVFA 1CGII 4L9MA 5FUWA 3MEKA 3TO6A 1ULNA 1V1IA 2GIVA 3UGIA 2SGEI 1CT0I 2QPOA 1Y1CA 2CWGA 4OVOA 2ROWA 4UXIA 1BMOA 2KCXA 2PQ8A 2NU4I 2N52A 5J8FA 1OVOA 1MJBA 2RIJA 3SEKC 3OXLA
chains in the Genus database with same CATH topology
2V1CA 2WVJA 5FUXA 1XBTA 1PPFI 3B4VC 1TIHA 1R79A 1PCEA 1FAQA 1M8CA 2KMOA 1SGQI 3SGBI 2QQ0A 3UGLA 3GOXA 1UVGA 1TUSA 2DB6A 1PJUA 1CHOI 2JW6A 1UUCA 2ERWA 2KMPA 3RU0A 1HPTA 3PDNA 1BUSA 1DS2I 2BUSA 1TBNA 1Z7KB 5DAEA 1OMTA 2A20A 1HJAI 1FARA 2E5RA 3UFFA 2GVIA 2NU1I 3KY9A 5EX0A 3UEJA 1W4RA 2WCYA 3TJQA 1PTQA 2FNFX 1W3SA 2L7XA 1SGPI 2SGDI 4E1RA 2ORVA 4JCVE 2B0UC 5CCLA 1H0ZA 3SGQI 1DS3I 1FYBA 2UZ3A 2SGPI 3VE5A 1OYVI 1CGJI 1TURA 2SGFI 2JYYA 1RFHA 1KBEA 1V1HA 3HH2C 2SGQI 1HDLA 2XRCA 2OVOA 4A24A 1LR7A 1TBRR 5HQ8A 1Y8FA 2M5XA 3E59A 4GI3C 5JHWC 3OXFA 1IY6A 3VDPA 2N1AB 1OMUA 1IY5A 3QWPA 3D00A 2P6AC 2YUUA 1LR8A 2LEOA 4E1PA 1SGYI 1CSOI 2J9RA 2VRWB 1CT4I 2JZMA 3BJIA 1XX6A 2LUYA 2KMQA 3VDUA 2DIPA 1LR9A 2JA1A 1XA6A 2NU3I 2ARPF 1KMAA 1X74A 2N71A 1SGEI 2V53A 1TOTA 1TBOA 2GKVA 3OL0A 1M8BA 4UXHA 3CXLA 2L8EA 2QQDA 1PTRA 2OD1A 2V1CC 1YU6C 2ORWA 1KBFA 1SGRI 2K9HA 2ENNA 2GKTI 1CE3A 5FUYA 2QQEA 1CT2I 2NU0I 2W0TA 2E73A 1N13A 2B8TA 1NUBA 4SGBI 5HI7A 2JXDA 3OXGA 2ODDA 1Y1BA 1SGNI 5CCMA 3UGDA 1SGDI 2QQCA 2F3CI 2CJSC 5FUVA 1VDDA 2KMRA 4FKDA 2ENZA 3FC3A 3E2IA 2N17A 1IW4A 4HGUA 1R0RI 3OVOA 1YTPA 1U5KA 2J87A 2GKRI 2YQPA 1X4SA 4UXJA 3QTLD 1MT1A 1TGSI 1AN1I 1TBQR 2NU2I 2ELIA 5EX3A 4L9MA 5FUWA 1UVFA 1CGII 3UEYA 3MEKA 1V1IA 3UGIA 2SGEI 1CT0I 2QPOA 1Y1CA 4OVOA 2ROWA 4UXIA 1BMOA 2KCXA 2NU4I 2N52A 1OVOA 4B6DA 3SEKC 3OXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPF I;  3B4V C;  1TIH A;  1PCE A;  1M8C A;  2KMO A;  1SGQ I;  3SGB I;  1UVG A;  1TUS A;  1PJU A;  1CHO I;  2KMP A;  1UUC A;  2ERW A;  1OVO A;  1HPT A;  1BUS A;  1DS2 I;  1Z7K B;  2BUS A;  5DAE A;  1OMT A;  1HJA I;  2NU1 I;  2WCY A;  3TJQ A;  2SGD I;  1SGP I;  2B0U C;  1H0Z A;  3SGQ I;  1DS3 I;  1FYB A;  2SGP I;  1OYV I;  1CGJ I;  1TUR A;  2SGF I;  2JYY A;  3HH2 C;  2SGQ I;  1HDL A;  2XRC A;  2OVO A;  1LR7 A;  1TBR R;  2M5X A;  4GI3 C;  5JHW C;  1IY6 A;  1OMU A;  1IY5 A;  2P6A C;  1LR8 A;  2LEO A;  1SGY I;  1CSO I;  1CT4 I;  2JZM A;  2KMQ A;  1LR9 A;  2NU3 I;  2ARP F;  1KMA A;  2N71 A;  1SGE I;  2V53 A;  2GKV A;  1M8B A;  2QQD A;  1YU6 C;  1SGR I;  2GKT I;  1CE3 A;  1CT2 I;  2NU0 I;  1N13 A;  1NUB A;  4SGB I;  2JXD A;  1Y1B A;  1SGN I;  1SGD I;  2QQC A;  2F3C I;  2KMR A;  2N17 A;  1IW4 A;  4HGU A;  1R0R I;  3OVO A;  1YTP A;  2GKR I;  3QTL D;  1MT1 A;  1TGS I;  1AN1 I;  1TBQ R;  2NU2 I;  1UVF A;  1CGI I;  2SGE I;  1CT0 I;  1Y1C A;  4OVO A;  1BMO A;  2NU4 I;  2N52 A;  2KCX A;  3SEK C; 
#chains in the Genus database with same CATH topology
 2V1C A;  2WVJ A;  5FUX A;  3UOE A;  1XBT A;  1PPF I;  3B4V C;  1K7U A;  1TIH A;  1R79 A;  3FSY A;  1PCE A;  1FAQ A;  1M8C A;  2KMO A;  1SGQ I;  3SGB I;  2QQ0 A;  3UGL A;  3GOX A;  1UVG A;  1TUS A;  2DB6 A;  3QAH A;  2X3T A;  1PJU A;  1CHO I;  2JW6 A;  1UUC A;  2ERW A;  2KMP A;  3RU0 A;  1HPT A;  3PDN A;  1BUS A;  1DS2 I;  1Z7K B;  1TBN A;  2BUS A;  5DAE A;  1OMT A;  2A20 A;  1HJA I;  1FAR A;  2E5R A;  3UFF A;  3TO9 A;  2GVI A;  2NU1 I;  3KY9 A;  5EX0 A;  3UEJ A;  1W4R A;  2WCY A;  2Y0M A;  3R5C A;  5E3R A;  3TJQ A;  1PTQ A;  1ULM A;  1W3S A;  2FNF X;  1SGP I;  2L7X A;  2SGD I;  3R5A A;  4E1R A;  2ORV A;  5E3Q A;  4JCV E;  1S20 A;  2B0U C;  5CCL A;  1H0Z A;  3SGQ I;  1DS3 I;  3R5D A;  1FYB A;  2WGC A;  2UZ3 A;  2SGP I;  3VE5 A;  1OYV I;  1CGJ I;  1UHA A;  1TUR A;  2SGF I;  2JYY A;  1Q9B A;  1RFH A;  9WGA A;  1KBE A;  7WGA A;  1V1H A;  3HH2 C;  2SGQ I;  3TOB A;  1K7V A;  1HDL A;  2XRC A;  2OVO A;  4A24 A;  1LR7 A;  1P9Z A;  1TBR R;  4B6D A;  5HQ8 A;  1Y8F A;  2M5X A;  3E59 A;  4GI3 C;  5JHW C;  3OXF A;  2DKV A;  2OU2 A;  3VDP A;  2N1A B;  1OMU A;  1IY5 A;  1IY6 A;  3QWP A;  3D00 A;  1FY7 A;  2P6A C;  2YUU A;  1LR8 A;  2LEO A;  4E1P A;  1SGY I;  1CSO I;  1P9G A;  2J9R A;  2VRW B;  1CT4 I;  1WKX A;  2JZM A;  3BJI A;  1XX6 A;  2LUY A;  2UVO A;  2KMQ A;  3VDU A;  2DIP A;  1LR9 A;  1MJA A;  1XA6 A;  2JA1 A;  2NU3 I;  2ARP F;  1KMA A;  1X74 A;  2N71 A;  1SGE I;  2V53 A;  2CWF A;  1TOT A;  1TBO A;  2X52 A;  4AML A;  2GKV A;  3TO7 A;  3OL0 A;  1M8B A;  4UXH A;  3CXL A;  2L8E A;  2QQD A;  1PTR A;  2OD1 A;  2V1C C;  1YU6 C;  2ORW A;  1KBF A;  3FSX A;  1SGR I;  2K9H A;  4DNC A;  2ENN A;  2GKT I;  2LB7 A;  1CE3 A;  5FUY A;  2QQE A;  1CT2 I;  2NU0 I;  2W0T A;  2E73 A;  1N13 A;  2B8T A;  1NUB A;  1NXU A;  2OZU A;  4MPI A;  4SGB I;  5HI7 A;  2JXD A;  3OXG A;  2ODD A;  1K7T A;  1Y1B A;  1SGN I;  5CCM A;  3UGD A;  1SGD I;  2CWH A;  2F3C I;  2QQC A;  2CJS C;  5FUV A;  1VDD A;  1WTJ A;  2KMR A;  3R5B A;  4FKD A;  2ENZ A;  3FC3 A;  1WGT A;  3E2I A;  2N17 A;  1IW4 A;  3TOA A;  4HGU A;  1Z2I A;  1HEV A;  5E3P A;  1R0R I;  3OVO A;  1YTP A;  1U5K A;  2J87 A;  2GKR I;  1WGC A;  1X4S A;  2YQP A;  4UXJ A;  3QTL D;  1MT1 A;  1TGS I;  1AN1 I;  1TBQ R;  2NU2 I;  2RC4 A;  3UEY A;  4WP4 A;  5J8C A;  2ELI A;  5EX3 A;  1MJ9 A;  1ULK A;  1UVF A;  1CGI I;  4L9M A;  5FUW A;  3MEK A;  3TO6 A;  1ULN A;  1V1I A;  2GIV A;  3UGI A;  2SGE I;  1CT0 I;  2QPO A;  1Y1C A;  2CWG A;  4OVO A;  2ROW A;  4UXI A;  1BMO A;  2KCX A;  2PQ8 A;  2NU4 I;  2N52 A;  5J8F A;  1OVO A;  1MJB A;  2RIJ A;  3SEK C;  3OXL A; 
#chains in the Genus database with same CATH homology
 2V1C A;  2WVJ A;  5FUX A;  1XBT A;  1PPF I;  3B4V C;  1TIH A;  1R79 A;  1PCE A;  1FAQ A;  1M8C A;  2KMO A;  1SGQ I;  3SGB I;  2QQ0 A;  3UGL A;  3GOX A;  1UVG A;  1TUS A;  2DB6 A;  1PJU A;  1CHO I;  2JW6 A;  1UUC A;  2ERW A;  2KMP A;  3RU0 A;  1HPT A;  3PDN A;  1BUS A;  1DS2 I;  2BUS A;  1TBN A;  1Z7K B;  5DAE A;  1OMT A;  2A20 A;  1HJA I;  1FAR A;  2E5R A;  3UFF A;  2GVI A;  2NU1 I;  3KY9 A;  5EX0 A;  3UEJ A;  1W4R A;  2WCY A;  3TJQ A;  1PTQ A;  2FNF X;  1W3S A;  2L7X A;  1SGP I;  2SGD I;  4E1R A;  2ORV A;  4JCV E;  2B0U C;  5CCL A;  1H0Z A;  3SGQ I;  1DS3 I;  1FYB A;  2UZ3 A;  2SGP I;  3VE5 A;  1OYV I;  1CGJ I;  1TUR A;  2SGF I;  2JYY A;  1RFH A;  1KBE A;  1V1H A;  3HH2 C;  2SGQ I;  1HDL A;  2XRC A;  2OVO A;  4A24 A;  1LR7 A;  1TBR R;  5HQ8 A;  1Y8F A;  2M5X A;  3E59 A;  4GI3 C;  5JHW C;  3OXF A;  1IY6 A;  3VDP A;  2N1A B;  1OMU A;  1IY5 A;  3QWP A;  3D00 A;  2P6A C;  2YUU A;  1LR8 A;  2LEO A;  4E1P A;  1SGY I;  1CSO I;  2J9R A;  2VRW B;  1CT4 I;  2JZM A;  3BJI A;  1XX6 A;  2LUY A;  2KMQ A;  3VDU A;  2DIP A;  1LR9 A;  2JA1 A;  1XA6 A;  2NU3 I;  2ARP F;  1KMA A;  1X74 A;  2N71 A;  1SGE I;  2V53 A;  1TOT A;  1TBO A;  2GKV A;  3OL0 A;  1M8B A;  4UXH A;  3CXL A;  2L8E A;  2QQD A;  1PTR A;  2OD1 A;  2V1C C;  1YU6 C;  2ORW A;  1KBF A;  1SGR I;  2K9H A;  2ENN A;  2GKT I;  1CE3 A;  5FUY A;  2QQE A;  1CT2 I;  2NU0 I;  2W0T A;  2E73 A;  1N13 A;  2B8T A;  1NUB A;  4SGB I;  5HI7 A;  2JXD A;  3OXG A;  2ODD A;  1Y1B A;  1SGN I;  5CCM A;  3UGD A;  1SGD I;  2QQC A;  2F3C I;  2CJS C;  5FUV A;  1VDD A;  2KMR A;  4FKD A;  2ENZ A;  3FC3 A;  3E2I A;  2N17 A;  1IW4 A;  4HGU A;  1R0R I;  3OVO A;  1YTP A;  1U5K A;  2J87 A;  2GKR I;  2YQP A;  1X4S A;  4UXJ A;  3QTL D;  1MT1 A;  1TGS I;  1AN1 I;  1TBQ R;  2NU2 I;  2ELI A;  5EX3 A;  4L9M A;  5FUW A;  1UVF A;  1CGI I;  3UEY A;  3MEK A;  1V1I A;  3UGI A;  2SGE I;  1CT0 I;  2QPO A;  1Y1C A;  4OVO A;  2ROW A;  4UXI A;  1BMO A;  2KCX A;  2NU4 I;  2N52 A;  1OVO A;  4B6D A;  3SEK C;  3OXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...