1Y8FA

Solution structure of the munc13-1 c1-domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
51
structure length
51
Chain Sequence
b'QHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Unc-13 homolog A
publication title Intramolecular occlusion of the diacylglycerol-binding site in the C1 domain of munc13-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis,signaling protein
total genus 5
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2004-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1y8fA00
2QQ0A 2ORVA 4UXHA 3E2IA 2VRWB 1R79A 1TBNA 3UEJA 5FUVA 3UGLA 2ENNA 1KBFA 1W4RA 1XA6A 3CXLA 1RFHA 2QQEA 3KY9A 1FARA 5FUWA 1Y8FA 2YUUA 3BJIA 5FUXA 3UEYA 2ROWA 2J87A 1FAQA 2B8TA 1PTQA 2ENZA 2WVJA 4L9MA 1XX6A 2QPOA 1KBEA 2J9RA 2FNFX 1XBTA 2JA1A 2ORWA 1PTRA 4UXJA 2UZ3A 3UFFA 3UGIA 4B6DA 2ELIA 2DB6A 4FKDA 5FUYA 3UGDA 4UXIA 1TBOA 2E73A 2GVIA
chains in the Genus database with same CATH superfamily
1MT1A 1OVOA 3TO7A 1W3SA 1LR8A 3R5BA 2OVOA 5J8CA 2VRWB 2XRCA 2BUSA 2GKRI 3HH2C 2V1CA 3QAHA 3OXLA 1TGSI 2RIJA 2N17A 2NU2I 2SGQI 3TO6A 3UEJA 2V1CC 1XA6A 1SGNI 2SGFI 3SEKC 2Y0MA 2N52A 2M5XA 3OVOA 5J8FA 1HJAI 1OMUA 2QQEA 5E3RA 3UOEA 3TO9A 3BJIA 2JYYA 3UEYA 2SGEI 1V1IA 1OMTA 1NUBA 4A24A 2J9RA 9WGAA 1X4SA 1CT0I 1HPTA 2A20A 1HDLA 2F3CI 1MJAA 2ARPF 1ULMA 1CT4I 4JCVE 1P9GA 2ELIA 2DB6A 5FUYA 2E73A 3OL0A 2QQCA 2WVJA 3R5CA 4FKDA 4E1PA 2QQ0A 2ORVA 2JXDA 2SGDI 1SGPI 1FY7A 2E5RA 2N1AB 1MJ9A 2GIVA 2CJSC 1DS3I 1UVGA 2NU4I 5E3PA 5FUVA 1W4RA 2K9HA 1RFHA 1K7TA 1FARA 1IY5A 3B4VC 5FUWA 3TOBA 5DAEA 2YUUA 5JHWC 2CWHA 5FUXA 2KMRA 1UHAA 3OXGA 2J87A 4E1RA 1CHOI 1SGRI 2B8TA 2N71A 3QTLD 1PTQA 2UVOA 1FAQA 1Y1CA 2QQDA 1Y1BA 4OVOA 2B0UC 2CWGA 2NU0I 2L8EA 3R5AA 4UXJA 1CE3A 2UZ3A 1PCEA 3QWPA 1BUSA 1V1HA 1VDDA 3UGIA 1WGTA 4DNCA 1M8CA 5HQ8A 5HI7A 3UGDA 4UXIA 1TBOA 2GVIA 3R5DA 1SGYI 2GKTI 1FYBA 5EX3A 1CGII 1LR9A 3RU0A 2SGPI 1K7UA 1WGCA 1R79A 1TBNA 2JZMA 1KBFA 2ENNA 2W0TA 2LUYA 1DS2I 2L7XA 2X52A 1AN1I 3KY9A 1TOTA 2CWFA 2ODDA 3SGBI 1SGQI 2PQ8A 2JW6A 3FSYA 2LEOA 1TBRR 1IY6A 2ROWA 5E3QA 3E59A 1ULKA 1HEVA 3FC3A 2KCXA 4AMLA 2KMQA 4WP4A 2V53A 1XX6A 2GKVA 1CSOI 1KBEA 1SGEI 2LB7A 2QPOA 5CCMA 1M8BA 1XBTA 1K7VA 1U5KA 1PTRA 2ORWA 3OXFA 1KMAA 3UFFA 1MJBA 1X74A 2KMOA 1Z7KB 2OD1A 2YQPA 1S20A 5EX0A 1BMOA 1LR7A 2ERWA 2DIPA 4UXHA 2X3TA 5CCLA 3E2IA 3VDPA 1WTJA 2OZUA 1R0RI 3FSXA 1OYVI 1YTPA 3TOAA 1PPFI 3UGLA 3SGQI 1TUSA 3CXLA 4HGUA 2DKVA 1SGDI 1P9ZA 1WKXA 3PDNA 1H0ZA 1Y8FA 2NU1I 3MEKA 2RC4A 3VE5A 4SGBI 1PJUA 1CGJI 3TJQA 2KMPA 2OU2A 1Z2IA 1N13A 2ENZA 4L9MA 2NU3I 2P6AC 2FNFX 2JA1A 1YU6C 2WGCA 1NXUA 4GI3C 1UVFA 1UUCA 4MPIA 7WGAA 3GOXA 1IW4A 1TIHA 1CT2I 3D00A 4B6DA 1ULNA 2WCYA 1TBQR 3VDUA 1Q9BA 1TURA
chains in the Genus database with same CATH topology
1MT1A 1OVOA 1W3SA 1LR8A 2OVOA 2VRWB 2XRCA 2BUSA 2GKRI 3HH2C 2V1CA 3OXLA 1TGSI 2SGQI 2N17A 2NU2I 3UEJA 2V1CC 1XA6A 1SGNI 2SGFI 3SEKC 3OVOA 2N52A 2M5XA 1HJAI 1OMUA 2QQEA 3BJIA 2JYYA 3UEYA 2SGEI 1V1IA 1OMTA 1NUBA 4A24A 2J9RA 1X4SA 1CT0I 1HPTA 2A20A 1HDLA 2F3CI 2ARPF 4JCVE 1CT4I 2ELIA 2DB6A 5FUYA 2E73A 3OL0A 2QQCA 2WVJA 4FKDA 4E1PA 2QQ0A 2ORVA 2JXDA 2SGDI 1SGPI 2E5RA 2N1AB 2CJSC 1DS3I 1UVGA 2NU4I 5FUVA 1W4RA 2K9HA 1RFHA 1FARA 1IY5A 3B4VC 5FUWA 5DAEA 2YUUA 5JHWC 5FUXA 2KMRA 4E1RA 3OXGA 2J87A 1CHOI 1SGRI 2B8TA 2N71A 3QTLD 1PTQA 1FAQA 1Y1CA 2QQDA 1Y1BA 4OVOA 2B0UC 2NU0I 2L8EA 4UXJA 1CE3A 2UZ3A 1PCEA 3QWPA 1BUSA 1V1HA 1VDDA 3UGIA 5HQ8A 1M8CA 5HI7A 3UGDA 4UXIA 1TBOA 2GVIA 1SGYI 2GKTI 1FYBA 5EX3A 1CGII 1LR9A 3RU0A 2SGPI 2JZMA 1R79A 1TBNA 1KBFA 2ENNA 2W0TA 2LUYA 1DS2I 2L7XA 1AN1I 3KY9A 1TOTA 2ODDA 3SGBI 1SGQI 2JW6A 2LEOA 1TBRR 1IY6A 2ROWA 3E59A 3FC3A 2KCXA 2KMQA 2V53A 1XX6A 2GKVA 1CSOI 1KBEA 1SGEI 2QPOA 5CCMA 1M8BA 1XBTA 1U5KA 1PTRA 2ORWA 3OXFA 1KMAA 3UFFA 1X74A 2KMOA 1Z7KB 2OD1A 2YQPA 5EX0A 1BMOA 1LR7A 2ERWA 2DIPA 4UXHA 5CCLA 3E2IA 3VDPA 1R0RI 1OYVI 1YTPA 3UGLA 1PPFI 3SGQI 1TUSA 3CXLA 4HGUA 1SGDI 1H0ZA 3PDNA 1Y8FA 2NU1I 3MEKA 3VE5A 4SGBI 1PJUA 1CGJI 3TJQA 2KMPA 1N13A 2ENZA 4L9MA 2NU3I 2P6AC 2FNFX 2JA1A 1YU6C 4GI3C 1UVFA 1UUCA 3GOXA 1IW4A 1TIHA 1CT2I 3D00A 4B6DA 2WCYA 1TBQR 3VDUA 1TURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQ0 A;  2ORV A;  4UXH A;  3E2I A;  2VRW B;  1R79 A;  1TBN A;  3UEJ A;  5FUV A;  3UGL A;  2ENN A;  1KBF A;  1W4R A;  1XA6 A;  3CXL A;  1RFH A;  2QQE A;  3KY9 A;  1FAR A;  5FUW A;  1Y8F A;  2YUU A;  3BJI A;  5FUX A;  3UEY A;  2ROW A;  2J87 A;  1FAQ A;  2B8T A;  1PTQ A;  2ENZ A;  2WVJ A;  4L9M A;  1XX6 A;  2QPO A;  1KBE A;  2J9R A;  2FNF X;  1XBT A;  2JA1 A;  2ORW A;  1PTR A;  4UXJ A;  2UZ3 A;  3UFF A;  3UGI A;  4B6D A;  2ELI A;  2DB6 A;  4FKD A;  5FUY A;  3UGD A;  4UXI A;  1TBO A;  2E73 A;  2GVI A; 
#chains in the Genus database with same CATH topology
 1MT1 A;  1OVO A;  3TO7 A;  1W3S A;  1LR8 A;  3R5B A;  2OVO A;  5J8C A;  2VRW B;  2XRC A;  2BUS A;  2GKR I;  3HH2 C;  2V1C A;  3QAH A;  3OXL A;  1TGS I;  2RIJ A;  2N17 A;  2NU2 I;  2SGQ I;  3TO6 A;  3UEJ A;  2V1C C;  1XA6 A;  1SGN I;  2SGF I;  3SEK C;  2Y0M A;  2N52 A;  2M5X A;  3OVO A;  5J8F A;  1HJA I;  1OMU A;  2QQE A;  5E3R A;  3UOE A;  3TO9 A;  3BJI A;  2JYY A;  3UEY A;  2SGE I;  1V1I A;  1OMT A;  1NUB A;  4A24 A;  2J9R A;  9WGA A;  1X4S A;  1CT0 I;  1HPT A;  2A20 A;  1HDL A;  2F3C I;  1MJA A;  2ARP F;  1ULM A;  1CT4 I;  4JCV E;  1P9G A;  2ELI A;  2DB6 A;  5FUY A;  2E73 A;  3OL0 A;  2QQC A;  2WVJ A;  3R5C A;  4FKD A;  4E1P A;  2QQ0 A;  2ORV A;  2JXD A;  2SGD I;  1SGP I;  1FY7 A;  2E5R A;  2N1A B;  1MJ9 A;  2GIV A;  2CJS C;  1DS3 I;  1UVG A;  2NU4 I;  5E3P A;  5FUV A;  1W4R A;  2K9H A;  1RFH A;  1K7T A;  1FAR A;  1IY5 A;  3B4V C;  5FUW A;  3TOB A;  5DAE A;  2YUU A;  5JHW C;  2CWH A;  5FUX A;  2KMR A;  1UHA A;  3OXG A;  2J87 A;  4E1R A;  1CHO I;  1SGR I;  2B8T A;  2N71 A;  3QTL D;  1PTQ A;  2UVO A;  1FAQ A;  1Y1C A;  2QQD A;  1Y1B A;  4OVO A;  2B0U C;  2CWG A;  2NU0 I;  2L8E A;  3R5A A;  4UXJ A;  1CE3 A;  2UZ3 A;  1PCE A;  3QWP A;  1BUS A;  1V1H A;  1VDD A;  3UGI A;  1WGT A;  4DNC A;  1M8C A;  5HQ8 A;  5HI7 A;  3UGD A;  4UXI A;  1TBO A;  2GVI A;  3R5D A;  1SGY I;  2GKT I;  1FYB A;  5EX3 A;  1CGI I;  1LR9 A;  3RU0 A;  2SGP I;  1K7U A;  1WGC A;  1R79 A;  1TBN A;  2JZM A;  1KBF A;  2ENN A;  2W0T A;  2LUY A;  1DS2 I;  2L7X A;  2X52 A;  1AN1 I;  3KY9 A;  1TOT A;  2CWF A;  2ODD A;  3SGB I;  1SGQ I;  2PQ8 A;  2JW6 A;  3FSY A;  2LEO A;  1TBR R;  1IY6 A;  2ROW A;  5E3Q A;  3E59 A;  1ULK A;  1HEV A;  3FC3 A;  2KCX A;  4AML A;  2KMQ A;  4WP4 A;  2V53 A;  1XX6 A;  2GKV A;  1CSO I;  1KBE A;  1SGE I;  2LB7 A;  2QPO A;  5CCM A;  1M8B A;  1XBT A;  1K7V A;  1U5K A;  1PTR A;  2ORW A;  3OXF A;  1KMA A;  3UFF A;  1MJB A;  1X74 A;  2KMO A;  1Z7K B;  2OD1 A;  2YQP A;  1S20 A;  5EX0 A;  1BMO A;  1LR7 A;  2ERW A;  2DIP A;  4UXH A;  2X3T A;  5CCL A;  3E2I A;  3VDP A;  1WTJ A;  2OZU A;  1R0R I;  3FSX A;  1OYV I;  1YTP A;  3TOA A;  1PPF I;  3UGL A;  3SGQ I;  1TUS A;  3CXL A;  4HGU A;  2DKV A;  1SGD I;  1P9Z A;  1WKX A;  3PDN A;  1H0Z A;  1Y8F A;  2NU1 I;  3MEK A;  2RC4 A;  3VE5 A;  4SGB I;  1PJU A;  1CGJ I;  3TJQ A;  2KMP A;  2OU2 A;  1Z2I A;  1N13 A;  2ENZ A;  4L9M A;  2NU3 I;  2P6A C;  2FNF X;  2JA1 A;  1YU6 C;  2WGC A;  1NXU A;  4GI3 C;  1UVF A;  1UUC A;  4MPI A;  7WGA A;  3GOX A;  1IW4 A;  1TIH A;  1CT2 I;  3D00 A;  4B6D A;  1ULN A;  2WCY A;  1TBQ R;  3VDU A;  1Q9B A;  1TUR A; 
#chains in the Genus database with same CATH homology
 1MT1 A;  1OVO A;  1W3S A;  1LR8 A;  2OVO A;  2VRW B;  2XRC A;  2BUS A;  2GKR I;  3HH2 C;  2V1C A;  3OXL A;  1TGS I;  2SGQ I;  2N17 A;  2NU2 I;  3UEJ A;  2V1C C;  1XA6 A;  1SGN I;  2SGF I;  3SEK C;  3OVO A;  2N52 A;  2M5X A;  1HJA I;  1OMU A;  2QQE A;  3BJI A;  2JYY A;  3UEY A;  2SGE I;  1V1I A;  1OMT A;  1NUB A;  4A24 A;  2J9R A;  1X4S A;  1CT0 I;  1HPT A;  2A20 A;  1HDL A;  2F3C I;  2ARP F;  4JCV E;  1CT4 I;  2ELI A;  2DB6 A;  5FUY A;  2E73 A;  3OL0 A;  2QQC A;  2WVJ A;  4FKD A;  4E1P A;  2QQ0 A;  2ORV A;  2JXD A;  2SGD I;  1SGP I;  2E5R A;  2N1A B;  2CJS C;  1DS3 I;  1UVG A;  2NU4 I;  5FUV A;  1W4R A;  2K9H A;  1RFH A;  1FAR A;  1IY5 A;  3B4V C;  5FUW A;  5DAE A;  2YUU A;  5JHW C;  5FUX A;  2KMR A;  4E1R A;  3OXG A;  2J87 A;  1CHO I;  1SGR I;  2B8T A;  2N71 A;  3QTL D;  1PTQ A;  1FAQ A;  1Y1C A;  2QQD A;  1Y1B A;  4OVO A;  2B0U C;  2NU0 I;  2L8E A;  4UXJ A;  1CE3 A;  2UZ3 A;  1PCE A;  3QWP A;  1BUS A;  1V1H A;  1VDD A;  3UGI A;  5HQ8 A;  1M8C A;  5HI7 A;  3UGD A;  4UXI A;  1TBO A;  2GVI A;  1SGY I;  2GKT I;  1FYB A;  5EX3 A;  1CGI I;  1LR9 A;  3RU0 A;  2SGP I;  2JZM A;  1R79 A;  1TBN A;  1KBF A;  2ENN A;  2W0T A;  2LUY A;  1DS2 I;  2L7X A;  1AN1 I;  3KY9 A;  1TOT A;  2ODD A;  3SGB I;  1SGQ I;  2JW6 A;  2LEO A;  1TBR R;  1IY6 A;  2ROW A;  3E59 A;  3FC3 A;  2KCX A;  2KMQ A;  2V53 A;  1XX6 A;  2GKV A;  1CSO I;  1KBE A;  1SGE I;  2QPO A;  5CCM A;  1M8B A;  1XBT A;  1U5K A;  1PTR A;  2ORW A;  3OXF A;  1KMA A;  3UFF A;  1X74 A;  2KMO A;  1Z7K B;  2OD1 A;  2YQP A;  5EX0 A;  1BMO A;  1LR7 A;  2ERW A;  2DIP A;  4UXH A;  5CCL A;  3E2I A;  3VDP A;  1R0R I;  1OYV I;  1YTP A;  3UGL A;  1PPF I;  3SGQ I;  1TUS A;  3CXL A;  4HGU A;  1SGD I;  1H0Z A;  3PDN A;  1Y8F A;  2NU1 I;  3MEK A;  3VE5 A;  4SGB I;  1PJU A;  1CGJ I;  3TJQ A;  2KMP A;  1N13 A;  2ENZ A;  4L9M A;  2NU3 I;  2P6A C;  2FNF X;  2JA1 A;  1YU6 C;  4GI3 C;  1UVF A;  1UUC A;  3GOX A;  1IW4 A;  1TIH A;  1CT2 I;  3D00 A;  4B6D A;  2WCY A;  1TBQ R;  3VDU A;  1TUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...