1Y8FA

Solution structure of the munc13-1 c1-domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
51
structure length
51
Chain Sequence
QHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Unc-13 homolog A
publication title Intramolecular occlusion of the diacylglycerol-binding site in the C1 domain of munc13-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis,signaling protein
total genus 5
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2004-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1y8fA00
2J87A 2ORVA 2WVJA 2YUUA 1PTRA 4UXHA 5FUWA 4B6DA 2GVIA 1XX6A 2JA1A 3BJIA 2QPOA 1FARA 3CXLA 2B8TA 1Y8FA 2VRWB 5FUVA 1TBNA 4FKDA 2QQEA 1XBTA 2DB6A 2UZ3A 3UGDA 1XA6A 1RFHA 4UXIA 4L9MA 3UEYA 4UXJA 3UFFA 1R79A 3UEJA 3UGLA 1W4RA 1KBFA 5FUYA 2ELIA 2QQ0A 3E2IA 5FUXA 1KBEA 2E73A 2ORWA 2J9RA 2FNFX 2ROWA 2ENNA 3UGIA 2ENZA 1FAQA 1PTQA 3KY9A 1TBOA
chains in the Genus database with same CATH superfamily
1CT2I 1N13A 1WTJA 1SGDI 2BUSA 3BJIA 2QPOA 1SGYI 3QTLD 1SGEI 5HI7A 3MEKA 4FKDA 2QQEA 2NU2I 1BUSA 1FAQA 1OVOA 2P6AC 1HJAI 2DB6A 3R5BA 2LB7A 1DS2I 4UXIA 1UUCA 3OXGA 3OXLA 2RC4A 1CHOI 1R79A 2SGFI 2WCYA 2KMOA 5FUYA 2CWFA 3SEKC 1KBFA 1PJUA 2ARPF 2SGPI 3E2IA 2QQ0A 3RU0A 5HQ8A 2J9RA 1ULNA 2V1CC 2YQPA 1ULMA 2ROWA 5E3RA 5EX3A 1LR7A 1SGQI 2CJSC 4OVOA 5CCLA 1AN1I 1PTQA 3TOBA 1WKXA 3VDPA 2ERWA 1TBOA 1VDDA 2YUUA 5EX0A 3VDUA 5FUWA 1DS3I 4UXHA 1K7VA 1CGJI 2QQCA 3UOEA 1UVGA 5J8FA 1TIHA 2K9HA 3TO9A 1FARA 3GOXA 1Y8FA 2B8TA 2PQ8A 3R5DA 3TJQA 1U5KA 5CCMA 1NXUA 3FSXA 1FYBA 2X3TA 1OMTA 2GKVA 7WGAA 1P9GA 1NUBA 1M8BA 1XA6A 1RFHA 5JHWC 2OU2A 4L9MA 3VE5A 1KMAA 3OVOA 2A20A 5DAEA 3UGLA 1W4RA 3TO7A 1K7TA 1SGNI 2ELIA 2F3CI 1WGTA 1MJ9A 2GKRI 3D00A 1CGII 5FUXA 1IY6A 2QQDA 2L8EA 1LR9A 1Z7KB 2ENNA 1FY7A 2ENZA 2KMPA 4A24A 4E1PA 1CT4I 1TUSA 2V53A 3SGQI 3FC3A 1H0ZA 2JW6A 1HPTA 3QAHA 2J87A 2WVJA 3R5CA 2JZMA 4E1RA 1P9ZA 1YU6C 2GVIA 1SGRI 1MJBA 2DIPA 2CWGA 1UVFA 1Y1BA 2VRWB 1Z2IA 2DKVA 3CXLA 3OXFA 1HDLA 2NU1I 2X52A 5E3QA 4WP4A 1X4SA 1XBTA 3B4VC 3PDNA 1V1IA 2JXDA 2OZUA 2SGDI 2UZ3A 1LR8A 1OMUA 2N71A 1ULKA 1WGCA 2E5RA 1R0RI 3UFFA 1CE3A 1OYVI 1S20A 2OVOA 4GI3C 2LEOA 1KBEA 1PPFI 1TGSI 2B0UC 1K7UA 2CWHA 2E73A 2ORWA 3HH2C 3UGIA 2SGQI 2N52A 2GIVA 1IY5A 2UVOA 1Y1CA 2SGEI 3KY9A 2L7XA 2ORVA 2NU4I 2WGCA 1PTRA 1TOTA 2M5XA 4SGBI 4B6DA 2N1AB 1XX6A 2JA1A 2KMRA 2Y0MA 1M8CA 1TURA 1MT1A 5FUVA 1MJAA 1TBNA 2GKTI 1V1HA 3FSYA 3QWPA 3SGBI 3TO6A 4DNCA 1TBQR 2OD1A 2KMQA 1X74A 1HEVA 2JYYA 2V1CA 1TBRR 2NU0I 2RIJA 3UGDA 9WGAA 2NU3I 4AMLA 1Q9BA 3UEYA 1UHAA 1YTPA 2XRCA 3E59A 5J8CA 3UEJA 1PCEA 1SGPI 1CSOI 1IW4A 4JCVE 1W3SA 1CT0I 2KCXA 4MPIA 3TOAA 2FNFX 2W0TA 3OL0A 3R5AA 2N17A 2LUYA 2ODDA 4HGUA 1BMOA 5E3PA 4UXJA
chains in the Genus database with same CATH topology
1CT2I 1N13A 1SGDI 2BUSA 3BJIA 2QPOA 1SGYI 3QTLD 1SGEI 5HI7A 3MEKA 4FKDA 2QQEA 2NU2I 1BUSA 1OVOA 2P6AC 1HJAI 2DB6A 1DS2I 4UXIA 1UUCA 3OXGA 3OXLA 1CHOI 1R79A 2SGFI 2WCYA 2KMOA 5FUYA 3SEKC 1KBFA 1PJUA 2ARPF 2SGPI 3E2IA 2QQ0A 3RU0A 5HQ8A 2J9RA 2V1CC 2YQPA 5EX3A 5EX0A 2ROWA 5CCLA 1LR7A 1SGQI 2CJSC 4OVOA 1AN1I 1PTQA 3VDPA 2ERWA 1TBOA 1VDDA 2YUUA 3VDUA 5FUWA 1DS3I 4UXHA 2QQCA 1CGJI 1UVGA 1TIHA 2K9HA 1FARA 3GOXA 1Y8FA 2B8TA 3TJQA 1U5KA 5CCMA 1FYBA 1OMTA 2GKVA 1NUBA 1M8BA 1XA6A 1RFHA 5JHWC 4L9MA 3VE5A 1KMAA 3OVOA 2A20A 5DAEA 3UGLA 1W4RA 1SGNI 2ELIA 2F3CI 2GKRI 3D00A 5FUXA 1CGII 1IY6A 2QQDA 2L8EA 1LR9A 1Z7KB 2ENNA 2KMPA 2ENZA 4A24A 4E1PA 1FAQA 1CT4I 1TUSA 2V53A 3SGQI 3FC3A 1H0ZA 2JW6A 1HPTA 2J87A 2WVJA 2JZMA 4E1RA 1YU6C 2GVIA 1SGRI 2DIPA 3CXLA 1UVFA 1Y1BA 2VRWB 3OXFA 1HDLA 2NU1I 1X4SA 1XBTA 3B4VC 3PDNA 1V1IA 2JXDA 2SGDI 2UZ3A 1LR8A 1OMUA 2N71A 2E5RA 1R0RI 3UFFA 1CE3A 1OYVI 2OVOA 4GI3C 2LEOA 1KBEA 1PPFI 1TGSI 2B0UC 2E73A 2ORWA 3HH2C 3UGIA 2SGQI 2N52A 1IY5A 1Y1CA 2SGEI 3KY9A 2L7XA 2ORVA 2NU4I 1PTRA 1TOTA 2M5XA 4SGBI 4B6DA 2N1AB 1XX6A 2JA1A 2KMRA 1M8CA 1TURA 1MT1A 5FUVA 1TBNA 3QWPA 2GKTI 1V1HA 3SGBI 1TBQR 2OD1A 2KMQA 1X74A 2JYYA 2V1CA 1TBRR 2NU0I 3UGDA 2NU3I 3UEYA 2XRCA 1YTPA 3E59A 3UEJA 1PCEA 1SGPI 1CSOI 1IW4A 4JCVE 1W3SA 1CT0I 2KCXA 2FNFX 2W0TA 3OL0A 2N17A 2LUYA 2ODDA 4HGUA 1BMOA 4UXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J87 A;  2ORV A;  2WVJ A;  2YUU A;  1PTR A;  4UXH A;  5FUW A;  4B6D A;  2GVI A;  1XX6 A;  2JA1 A;  3BJI A;  2QPO A;  1FAR A;  3CXL A;  2B8T A;  1Y8F A;  2VRW B;  5FUV A;  1TBN A;  4FKD A;  2QQE A;  1XBT A;  2DB6 A;  2UZ3 A;  3UGD A;  1XA6 A;  1RFH A;  4UXI A;  4L9M A;  3UEY A;  4UXJ A;  3UFF A;  1R79 A;  3UEJ A;  3UGL A;  1W4R A;  1KBF A;  5FUY A;  2ELI A;  2QQ0 A;  3E2I A;  5FUX A;  1KBE A;  2E73 A;  2ORW A;  2J9R A;  2FNF X;  2ROW A;  2ENN A;  3UGI A;  2ENZ A;  1FAQ A;  1PTQ A;  3KY9 A;  1TBO A; 
#chains in the Genus database with same CATH topology
 1CT2 I;  1N13 A;  1WTJ A;  1SGD I;  2BUS A;  3BJI A;  2QPO A;  1SGY I;  3QTL D;  1SGE I;  5HI7 A;  3MEK A;  4FKD A;  2QQE A;  2NU2 I;  1BUS A;  1FAQ A;  1OVO A;  2P6A C;  1HJA I;  2DB6 A;  3R5B A;  2LB7 A;  1DS2 I;  4UXI A;  1UUC A;  3OXG A;  3OXL A;  2RC4 A;  1CHO I;  1R79 A;  2SGF I;  2WCY A;  2KMO A;  5FUY A;  2CWF A;  3SEK C;  1KBF A;  1PJU A;  2ARP F;  2SGP I;  3E2I A;  2QQ0 A;  3RU0 A;  5HQ8 A;  2J9R A;  1ULN A;  2V1C C;  2YQP A;  1ULM A;  2ROW A;  5E3R A;  5EX3 A;  1LR7 A;  1SGQ I;  2CJS C;  4OVO A;  5CCL A;  1AN1 I;  1PTQ A;  3TOB A;  1WKX A;  3VDP A;  2ERW A;  1TBO A;  1VDD A;  2YUU A;  5EX0 A;  3VDU A;  5FUW A;  1DS3 I;  4UXH A;  1K7V A;  1CGJ I;  2QQC A;  3UOE A;  1UVG A;  5J8F A;  1TIH A;  2K9H A;  3TO9 A;  1FAR A;  3GOX A;  1Y8F A;  2B8T A;  2PQ8 A;  3R5D A;  3TJQ A;  1U5K A;  5CCM A;  1NXU A;  3FSX A;  1FYB A;  2X3T A;  1OMT A;  2GKV A;  7WGA A;  1P9G A;  1NUB A;  1M8B A;  1XA6 A;  1RFH A;  5JHW C;  2OU2 A;  4L9M A;  3VE5 A;  1KMA A;  3OVO A;  2A20 A;  5DAE A;  3UGL A;  1W4R A;  3TO7 A;  1K7T A;  1SGN I;  2ELI A;  2F3C I;  1WGT A;  1MJ9 A;  2GKR I;  3D00 A;  1CGI I;  5FUX A;  1IY6 A;  2QQD A;  2L8E A;  1LR9 A;  1Z7K B;  2ENN A;  1FY7 A;  2ENZ A;  2KMP A;  4A24 A;  4E1P A;  1CT4 I;  1TUS A;  2V53 A;  3SGQ I;  3FC3 A;  1H0Z A;  2JW6 A;  1HPT A;  3QAH A;  2J87 A;  2WVJ A;  3R5C A;  2JZM A;  4E1R A;  1P9Z A;  1YU6 C;  2GVI A;  1SGR I;  1MJB A;  2DIP A;  2CWG A;  1UVF A;  1Y1B A;  2VRW B;  1Z2I A;  2DKV A;  3CXL A;  3OXF A;  1HDL A;  2NU1 I;  2X52 A;  5E3Q A;  4WP4 A;  1X4S A;  1XBT A;  3B4V C;  3PDN A;  1V1I A;  2JXD A;  2OZU A;  2SGD I;  2UZ3 A;  1LR8 A;  1OMU A;  2N71 A;  1ULK A;  1WGC A;  2E5R A;  1R0R I;  3UFF A;  1CE3 A;  1OYV I;  1S20 A;  2OVO A;  4GI3 C;  2LEO A;  1KBE A;  1PPF I;  1TGS I;  2B0U C;  1K7U A;  2CWH A;  2E73 A;  2ORW A;  3HH2 C;  3UGI A;  2SGQ I;  2N52 A;  2GIV A;  1IY5 A;  2UVO A;  1Y1C A;  2SGE I;  3KY9 A;  2L7X A;  2ORV A;  2NU4 I;  2WGC A;  1PTR A;  1TOT A;  2M5X A;  4SGB I;  4B6D A;  2N1A B;  1XX6 A;  2JA1 A;  2KMR A;  2Y0M A;  1M8C A;  1TUR A;  1MT1 A;  5FUV A;  1MJA A;  1TBN A;  2GKT I;  1V1H A;  3FSY A;  3QWP A;  3SGB I;  3TO6 A;  4DNC A;  1TBQ R;  2OD1 A;  2KMQ A;  1X74 A;  1HEV A;  2JYY A;  2V1C A;  1TBR R;  2NU0 I;  2RIJ A;  3UGD A;  9WGA A;  2NU3 I;  4AML A;  1Q9B A;  3UEY A;  1UHA A;  1YTP A;  2XRC A;  3E59 A;  5J8C A;  3UEJ A;  1PCE A;  1SGP I;  1CSO I;  1IW4 A;  4JCV E;  1W3S A;  1CT0 I;  2KCX A;  4MPI A;  3TOA A;  2FNF X;  2W0T A;  3OL0 A;  3R5A A;  2N17 A;  2LUY A;  2ODD A;  4HGU A;  1BMO A;  5E3P A;  4UXJ A; 
#chains in the Genus database with same CATH homology
 1CT2 I;  1N13 A;  1SGD I;  2BUS A;  3BJI A;  2QPO A;  1SGY I;  3QTL D;  1SGE I;  5HI7 A;  3MEK A;  4FKD A;  2QQE A;  2NU2 I;  1BUS A;  1OVO A;  2P6A C;  1HJA I;  2DB6 A;  1DS2 I;  4UXI A;  1UUC A;  3OXG A;  3OXL A;  1CHO I;  1R79 A;  2SGF I;  2WCY A;  2KMO A;  5FUY A;  3SEK C;  1KBF A;  1PJU A;  2ARP F;  2SGP I;  3E2I A;  2QQ0 A;  3RU0 A;  5HQ8 A;  2J9R A;  2V1C C;  2YQP A;  5EX3 A;  5EX0 A;  2ROW A;  5CCL A;  1LR7 A;  1SGQ I;  2CJS C;  4OVO A;  1AN1 I;  1PTQ A;  3VDP A;  2ERW A;  1TBO A;  1VDD A;  2YUU A;  3VDU A;  5FUW A;  1DS3 I;  4UXH A;  2QQC A;  1CGJ I;  1UVG A;  1TIH A;  2K9H A;  1FAR A;  3GOX A;  1Y8F A;  2B8T A;  3TJQ A;  1U5K A;  5CCM A;  1FYB A;  1OMT A;  2GKV A;  1NUB A;  1M8B A;  1XA6 A;  1RFH A;  5JHW C;  4L9M A;  3VE5 A;  1KMA A;  3OVO A;  2A20 A;  5DAE A;  3UGL A;  1W4R A;  1SGN I;  2ELI A;  2F3C I;  2GKR I;  3D00 A;  5FUX A;  1CGI I;  1IY6 A;  2QQD A;  2L8E A;  1LR9 A;  1Z7K B;  2ENN A;  2KMP A;  2ENZ A;  4A24 A;  4E1P A;  1FAQ A;  1CT4 I;  1TUS A;  2V53 A;  3SGQ I;  3FC3 A;  1H0Z A;  2JW6 A;  1HPT A;  2J87 A;  2WVJ A;  2JZM A;  4E1R A;  1YU6 C;  2GVI A;  1SGR I;  2DIP A;  3CXL A;  1UVF A;  1Y1B A;  2VRW B;  3OXF A;  1HDL A;  2NU1 I;  1X4S A;  1XBT A;  3B4V C;  3PDN A;  1V1I A;  2JXD A;  2SGD I;  2UZ3 A;  1LR8 A;  1OMU A;  2N71 A;  2E5R A;  1R0R I;  3UFF A;  1CE3 A;  1OYV I;  2OVO A;  4GI3 C;  2LEO A;  1KBE A;  1PPF I;  1TGS I;  2B0U C;  2E73 A;  2ORW A;  3HH2 C;  3UGI A;  2SGQ I;  2N52 A;  1IY5 A;  1Y1C A;  2SGE I;  3KY9 A;  2L7X A;  2ORV A;  2NU4 I;  1PTR A;  1TOT A;  2M5X A;  4SGB I;  4B6D A;  2N1A B;  1XX6 A;  2JA1 A;  2KMR A;  1M8C A;  1TUR A;  1MT1 A;  5FUV A;  1TBN A;  3QWP A;  2GKT I;  1V1H A;  3SGB I;  1TBQ R;  2OD1 A;  2KMQ A;  1X74 A;  2JYY A;  2V1C A;  1TBR R;  2NU0 I;  3UGD A;  2NU3 I;  3UEY A;  2XRC A;  1YTP A;  3E59 A;  3UEJ A;  1PCE A;  1SGP I;  1CSO I;  1IW4 A;  4JCV E;  1W3S A;  1CT0 I;  2KCX A;  2FNF X;  2W0T A;  3OL0 A;  2N17 A;  2LUY A;  2ODD A;  4HGU A;  1BMO A;  4UXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...