1Y8FA

Solution structure of the munc13-1 c1-domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
51
structure length
51
Chain Sequence
QHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis,signaling protein
molecule keywords Unc-13 homolog A
publication title Intramolecular occlusion of the diacylglycerol-binding site in the C1 domain of munc13-1.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 5
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2004-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1y8fA00
2ELIA 2J9RA 3E2IA 3CXLA 2J87A 1TBOA 1Y8FA 2ORWA 2YUUA 1KBEA 3UGLA 2JA1A 3KY9A 3UEYA 2VRWB 4FKDA 3UGDA 4UXJA 1R79A 2WVJA 2FNFX 2E73A 4UXHA 2ROWA 5FUXA 1XA6A 2ENNA 2ORVA 4B6DA 4UXIA 2DB6A 5FUYA 1FARA 2UZ3A 1PTQA 1TBNA 2B8TA 2GVIA 1RFHA 2QQ0A 3UFFA 1XBTA 1KBFA 1PTRA 2QQEA 2QPOA 4L9MA 1FAQA 5FUVA 2ENZA 5FUWA 3BJIA 1XX6A 3UEJA 1W4RA 3UGIA
chains in the Genus database with same CATH superfamily
2ELIA 1TBRR 1CT0I 3VE5A 1K7VA 1S20A 3R5DA 1TBOA 1FYBA 1Y1BA 2QQCA 1CT4I 3KY9A 1SGEI 1HPTA 3UEYA 1SGDI 3UGDA 1IY6A 1SGRI 3OXLA 5E3QA 3TO9A 2KCXA 2NU0I 2ODDA 1CT2I 1HDLA 2UVOA 2WGCA 4UXIA 2W0TA 1X74A 3D00A 1FARA 1W3SA 1OVOA 1R0RI 2WCYA 1WTJA 4A24A 3RU0A 2GKRI 4L9MA 5HI7A 2QQDA 3SEKC 1U5KA 5CCLA 1SGQI 1IW4A 2L7XA 3UEJA 2OU2A 1CGII 3OXFA 1BMOA 9WGAA 1UVGA 1DS3I 3OXGA 5E3PA 1YU6C 2NU1I 3HH2C 1Z2IA 2A20A 1SGYI 1Z7KB 2NU2I 3FC3A 2LEOA 4JCVE 2JZMA 2J87A 1Y8FA 1MJ9A 1P9ZA 1KBEA 2K9HA 3UOEA 1PPFI 1Q9BA 3SGBI 3GOXA 1M8CA 2VRWB 2SGEI 4FKDA 5J8FA 1R79A 2Y0MA 1WGCA 2BUSA 4UXHA 3SGQI 1PCEA 1XA6A 1M8BA 1TUSA 2ENNA 2ORVA 2XRCA 5EX3A 1OMTA 2DB6A 2L8EA 4OVOA 3TOAA 1ULMA 1TOTA 5J8CA 1PTQA 1TBNA 2GVIA 3QWPA 2GIVA 1KMAA 1V1IA 2JXDA 1OYVI 1UHAA 1TURA 1PTRA 2V53A 2OD1A 2N71A 3TJQA 1P9GA 2N52A 4AMLA 1K7UA 3OL0A 2RC4A 5FUWA 1CGJI 3BJIA 1NUBA 1UUCA 1NXUA 2J9RA 3TO7A 1DS2I 1ULKA 2CWFA 2E5RA 2F3CI 2RIJA 3CXLA 3E2IA 2JYYA 3FSXA 1WGTA 2ORWA 1WKXA 3MEKA 2JA1A 1YTPA 3UGLA 4E1RA 3TO6A 2KMQA 1IY5A 3QTLD 1VDDA 1N13A 1MJBA 4UXJA 3OVOA 3TOBA 2N1AB 2E73A 1V1HA 3VDPA 1CHOI 2ROWA 2CWGA 2GKTI 5DAEA 1MJAA 3FSYA 4MPIA 2P6AC 5FUYA 2OZUA 2KMRA 2UZ3A 2B8TA 2QQ0A 2OVOA 4GI3C 2PQ8A 2LUYA 3UFFA 3E59A 5JHWC 2CJSC 2KMPA 2LB7A 1KBFA 3PDNA 2NU3I 1LR7A 2QPOA 1FAQA 1SGNI 2KMOA 1MT1A 1ULNA 3R5BA 1BUSA 2X3TA 4HGUA 3R5CA 1W4RA 1TBQR 3UGIA 1H0ZA 1LR9A 2N17A 1Y1CA 4DNCA 1TIHA 1TGSI 1HJAI 2SGPI 1PJUA 2DIPA 2YUUA 2NU4I 4E1PA 5CCMA 2WVJA 2M5XA 1OMUA 2CWHA 1LR8A 2FNFX 3R5AA 2SGDI 3VDUA 5FUXA 2V1CC 2X52A 3B4VC 4B6DA 1FY7A 1UVFA 7WGAA 4SGBI 1CE3A 5HQ8A 2SGQI 1HEVA 1SGPI 1RFHA 1CSOI 2SGFI 3QAHA 1XBTA 1AN1I 2ERWA 4WP4A 1K7TA 2GKVA 2QQEA 2YQPA 5FUVA 2V1CA 5EX0A 5E3RA 2ENZA 1X4SA 2B0UC 2JW6A 2DKVA 1XX6A 2ARPF
chains in the Genus database with same CATH topology
2ELIA 1TBRR 1CT0I 3VE5A 1TBOA 1FYBA 1Y1BA 2QQCA 1CT4I 3KY9A 1SGEI 1HPTA 3UEYA 1SGDI 3UGDA 1IY6A 1SGRI 3OXLA 2KCXA 2NU0I 2ODDA 1CT2I 1HDLA 4UXIA 2W0TA 1X74A 3D00A 1FARA 1W3SA 1OVOA 1R0RI 2WCYA 4A24A 3RU0A 2GKRI 4L9MA 5HI7A 2QQDA 3SEKC 1U5KA 5CCLA 1SGQI 1IW4A 2L7XA 1CGII 3OXFA 1BMOA 1UVGA 1DS3I 3OXGA 1YU6C 2NU1I 3HH2C 2NU2I 2A20A 1SGYI 1Z7KB 3FC3A 2LEOA 4JCVE 2JZMA 2J87A 1Y8FA 1KBEA 2K9HA 1PPFI 3SGBI 3GOXA 1M8CA 2VRWB 2SGEI 4FKDA 1R79A 2BUSA 4UXHA 3SGQI 1PCEA 1XA6A 1M8BA 1TUSA 2ENNA 2ORVA 2XRCA 5EX3A 1OMTA 2DB6A 2L8EA 4OVOA 1TOTA 1PTQA 1TBNA 2GVIA 3QWPA 1KMAA 1V1IA 2JXDA 1OYVI 1TURA 1PTRA 2V53A 2OD1A 2N71A 3TJQA 2N52A 3OL0A 5FUWA 1CGJI 1NUBA 1UUCA 2J9RA 1DS2I 3E2IA 2E5RA 2F3CI 3UEJA 3CXLA 2JYYA 2ORWA 3UGLA 3MEKA 2JA1A 1YTPA 4E1RA 1IY5A 2KMQA 3QTLD 1VDDA 1N13A 4UXJA 3OVOA 2N1AB 2E73A 1V1HA 3VDPA 1CHOI 2ROWA 2GKTI 5DAEA 2P6AC 5FUYA 2KMRA 2UZ3A 2B8TA 2QQ0A 2OVOA 4GI3C 3UFFA 2LUYA 5JHWC 3E59A 2CJSC 2KMPA 1KBFA 3PDNA 2NU3I 1LR7A 2QPOA 1FAQA 1SGNI 2KMOA 1MT1A 1BUSA 4HGUA 1H0ZA 1W4RA 1TBQR 3UGIA 1LR9A 2N17A 1Y1CA 1TIHA 1TGSI 1HJAI 2SGPI 1PJUA 2DIPA 2YUUA 2NU4I 4E1PA 5CCMA 2WVJA 2M5XA 1OMUA 2FNFX 1LR8A 2SGDI 3VDUA 5FUXA 2V1CC 3B4VC 4B6DA 1UVFA 4SGBI 1CE3A 5HQ8A 2SGQI 1SGPI 1RFHA 1CSOI 2SGFI 1XBTA 1AN1I 2ERWA 2GKVA 2QQEA 2YQPA 5FUVA 2V1CA 5EX0A 2ENZA 1X4SA 2B0UC 2JW6A 3BJIA 1XX6A 2ARPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELI A;  2J9R A;  3E2I A;  3CXL A;  2J87 A;  1TBO A;  1Y8F A;  2ORW A;  2YUU A;  1KBE A;  3UGL A;  2JA1 A;  3KY9 A;  3UEY A;  2VRW B;  4FKD A;  3UGD A;  4UXJ A;  1R79 A;  2WVJ A;  2FNF X;  2E73 A;  4UXH A;  2ROW A;  5FUX A;  1XA6 A;  2ENN A;  2ORV A;  4B6D A;  4UXI A;  2DB6 A;  5FUY A;  1FAR A;  2UZ3 A;  1PTQ A;  1TBN A;  2B8T A;  2GVI A;  1RFH A;  2QQ0 A;  3UFF A;  1XBT A;  1KBF A;  1PTR A;  2QQE A;  2QPO A;  4L9M A;  1FAQ A;  5FUV A;  2ENZ A;  5FUW A;  3BJI A;  1XX6 A;  3UEJ A;  1W4R A;  3UGI A; 
#chains in the Genus database with same CATH topology
 2ELI A;  1TBR R;  1CT0 I;  3VE5 A;  1K7V A;  1S20 A;  3R5D A;  1TBO A;  1FYB A;  1Y1B A;  2QQC A;  1CT4 I;  3KY9 A;  1SGE I;  1HPT A;  3UEY A;  1SGD I;  3UGD A;  1IY6 A;  1SGR I;  3OXL A;  5E3Q A;  3TO9 A;  2KCX A;  2NU0 I;  2ODD A;  1CT2 I;  1HDL A;  2UVO A;  2WGC A;  4UXI A;  2W0T A;  1X74 A;  3D00 A;  1FAR A;  1W3S A;  1OVO A;  1R0R I;  2WCY A;  1WTJ A;  4A24 A;  3RU0 A;  2GKR I;  4L9M A;  5HI7 A;  2QQD A;  3SEK C;  1U5K A;  5CCL A;  1SGQ I;  1IW4 A;  2L7X A;  3UEJ A;  2OU2 A;  1CGI I;  3OXF A;  1BMO A;  9WGA A;  1UVG A;  1DS3 I;  3OXG A;  5E3P A;  1YU6 C;  2NU1 I;  3HH2 C;  1Z2I A;  2A20 A;  1SGY I;  1Z7K B;  2NU2 I;  3FC3 A;  2LEO A;  4JCV E;  2JZM A;  2J87 A;  1Y8F A;  1MJ9 A;  1P9Z A;  1KBE A;  2K9H A;  3UOE A;  1PPF I;  1Q9B A;  3SGB I;  3GOX A;  1M8C A;  2VRW B;  2SGE I;  4FKD A;  5J8F A;  1R79 A;  2Y0M A;  1WGC A;  2BUS A;  4UXH A;  3SGQ I;  1PCE A;  1XA6 A;  1M8B A;  1TUS A;  2ENN A;  2ORV A;  2XRC A;  5EX3 A;  1OMT A;  2DB6 A;  2L8E A;  4OVO A;  3TOA A;  1ULM A;  1TOT A;  5J8C A;  1PTQ A;  1TBN A;  2GVI A;  3QWP A;  2GIV A;  1KMA A;  1V1I A;  2JXD A;  1OYV I;  1UHA A;  1TUR A;  1PTR A;  2V53 A;  2OD1 A;  2N71 A;  3TJQ A;  1P9G A;  2N52 A;  4AML A;  1K7U A;  3OL0 A;  2RC4 A;  5FUW A;  1CGJ I;  3BJI A;  1NUB A;  1UUC A;  1NXU A;  2J9R A;  3TO7 A;  1DS2 I;  1ULK A;  2CWF A;  2E5R A;  2F3C I;  2RIJ A;  3CXL A;  3E2I A;  2JYY A;  3FSX A;  1WGT A;  2ORW A;  1WKX A;  3MEK A;  2JA1 A;  1YTP A;  3UGL A;  4E1R A;  3TO6 A;  2KMQ A;  1IY5 A;  3QTL D;  1VDD A;  1N13 A;  1MJB A;  4UXJ A;  3OVO A;  3TOB A;  2N1A B;  2E73 A;  1V1H A;  3VDP A;  1CHO I;  2ROW A;  2CWG A;  2GKT I;  5DAE A;  1MJA A;  3FSY A;  4MPI A;  2P6A C;  5FUY A;  2OZU A;  2KMR A;  2UZ3 A;  2B8T A;  2QQ0 A;  2OVO A;  4GI3 C;  2PQ8 A;  2LUY A;  3UFF A;  3E59 A;  5JHW C;  2CJS C;  2KMP A;  2LB7 A;  1KBF A;  3PDN A;  2NU3 I;  1LR7 A;  2QPO A;  1FAQ A;  1SGN I;  2KMO A;  1MT1 A;  1ULN A;  3R5B A;  1BUS A;  2X3T A;  4HGU A;  3R5C A;  1W4R A;  1TBQ R;  3UGI A;  1H0Z A;  1LR9 A;  2N17 A;  1Y1C A;  4DNC A;  1TIH A;  1TGS I;  1HJA I;  2SGP I;  1PJU A;  2DIP A;  2YUU A;  2NU4 I;  4E1P A;  5CCM A;  2WVJ A;  2M5X A;  1OMU A;  2CWH A;  1LR8 A;  2FNF X;  3R5A A;  2SGD I;  3VDU A;  5FUX A;  2V1C C;  2X52 A;  3B4V C;  4B6D A;  1FY7 A;  1UVF A;  7WGA A;  4SGB I;  1CE3 A;  5HQ8 A;  2SGQ I;  1HEV A;  1SGP I;  1RFH A;  1CSO I;  2SGF I;  3QAH A;  1XBT A;  1AN1 I;  2ERW A;  4WP4 A;  1K7T A;  2GKV A;  2QQE A;  2YQP A;  5FUV A;  2V1C A;  5EX0 A;  5E3R A;  2ENZ A;  1X4S A;  2B0U C;  2JW6 A;  2DKV A;  1XX6 A;  2ARP F; 
#chains in the Genus database with same CATH homology
 2ELI A;  1TBR R;  1CT0 I;  3VE5 A;  1TBO A;  1FYB A;  1Y1B A;  2QQC A;  1CT4 I;  3KY9 A;  1SGE I;  1HPT A;  3UEY A;  1SGD I;  3UGD A;  1IY6 A;  1SGR I;  3OXL A;  2KCX A;  2NU0 I;  2ODD A;  1CT2 I;  1HDL A;  4UXI A;  2W0T A;  1X74 A;  3D00 A;  1FAR A;  1W3S A;  1OVO A;  1R0R I;  2WCY A;  4A24 A;  3RU0 A;  2GKR I;  4L9M A;  5HI7 A;  2QQD A;  3SEK C;  1U5K A;  5CCL A;  1SGQ I;  1IW4 A;  2L7X A;  1CGI I;  3OXF A;  1BMO A;  1UVG A;  1DS3 I;  3OXG A;  1YU6 C;  2NU1 I;  3HH2 C;  2NU2 I;  2A20 A;  1SGY I;  1Z7K B;  3FC3 A;  2LEO A;  4JCV E;  2JZM A;  2J87 A;  1Y8F A;  1KBE A;  2K9H A;  1PPF I;  3SGB I;  3GOX A;  1M8C A;  2VRW B;  2SGE I;  4FKD A;  1R79 A;  2BUS A;  4UXH A;  3SGQ I;  1PCE A;  1XA6 A;  1M8B A;  1TUS A;  2ENN A;  2ORV A;  2XRC A;  5EX3 A;  1OMT A;  2DB6 A;  2L8E A;  4OVO A;  1TOT A;  1PTQ A;  1TBN A;  2GVI A;  3QWP A;  1KMA A;  1V1I A;  2JXD A;  1OYV I;  1TUR A;  1PTR A;  2V53 A;  2OD1 A;  2N71 A;  3TJQ A;  2N52 A;  3OL0 A;  5FUW A;  1CGJ I;  1NUB A;  1UUC A;  2J9R A;  1DS2 I;  3E2I A;  2E5R A;  2F3C I;  3UEJ A;  3CXL A;  2JYY A;  2ORW A;  3UGL A;  3MEK A;  2JA1 A;  1YTP A;  4E1R A;  1IY5 A;  2KMQ A;  3QTL D;  1VDD A;  1N13 A;  4UXJ A;  3OVO A;  2N1A B;  2E73 A;  1V1H A;  3VDP A;  1CHO I;  2ROW A;  2GKT I;  5DAE A;  2P6A C;  5FUY A;  2KMR A;  2UZ3 A;  2B8T A;  2QQ0 A;  2OVO A;  4GI3 C;  3UFF A;  2LUY A;  5JHW C;  3E59 A;  2CJS C;  2KMP A;  1KBF A;  3PDN A;  2NU3 I;  1LR7 A;  2QPO A;  1FAQ A;  1SGN I;  2KMO A;  1MT1 A;  1BUS A;  4HGU A;  1H0Z A;  1W4R A;  1TBQ R;  3UGI A;  1LR9 A;  2N17 A;  1Y1C A;  1TIH A;  1TGS I;  1HJA I;  2SGP I;  1PJU A;  2DIP A;  2YUU A;  2NU4 I;  4E1P A;  5CCM A;  2WVJ A;  2M5X A;  1OMU A;  2FNF X;  1LR8 A;  2SGD I;  3VDU A;  5FUX A;  2V1C C;  3B4V C;  4B6D A;  1UVF A;  4SGB I;  1CE3 A;  5HQ8 A;  2SGQ I;  1SGP I;  1RFH A;  1CSO I;  2SGF I;  1XBT A;  1AN1 I;  2ERW A;  2GKV A;  2QQE A;  2YQP A;  5FUV A;  2V1C A;  5EX0 A;  2ENZ A;  1X4S A;  2B0U C;  2JW6 A;  3BJI A;  1XX6 A;  2ARP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...