1Y8FA

Solution structure of the munc13-1 c1-domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
51
structure length
51
Chain Sequence
QHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Intramolecular occlusion of the diacylglycerol-binding site in the C1 domain of munc13-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis,signaling protein
molecule keywords Unc-13 homolog A
total genus 5
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2004-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1y8fA00
4UXIA 3UEJA 1XA6A 2QPOA 1FAQA 2QQ0A 4UXJA 4UXHA 3UGLA 3KY9A 4FKDA 2FNFX 2B8TA 4B6DA 1TBNA 1FARA 2ROWA 3UEYA 1KBEA 2E73A 2YUUA 3CXLA 5FUVA 2QQEA 2DB6A 3E2IA 3UGDA 2ENNA 2ELIA 2ENZA 2VRWB 1XBTA 2WVJA 5FUWA 3BJIA 1TBOA 1W4RA 3UFFA 2UZ3A 1PTQA 1KBFA 1RFHA 5FUXA 1R79A 2J87A 2GVIA 4L9MA 2ORVA 2JA1A 1PTRA 2ORWA 2J9RA 5FUYA 3UGIA 1Y8FA 1XX6A
chains in the Genus database with same CATH superfamily
4UXIA 3UEJA 5CCLA 1FAQA 3TO9A 3UGLA 5E3RA 1TURA 2B8TA 2FNFX 4B6DA 2JYYA 5J8CA 1FARA 5J8FA 3D00A 1BUSA 2X3TA 5FUVA 1DS2I 1K7VA 3SGBI 2L8EA 2WGCA 2E5RA 2DKVA 2KMPA 2W0TA 5DAEA 3FSYA 3BJIA 4AMLA 1TBOA 1Z2IA 1IY5A 1TBRR 1IW4A 1HEVA 2KCXA 1DS3I 1Y1CA 1UVGA 2GKVA 1MJBA 1RFHA 1H0ZA 1R79A 2GVIA 2QQDA 1WKXA 3QWPA 1WGCA 4E1RA 4E1PA 2OZUA 2PQ8A 2X52A 1OYVI 2N1AB 2OD1A 2L7XA 5FUYA 1SGRI 1P9ZA 1Y8FA 1XX6A 2NU2I 5FUWA 1S20A 1LR7A 1XA6A 1MJAA 2OU2A 3R5DA 4UXJA 1OMUA 3KY9A 4FKDA 1MT1A 1TBQR 1U5KA 3OXLA 1Q9BA 1YTPA 4GI3C 3SGQI 5CCMA 2BUSA 2F3CI 2B0UC 1KBEA 2ROWA 1SGYI 1SGNI 1CT2I 1UHAA 2ARPF 2E73A 3CXLA 1CGJI 5HQ8A 3E2IA 1P9GA 1WGTA 3UOEA 1SGPI 2DIPA 2N17A 4OVOA 3UGDA 1CE3A 2ELIA 3TO7A 3FC3A 2M5XA 1CT4I 3VDUA 1W4RA 2UVOA 2P6AC 3OXFA 2CWHA 2NU0I 1CSOI 2UZ3A 1PTQA 1KBFA 3MEKA 5FUXA 4L9MA 1KMAA 1PPFI 1TGSI 2KMRA 5EX3A 1YU6C 2JA1A 5EX0A 1V1HA 2YQPA 3UGIA 1UVFA 2JXDA 4HGUA 3GOXA 2QPOA 3HH2C 1SGQI 1X4SA 2QQ0A 2V1CC 4UXHA 1CHOI 4MPIA 5E3QA 1MJ9A 1TBNA 3TOAA 3SEKC 1LR9A 1OMTA 2SGFI 3QTLD 1K7TA 1PCEA 1UUCA 2SGQI 3TOBA 1TOTA 2GKTI 5JHWC 1TIHA 2CJSC 2CWFA 2GKRI 2N71A 1Z7KB 2ENNA 1WTJA 2ENZA 2NU3I 2KMOA 3R5AA 2NU1I 1OVOA 3FSXA 4WP4A 2K9HA 3VDPA 3UFFA 1Y1BA 4JCVE 1TUSA 2J87A 1NUBA 1HPTA 1CGII 1PJUA 1ULNA 2Y0MA 3PDNA 2KMQA 1VDDA 1K7UA 1FYBA 2OVOA 1N13A 3E59A 1AN1I 2SGPI 3QAHA 1HDLA 2CWGA 3OVOA 2SGEI 1HJAI 3OL0A 2LUYA 3TJQA 3TO6A 5HI7A 1IY6A 2LEOA 2SGDI 2V53A 3UEYA 2YUUA 1V1IA 2QQEA 2WCYA 9WGAA 1LR8A 1SGEI 2DB6A 1W3SA 2RIJA 3R5BA 3VE5A 3R5CA 1X74A 2QQCA 5E3PA 2RC4A 1BMOA 1R0RI 1XBTA 2VRWB 2WVJA 1M8BA 7WGAA 2JW6A 4DNCA 2V1CA 1FY7A 2LB7A 1CT0I 2A20A 1ULMA 1M8CA 2GIVA 1SGDI 2JZMA 1NXUA 2N52A 2ERWA 2NU4I 2ORVA 3B4VC 1PTRA 2ODDA 2ORWA 2J9RA 2XRCA 3OXGA 4SGBI 1ULKA 3RU0A 4A24A
chains in the Genus database with same CATH topology
4UXIA 3UEJA 5CCLA 1FAQA 3UGLA 1TURA 2B8TA 2FNFX 4B6DA 2JYYA 1FARA 3D00A 1BUSA 5FUVA 1DS2I 3SGBI 2L8EA 2E5RA 2KMPA 2W0TA 5DAEA 3BJIA 1TBOA 1IY5A 1TBRR 1IW4A 2KCXA 1DS3I 1Y1CA 1UVGA 2GKVA 1H0ZA 1RFHA 1R79A 2GVIA 2QQDA 3QWPA 4E1RA 4E1PA 1OYVI 2N1AB 2OD1A 2L7XA 5FUYA 1SGRI 1Y8FA 1XX6A 2NU2I 5FUWA 1LR7A 1XA6A 4UXJA 1OMUA 3KY9A 4FKDA 1MT1A 1TBQR 1U5KA 3OXLA 5CCMA 1YTPA 4GI3C 3SGQI 2BUSA 2F3CI 2B0UC 1KBEA 2ROWA 1SGYI 1SGNI 1CT2I 2ARPF 2E73A 3CXLA 5HQ8A 1CGJI 3E2IA 1SGPI 2DIPA 2N17A 4OVOA 3UGDA 1CE3A 2ELIA 3FC3A 2M5XA 1CT4I 3VDUA 1W4RA 2P6AC 3OXFA 2NU0I 1CSOI 2UZ3A 1PTQA 1KBFA 3MEKA 5FUXA 4L9MA 1KMAA 1PPFI 1TGSI 2KMRA 5EX3A 1YU6C 2JA1A 5EX0A 1V1HA 2YQPA 3UGIA 1UVFA 2JXDA 4HGUA 3GOXA 2QPOA 3HH2C 1SGQI 1X4SA 2QQ0A 2V1CC 4UXHA 1CHOI 1TBNA 3SEKC 1LR9A 1OMTA 2SGFI 3QTLD 1PCEA 1UUCA 2SGQI 1TOTA 2GKTI 5JHWC 1TIHA 2CJSC 2GKRI 2N71A 1Z7KB 2ENNA 2ENZA 2NU3I 2KMOA 2NU1I 1OVOA 2K9HA 3VDPA 3UFFA 1Y1BA 4JCVE 1TUSA 2J87A 1NUBA 1HPTA 1CGII 1PJUA 3PDNA 2KMQA 1VDDA 1FYBA 2OVOA 1N13A 3E59A 1AN1I 2SGPI 1HDLA 3OVOA 2SGEI 1HJAI 3OL0A 2LUYA 3TJQA 5HI7A 1IY6A 2LEOA 3UEYA 2V53A 2YUUA 1V1IA 2QQEA 2WCYA 1LR8A 1SGEI 2DB6A 1W3SA 3VE5A 1X74A 2QQCA 1BMOA 1R0RI 1XBTA 2VRWB 2WVJA 1M8BA 2JW6A 2V1CA 1CT0I 2A20A 2JZMA 1M8CA 2N52A 1SGDI 2ORVA 2ERWA 2NU4I 3B4VC 1PTRA 2ODDA 2ORWA 2J9RA 2XRCA 3OXGA 4SGBI 2SGDI 3RU0A 4A24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UXI A;  3UEJ A;  1XA6 A;  2QPO A;  1FAQ A;  2QQ0 A;  4UXJ A;  4UXH A;  3UGL A;  3KY9 A;  4FKD A;  2FNF X;  2B8T A;  4B6D A;  1TBN A;  1FAR A;  2ROW A;  3UEY A;  1KBE A;  2E73 A;  2YUU A;  3CXL A;  5FUV A;  2QQE A;  2DB6 A;  3E2I A;  3UGD A;  2ENN A;  2ELI A;  2ENZ A;  2VRW B;  1XBT A;  2WVJ A;  5FUW A;  3BJI A;  1TBO A;  1W4R A;  3UFF A;  2UZ3 A;  1PTQ A;  1KBF A;  1RFH A;  5FUX A;  1R79 A;  2J87 A;  2GVI A;  4L9M A;  2ORV A;  2JA1 A;  1PTR A;  2ORW A;  2J9R A;  5FUY A;  3UGI A;  1Y8F A;  1XX6 A; 
#chains in the Genus database with same CATH topology
 4UXI A;  3UEJ A;  5CCL A;  1FAQ A;  3TO9 A;  3UGL A;  5E3R A;  1TUR A;  2B8T A;  2FNF X;  4B6D A;  2JYY A;  5J8C A;  1FAR A;  5J8F A;  3D00 A;  1BUS A;  2X3T A;  5FUV A;  1DS2 I;  1K7V A;  3SGB I;  2L8E A;  2WGC A;  2E5R A;  2DKV A;  2KMP A;  2W0T A;  5DAE A;  3FSY A;  3BJI A;  4AML A;  1TBO A;  1Z2I A;  1IY5 A;  1TBR R;  1IW4 A;  1HEV A;  2KCX A;  1DS3 I;  1Y1C A;  1UVG A;  2GKV A;  1MJB A;  1RFH A;  1H0Z A;  1R79 A;  2GVI A;  2QQD A;  1WKX A;  3QWP A;  1WGC A;  4E1R A;  4E1P A;  2OZU A;  2PQ8 A;  2X52 A;  1OYV I;  2N1A B;  2OD1 A;  2L7X A;  5FUY A;  1SGR I;  1P9Z A;  1Y8F A;  1XX6 A;  2NU2 I;  5FUW A;  1S20 A;  1LR7 A;  1XA6 A;  1MJA A;  2OU2 A;  3R5D A;  4UXJ A;  1OMU A;  3KY9 A;  4FKD A;  1MT1 A;  1TBQ R;  1U5K A;  3OXL A;  1Q9B A;  1YTP A;  4GI3 C;  3SGQ I;  5CCM A;  2BUS A;  2F3C I;  2B0U C;  1KBE A;  2ROW A;  1SGY I;  1SGN I;  1CT2 I;  1UHA A;  2ARP F;  2E73 A;  3CXL A;  1CGJ I;  5HQ8 A;  3E2I A;  1P9G A;  1WGT A;  3UOE A;  1SGP I;  2DIP A;  2N17 A;  4OVO A;  3UGD A;  1CE3 A;  2ELI A;  3TO7 A;  3FC3 A;  2M5X A;  1CT4 I;  3VDU A;  1W4R A;  2UVO A;  2P6A C;  3OXF A;  2CWH A;  2NU0 I;  1CSO I;  2UZ3 A;  1PTQ A;  1KBF A;  3MEK A;  5FUX A;  4L9M A;  1KMA A;  1PPF I;  1TGS I;  2KMR A;  5EX3 A;  1YU6 C;  2JA1 A;  5EX0 A;  1V1H A;  2YQP A;  3UGI A;  1UVF A;  2JXD A;  4HGU A;  3GOX A;  2QPO A;  3HH2 C;  1SGQ I;  1X4S A;  2QQ0 A;  2V1C C;  4UXH A;  1CHO I;  4MPI A;  5E3Q A;  1MJ9 A;  1TBN A;  3TOA A;  3SEK C;  1LR9 A;  1OMT A;  2SGF I;  3QTL D;  1K7T A;  1PCE A;  1UUC A;  2SGQ I;  3TOB A;  1TOT A;  2GKT I;  5JHW C;  1TIH A;  2CJS C;  2CWF A;  2GKR I;  2N71 A;  1Z7K B;  2ENN A;  1WTJ A;  2ENZ A;  2NU3 I;  2KMO A;  3R5A A;  2NU1 I;  1OVO A;  3FSX A;  4WP4 A;  2K9H A;  3VDP A;  3UFF A;  1Y1B A;  4JCV E;  1TUS A;  2J87 A;  1NUB A;  1HPT A;  1CGI I;  1PJU A;  1ULN A;  2Y0M A;  3PDN A;  2KMQ A;  1VDD A;  1K7U A;  1FYB A;  2OVO A;  1N13 A;  3E59 A;  1AN1 I;  2SGP I;  3QAH A;  1HDL A;  2CWG A;  3OVO A;  2SGE I;  1HJA I;  3OL0 A;  2LUY A;  3TJQ A;  3TO6 A;  5HI7 A;  1IY6 A;  2LEO A;  2SGD I;  2V53 A;  3UEY A;  2YUU A;  1V1I A;  2QQE A;  2WCY A;  9WGA A;  1LR8 A;  1SGE I;  2DB6 A;  1W3S A;  2RIJ A;  3R5B A;  3VE5 A;  3R5C A;  1X74 A;  2QQC A;  5E3P A;  2RC4 A;  1BMO A;  1R0R I;  1XBT A;  2VRW B;  2WVJ A;  1M8B A;  7WGA A;  2JW6 A;  4DNC A;  2V1C A;  1FY7 A;  2LB7 A;  1CT0 I;  2A20 A;  1ULM A;  1M8C A;  2GIV A;  1SGD I;  2JZM A;  1NXU A;  2N52 A;  2ERW A;  2NU4 I;  2ORV A;  3B4V C;  1PTR A;  2ODD A;  2ORW A;  2J9R A;  2XRC A;  3OXG A;  4SGB I;  1ULK A;  3RU0 A;  4A24 A; 
#chains in the Genus database with same CATH homology
 4UXI A;  3UEJ A;  5CCL A;  1FAQ A;  3UGL A;  1TUR A;  2B8T A;  2FNF X;  4B6D A;  2JYY A;  1FAR A;  3D00 A;  1BUS A;  5FUV A;  1DS2 I;  3SGB I;  2L8E A;  2E5R A;  2KMP A;  2W0T A;  5DAE A;  3BJI A;  1TBO A;  1IY5 A;  1TBR R;  1IW4 A;  2KCX A;  1DS3 I;  1Y1C A;  1UVG A;  2GKV A;  1H0Z A;  1RFH A;  1R79 A;  2GVI A;  2QQD A;  3QWP A;  4E1R A;  4E1P A;  1OYV I;  2N1A B;  2OD1 A;  2L7X A;  5FUY A;  1SGR I;  1Y8F A;  1XX6 A;  2NU2 I;  5FUW A;  1LR7 A;  1XA6 A;  4UXJ A;  1OMU A;  3KY9 A;  4FKD A;  1MT1 A;  1TBQ R;  1U5K A;  3OXL A;  5CCM A;  1YTP A;  4GI3 C;  3SGQ I;  2BUS A;  2F3C I;  2B0U C;  1KBE A;  2ROW A;  1SGY I;  1SGN I;  1CT2 I;  2ARP F;  2E73 A;  3CXL A;  5HQ8 A;  1CGJ I;  3E2I A;  1SGP I;  2DIP A;  2N17 A;  4OVO A;  3UGD A;  1CE3 A;  2ELI A;  3FC3 A;  2M5X A;  1CT4 I;  3VDU A;  1W4R A;  2P6A C;  3OXF A;  2NU0 I;  1CSO I;  2UZ3 A;  1PTQ A;  1KBF A;  3MEK A;  5FUX A;  4L9M A;  1KMA A;  1PPF I;  1TGS I;  2KMR A;  5EX3 A;  1YU6 C;  2JA1 A;  5EX0 A;  1V1H A;  2YQP A;  3UGI A;  1UVF A;  2JXD A;  4HGU A;  3GOX A;  2QPO A;  3HH2 C;  1SGQ I;  1X4S A;  2QQ0 A;  2V1C C;  4UXH A;  1CHO I;  1TBN A;  3SEK C;  1LR9 A;  1OMT A;  2SGF I;  3QTL D;  1PCE A;  1UUC A;  2SGQ I;  1TOT A;  2GKT I;  5JHW C;  1TIH A;  2CJS C;  2GKR I;  2N71 A;  1Z7K B;  2ENN A;  2ENZ A;  2NU3 I;  2KMO A;  2NU1 I;  1OVO A;  2K9H A;  3VDP A;  3UFF A;  1Y1B A;  4JCV E;  1TUS A;  2J87 A;  1NUB A;  1HPT A;  1CGI I;  1PJU A;  3PDN A;  2KMQ A;  1VDD A;  1FYB A;  2OVO A;  1N13 A;  3E59 A;  1AN1 I;  2SGP I;  1HDL A;  3OVO A;  2SGE I;  1HJA I;  3OL0 A;  2LUY A;  3TJQ A;  5HI7 A;  1IY6 A;  2LEO A;  3UEY A;  2V53 A;  2YUU A;  1V1I A;  2QQE A;  2WCY A;  1LR8 A;  1SGE I;  2DB6 A;  1W3S A;  3VE5 A;  1X74 A;  2QQC A;  1BMO A;  1R0R I;  1XBT A;  2VRW B;  2WVJ A;  1M8B A;  2JW6 A;  2V1C A;  1CT0 I;  2A20 A;  2JZM A;  1M8C A;  2N52 A;  1SGD I;  2ORV A;  2ERW A;  2NU4 I;  3B4V C;  1PTR A;  2ODD A;  2ORW A;  2J9R A;  2XRC A;  3OXG A;  4SGB I;  2SGD I;  3RU0 A;  4A24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...