1UVGA

Solution structure of the 15th domain of lekti
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
DSEMCKDYRVLPRIGYLCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRSTGKCEESSTPGTTAASMPPSDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Solution Structure of a Chimeric Lekti Domain Reveals a Chameleon Sequence
pubmed doi rcsb
molecule keywords SERINE PROTEINASE INHIBITOR KAZAL TYPE 5
molecule tags Serine proteinase inhibitor
source organism Homo sapiens
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1uvgA01
1LR8A 1TGSI 2ARPF 5JHWC 1DS3I 1H0ZA 2SGQI 1PPFI 2NU2I 1BUSA 1PJUA 1SGNI 2GKVA 3QTLD 4OVOA 1OMTA 2N17A 1CT2I 1UUCA 2ERWA 2JZMA 1HDLA 3HH2C 1SGRI 1FYBA 2B0UC 1IW4A 2KMOA 1IY6A 1TIHA 1PCEA 2NU0I 2SGPI 2V53A 2KMPA 1SGEI 1MT1A 2QQCA 1CT0I 1LR7A 1Y1BA 2OVOA 1IY5A 4GI3C 1TURA 1YTPA 2NU1I 2F3CI 2N52A 1M8BA 1SGDI 2NU3I 2SGFI 1BMOA 3TJQA 1NUBA 2KCXA 3B4VC 1LR9A 1CE3A 4HGUA 1YU6C 2QQDA 1N13A 2WCYA 1HJAI 2P6AC 1OVOA 1AN1I 1UVGA 2GKRI 1Z7KB 4SGBI 1KMAA 1TUSA 1CGII 1CT4I 1CHOI 1SGQI 2M5XA 1SGYI 2BUSA 1UVFA 1CSOI 2SGDI 5DAEA 1HPTA 1TBRR 2LEOA 2XRCA 2KMRA 2N71A 2KMQA 3SEKC 1CGJI 3SGQI 1Y1CA 3SGBI 1TBQR 1R0RI 2JYYA 2JXDA 1OYVI 1DS2I 1SGPI 3OVOA 1OMUA 2SGEI 1M8CA 2GKTI 2NU4I
chains in the Genus database with same CATH superfamily
2N1AB 5FUVA 2OZUA 1LR8A 2JW6A 2CJSC 1TGSI 2ARPF 5JHWC 1DS3I 5E3QA 4AMLA 3OL0A 1H0ZA 2SGQI 2X3TA 2YUUA 1PPFI 2NU2I 1BUSA 1PJUA 1SGNI 1FY7A 2GKVA 3TOAA 3QTLD 5EX3A 3UEJA 3FSXA 4OVOA 5E3PA 1Z2IA 4E1RA 1OMTA 2N17A 3QAHA 2ELIA 1Q9BA 5E3RA 1CT2I 1UUCA 1XBTA 4UXIA 3UEYA 2ERWA 2FNFX 1X4SA 2DKVA 2JZMA 2ROWA 2V1CA 1V1HA 2Y0MA 3HH2C 5FUWA 1SGRI 1FYBA 3E2IA 3QWPA 3UOEA 2LUYA 2ENZA 2A20A 2B0UC 2E5RA 1Y8FA 2KMOA 1IW4A 3OXGA 1IY6A 2UVOA 2DIPA 1TIHA 1MJ9A 1WTJA 1PCEA 3MEKA 2NU0I 2SGPI 2V53A 2KMPA 1SGEI 1MT1A 2L8EA 1CT0I 2QQCA 5FUXA 1FAQA 1LR7A 1Y1BA 1MJBA 1TBOA 1P9GA 4UXJA 2OVOA 2GIVA 3UFFA 1FARA 4GI3C 1IY5A 1W3SA 2ENNA 3R5BA 5J8CA 2CWHA 3GOXA 3E59A 1PTRA 1TURA 1YTPA 7WGAA 2UZ3A 2NU1I 2QPOA 1WGTA 2WVJA 3UGDA 9WGAA 1K7TA 2F3CI 2YQPA 3R5DA 2N52A 3OXLA 1M8BA 1SGDI 2JA1A 2NU3I 2SGFI 1BMOA 3BJIA 1NUBA 4MPIA 3TJQA 3VE5A 5HQ8A 1KBFA 2KCXA 2ORVA 3FC3A 3B4VC 1ULKA 1TOTA 1LR9A 2OD1A 2WGCA 3VDUA 1R79A 2VRWB 3FSYA 3UGLA 1CE3A 1KBEA 1ULMA 1YU6C 4HGUA 3TOBA 2V1CC 2W0TA 2QQDA 1N13A 2WCYA 1HJAI 4E1PA 1X74A 2P6AC 1OVOA 3R5CA 4JCVE 1AN1I 1UVGA 1HDLA 2GKRI 1Z7KB 4FKDA 4SGBI 1KMAA 3UGIA 1TUSA 1CGII 3RU0A 1CT4I 4DNCA 1U5KA 1CHOI 1TBNA 1SGQI 1VDDA 2M5XA 1NXUA 1SGYI 2BUSA 1UVFA 1P9ZA 2OU2A 1CSOI 3R5AA 1MJAA 4L9MA 1K7UA 2SGDI 1K7VA 1PTQA 1WGCA 5HI7A 3PDNA 2ODDA 1HEVA 3TO9A 5DAEA 1ULNA 1HPTA 1TBRR 2J87A 2LEOA 1S20A 3D00A 2CWFA 2XRCA 2KMRA 3CXLA 5CCMA 2X52A 2N71A 2KMQA 3OXFA 1CGJI 3SEKC 3KY9A 3SGQI 2RIJA 2PQ8A 3TO7A 2K9HA 5J8FA 1Y1CA 2B8TA 3SGBI 3TO6A 1XA6A 1TBQR 1R0RI 3VDPA 4A24A 2GVIA 4WP4A 1UHAA 2JYYA 1W4RA 5EX0A 2RC4A 4UXHA 2L7XA 2JXDA 2DB6A 5FUYA 1RFHA 1OYVI 2E73A 1DS2I 1SGPI 2LB7A 3OVOA 1V1IA 4B6DA 2CWGA 2J9RA 2QQEA 2QQ0A 1OMUA 2SGEI 1M8CA 1WKXA 2GKTI 2ORWA 1XX6A 5CCLA 2NU4I
chains in the Genus database with same CATH topology
2N1AB 5FUVA 1LR8A 2JW6A 2CJSC 1TGSI 2ARPF 5JHWC 1DS3I 3OL0A 1H0ZA 2SGQI 2YUUA 1PPFI 2NU2I 1BUSA 1PJUA 1SGNI 2GKVA 3QTLD 5EX3A 3UEJA 4OVOA 4E1RA 1OMTA 2N17A 2ELIA 1CT2I 1UUCA 1XBTA 4UXIA 3UEYA 2ERWA 2FNFX 1X4SA 2JZMA 2ROWA 2V1CA 5FUWA 1V1HA 3HH2C 1HDLA 1SGRI 1FYBA 3E2IA 3QWPA 2LUYA 2ENZA 2A20A 2B0UC 2E5RA 1Y8FA 2KMOA 1IW4A 3OXGA 1IY6A 2DIPA 1TIHA 1PCEA 3MEKA 2NU0I 2SGPI 2V53A 2KMPA 1SGEI 1MT1A 2L8EA 1CT0I 2QQCA 5FUXA 1FAQA 1LR7A 1Y1BA 1TBOA 4UXJA 2OVOA 3UFFA 1FARA 4GI3C 1IY5A 1W3SA 2ENNA 3GOXA 3E59A 1PTRA 1TURA 1YTPA 2UZ3A 2NU1I 2QPOA 2WVJA 3UGDA 2F3CI 2YQPA 2N52A 3OXLA 1M8BA 1SGDI 2JA1A 2NU3I 2SGFI 1BMOA 3BJIA 1NUBA 3TJQA 3VE5A 5HQ8A 1KBFA 2KCXA 2ORVA 3FC3A 3B4VC 1LR9A 1TOTA 2OD1A 3VDUA 1R79A 2VRWB 3UGLA 1CE3A 1KBEA 4HGUA 1YU6C 2V1CC 2W0TA 2QQDA 1N13A 2WCYA 1HJAI 4E1PA 1X74A 2P6AC 1OVOA 4JCVE 1AN1I 1UVGA 2GKRI 1Z7KB 4FKDA 4SGBI 1KMAA 3UGIA 1TUSA 1CGII 3RU0A 1CT4I 1U5KA 1CHOI 1TBNA 1SGQI 1VDDA 2M5XA 1SGYI 2BUSA 1UVFA 1CSOI 4L9MA 2SGDI 5HI7A 1PTQA 3PDNA 2ODDA 5DAEA 1HPTA 1TBRR 2J87A 2LEOA 3D00A 2XRCA 5CCMA 2KMRA 3CXLA 2N71A 2KMQA 3OXFA 1CGJI 3SEKC 3KY9A 3SGQI 2K9HA 1Y1CA 2B8TA 3SGBI 1XA6A 1TBQR 1R0RI 3VDPA 4A24A 2GVIA 2JYYA 1W4RA 5EX0A 4UXHA 2L7XA 2JXDA 2DB6A 5FUYA 1RFHA 1OYVI 2E73A 1DS2I 1SGPI 3OVOA 1V1IA 4B6DA 2J9RA 2QQEA 2QQ0A 1OMUA 2SGEI 1M8CA 2GKTI 2ORWA 1XX6A 5CCLA 2NU4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LR8 A;  1TGS I;  2ARP F;  5JHW C;  1DS3 I;  1H0Z A;  2SGQ I;  1PPF I;  2NU2 I;  1BUS A;  1PJU A;  1SGN I;  2GKV A;  3QTL D;  4OVO A;  1OMT A;  2N17 A;  1CT2 I;  1UUC A;  2ERW A;  2JZM A;  1HDL A;  3HH2 C;  1SGR I;  1FYB A;  2B0U C;  1IW4 A;  2KMO A;  1IY6 A;  1TIH A;  1PCE A;  2NU0 I;  2SGP I;  2V53 A;  2KMP A;  1SGE I;  1MT1 A;  2QQC A;  1CT0 I;  1LR7 A;  1Y1B A;  2OVO A;  1IY5 A;  4GI3 C;  1TUR A;  1YTP A;  2NU1 I;  2F3C I;  2N52 A;  1M8B A;  1SGD I;  2NU3 I;  2SGF I;  1BMO A;  3TJQ A;  1NUB A;  2KCX A;  3B4V C;  1LR9 A;  1CE3 A;  4HGU A;  1YU6 C;  2QQD A;  1N13 A;  2WCY A;  1HJA I;  2P6A C;  1OVO A;  1AN1 I;  1UVG A;  2GKR I;  1Z7K B;  4SGB I;  1KMA A;  1TUS A;  1CGI I;  1CT4 I;  1CHO I;  1SGQ I;  2M5X A;  1SGY I;  2BUS A;  1UVF A;  1CSO I;  2SGD I;  5DAE A;  1HPT A;  1TBR R;  2LEO A;  2XRC A;  2KMR A;  2N71 A;  2KMQ A;  3SEK C;  1CGJ I;  3SGQ I;  1Y1C A;  3SGB I;  1TBQ R;  1R0R I;  2JYY A;  2JXD A;  1OYV I;  1DS2 I;  1SGP I;  3OVO A;  1OMU A;  2SGE I;  1M8C A;  2GKT I;  2NU4 I; 
#chains in the Genus database with same CATH topology
 2N1A B;  5FUV A;  2OZU A;  1LR8 A;  2JW6 A;  2CJS C;  1TGS I;  2ARP F;  5JHW C;  1DS3 I;  5E3Q A;  4AML A;  3OL0 A;  1H0Z A;  2SGQ I;  2X3T A;  2YUU A;  1PPF I;  2NU2 I;  1BUS A;  1PJU A;  1SGN I;  1FY7 A;  2GKV A;  3TOA A;  3QTL D;  5EX3 A;  3UEJ A;  3FSX A;  4OVO A;  5E3P A;  1Z2I A;  4E1R A;  1OMT A;  2N17 A;  3QAH A;  2ELI A;  1Q9B A;  5E3R A;  1CT2 I;  1UUC A;  1XBT A;  4UXI A;  3UEY A;  2ERW A;  2FNF X;  1X4S A;  2DKV A;  2JZM A;  2ROW A;  2V1C A;  1V1H A;  2Y0M A;  3HH2 C;  5FUW A;  1SGR I;  1FYB A;  3E2I A;  3QWP A;  3UOE A;  2LUY A;  2ENZ A;  2A20 A;  2B0U C;  2E5R A;  1Y8F A;  2KMO A;  1IW4 A;  3OXG A;  1IY6 A;  2UVO A;  2DIP A;  1TIH A;  1MJ9 A;  1WTJ A;  1PCE A;  3MEK A;  2NU0 I;  2SGP I;  2V53 A;  2KMP A;  1SGE I;  1MT1 A;  2L8E A;  1CT0 I;  2QQC A;  5FUX A;  1FAQ A;  1LR7 A;  1Y1B A;  1MJB A;  1TBO A;  1P9G A;  4UXJ A;  2OVO A;  2GIV A;  3UFF A;  1FAR A;  4GI3 C;  1IY5 A;  1W3S A;  2ENN A;  3R5B A;  5J8C A;  2CWH A;  3GOX A;  3E59 A;  1PTR A;  1TUR A;  1YTP A;  7WGA A;  2UZ3 A;  2NU1 I;  2QPO A;  1WGT A;  2WVJ A;  3UGD A;  9WGA A;  1K7T A;  2F3C I;  2YQP A;  3R5D A;  2N52 A;  3OXL A;  1M8B A;  1SGD I;  2JA1 A;  2NU3 I;  2SGF I;  1BMO A;  3BJI A;  1NUB A;  4MPI A;  3TJQ A;  3VE5 A;  5HQ8 A;  1KBF A;  2KCX A;  2ORV A;  3FC3 A;  3B4V C;  1ULK A;  1TOT A;  1LR9 A;  2OD1 A;  2WGC A;  3VDU A;  1R79 A;  2VRW B;  3FSY A;  3UGL A;  1CE3 A;  1KBE A;  1ULM A;  1YU6 C;  4HGU A;  3TOB A;  2V1C C;  2W0T A;  2QQD A;  1N13 A;  2WCY A;  1HJA I;  4E1P A;  1X74 A;  2P6A C;  1OVO A;  3R5C A;  4JCV E;  1AN1 I;  1UVG A;  1HDL A;  2GKR I;  1Z7K B;  4FKD A;  4SGB I;  1KMA A;  3UGI A;  1TUS A;  1CGI I;  3RU0 A;  1CT4 I;  4DNC A;  1U5K A;  1CHO I;  1TBN A;  1SGQ I;  1VDD A;  2M5X A;  1NXU A;  1SGY I;  2BUS A;  1UVF A;  1P9Z A;  2OU2 A;  1CSO I;  3R5A A;  1MJA A;  4L9M A;  1K7U A;  2SGD I;  1K7V A;  1PTQ A;  1WGC A;  5HI7 A;  3PDN A;  2ODD A;  1HEV A;  3TO9 A;  5DAE A;  1ULN A;  1HPT A;  1TBR R;  2J87 A;  2LEO A;  1S20 A;  3D00 A;  2CWF A;  2XRC A;  2KMR A;  3CXL A;  5CCM A;  2X52 A;  2N71 A;  2KMQ A;  3OXF A;  1CGJ I;  3SEK C;  3KY9 A;  3SGQ I;  2RIJ A;  2PQ8 A;  3TO7 A;  2K9H A;  5J8F A;  1Y1C A;  2B8T A;  3SGB I;  3TO6 A;  1XA6 A;  1TBQ R;  1R0R I;  3VDP A;  4A24 A;  2GVI A;  4WP4 A;  1UHA A;  2JYY A;  1W4R A;  5EX0 A;  2RC4 A;  4UXH A;  2L7X A;  2JXD A;  2DB6 A;  5FUY A;  1RFH A;  1OYV I;  2E73 A;  1DS2 I;  1SGP I;  2LB7 A;  3OVO A;  1V1I A;  4B6D A;  2CWG A;  2J9R A;  2QQE A;  2QQ0 A;  1OMU A;  2SGE I;  1M8C A;  1WKX A;  2GKT I;  2ORW A;  1XX6 A;  5CCL A;  2NU4 I; 
#chains in the Genus database with same CATH homology
 2N1A B;  5FUV A;  1LR8 A;  2JW6 A;  2CJS C;  1TGS I;  2ARP F;  5JHW C;  1DS3 I;  3OL0 A;  1H0Z A;  2SGQ I;  2YUU A;  1PPF I;  2NU2 I;  1BUS A;  1PJU A;  1SGN I;  2GKV A;  3QTL D;  5EX3 A;  3UEJ A;  4OVO A;  4E1R A;  1OMT A;  2N17 A;  2ELI A;  1CT2 I;  1UUC A;  1XBT A;  4UXI A;  3UEY A;  2ERW A;  2FNF X;  1X4S A;  2JZM A;  2ROW A;  2V1C A;  5FUW A;  1V1H A;  3HH2 C;  1HDL A;  1SGR I;  1FYB A;  3E2I A;  3QWP A;  2LUY A;  2ENZ A;  2A20 A;  2B0U C;  2E5R A;  1Y8F A;  2KMO A;  1IW4 A;  3OXG A;  1IY6 A;  2DIP A;  1TIH A;  1PCE A;  3MEK A;  2NU0 I;  2SGP I;  2V53 A;  2KMP A;  1SGE I;  1MT1 A;  2L8E A;  1CT0 I;  2QQC A;  5FUX A;  1FAQ A;  1LR7 A;  1Y1B A;  1TBO A;  4UXJ A;  2OVO A;  3UFF A;  1FAR A;  4GI3 C;  1IY5 A;  1W3S A;  2ENN A;  3GOX A;  3E59 A;  1PTR A;  1TUR A;  1YTP A;  2UZ3 A;  2NU1 I;  2QPO A;  2WVJ A;  3UGD A;  2F3C I;  2YQP A;  2N52 A;  3OXL A;  1M8B A;  1SGD I;  2JA1 A;  2NU3 I;  2SGF I;  1BMO A;  3BJI A;  1NUB A;  3TJQ A;  3VE5 A;  5HQ8 A;  1KBF A;  2KCX A;  2ORV A;  3FC3 A;  3B4V C;  1LR9 A;  1TOT A;  2OD1 A;  3VDU A;  1R79 A;  2VRW B;  3UGL A;  1CE3 A;  1KBE A;  4HGU A;  1YU6 C;  2V1C C;  2W0T A;  2QQD A;  1N13 A;  2WCY A;  1HJA I;  4E1P A;  1X74 A;  2P6A C;  1OVO A;  4JCV E;  1AN1 I;  1UVG A;  2GKR I;  1Z7K B;  4FKD A;  4SGB I;  1KMA A;  3UGI A;  1TUS A;  1CGI I;  3RU0 A;  1CT4 I;  1U5K A;  1CHO I;  1TBN A;  1SGQ I;  1VDD A;  2M5X A;  1SGY I;  2BUS A;  1UVF A;  1CSO I;  4L9M A;  2SGD I;  5HI7 A;  1PTQ A;  3PDN A;  2ODD A;  5DAE A;  1HPT A;  1TBR R;  2J87 A;  2LEO A;  3D00 A;  2XRC A;  5CCM A;  2KMR A;  3CXL A;  2N71 A;  2KMQ A;  3OXF A;  1CGJ I;  3SEK C;  3KY9 A;  3SGQ I;  2K9H A;  1Y1C A;  2B8T A;  3SGB I;  1XA6 A;  1TBQ R;  1R0R I;  3VDP A;  4A24 A;  2GVI A;  2JYY A;  1W4R A;  5EX0 A;  4UXH A;  2L7X A;  2JXD A;  2DB6 A;  5FUY A;  1RFH A;  1OYV I;  2E73 A;  1DS2 I;  1SGP I;  3OVO A;  1V1I A;  4B6D A;  2J9R A;  2QQE A;  2QQ0 A;  1OMU A;  2SGE I;  1M8C A;  2GKT I;  2ORW A;  1XX6 A;  5CCL A;  2NU4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...