2ODDA

Solution structure of the mynd domain from aml1-eto complexed with smrt, a corepressor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
50
structure length
50
Chain Sequence
DSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SMRT
publication title Structural basis for recognition of SMRT/N-CoR by the MYND domain and its contribution to AML1/ETO's activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 8
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.180 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2oddA00
5CCMA 3MEKA 2OD1A 5EX3A 3OXGA 3QWPA 2JW6A 5EX0A 2ODDA 5HI7A 3OXLA 3OXFA 3PDNA 3RU0A 5HQ8A 4A24A 5CCLA
chains in the Genus database with same CATH superfamily
3UGLA 1TBQR 2KCXA 1X74A 2JA1A 2JW6A 2SGFI 2WCYA 3QWPA 1LR7A 2OZUA 4UXJA 3KY9A 1PJUA 2UVOA 1MT1A 2J87A 5HQ8A 4MPIA 2M5XA 2L8EA 1N13A 2QQ0A 1Z7KB 1K7UA 1Z2IA 2CWFA 3OXGA 1FARA 7WGAA 2ODDA 1KBFA 1P9ZA 3TOBA 2LUYA 3SGQI 1V1IA 1Q9BA 2PQ8A 2KMOA 2QQEA 4E1RA 1VDDA 5EX0A 3OVOA 3UGIA 1LR9A 1Y8FA 1NXUA 1U5KA 2A20A 2ROWA 2X52A 1WGCA 1MJAA 2SGDI 1BMOA 2GIVA 1TUSA 1SGPI 1TOTA 1Y1BA 1FY7A 2ENNA 5FUVA 2VRWB 4HGUA 1H0ZA 1OMUA 1OYVI 1ULKA 3RU0A 1IW4A 1HEVA 1DS2I 1S20A 3R5AA 4L9MA 1W3SA 1UVGA 5J8CA 5HI7A 2KMPA 1TIHA 1TBRR 3TO7A 9WGAA 1V1HA 2DB6A 1YU6C 2V1CC 2B0UC 1WKXA 2ELIA 5FUYA 2SGEI 2N71A 2QQCA 2ARPF 3B4VC 2L7XA 1CE3A 1KBEA 1MJBA 2CWGA 2DIPA 2CWHA 3MEKA 2N52A 2F3CI 3SEKC 5FUXA 3TO6A 2Y0MA 2K9HA 2ORVA 1SGEI 1DS3I 1TGSI 2J9RA 2ORWA 2V53A 1PCEA 4WP4A 2N1AB 2QPOA 2P6AC 4UXIA 4GI3C 1SGQI 1SGRI 3QTLD 2V1CA 1UVFA 2OU2A 1YTPA 5E3RA 1CGJI 1SGDI 3VDUA 2RIJA 2GKTI 1XA6A 1FAQA 3E2IA 3VE5A 3UEYA 1OVOA 3TO9A 1IY6A 1UUCA 2LB7A 1SGNI 1NUBA 1AN1I 1PTRA 1XX6A 2NU4I 5CCMA 1ULMA 1KMAA 2CJSC 3FC3A 1WGTA 3TJQA 2E73A 2YQPA 2RC4A 1BUSA 3VDPA 2JXDA 2NU0I 2SGPI 1CGII 2E5RA 1Y1CA 5E3QA 2ERWA 2W0TA 3HH2C 4OVOA 4DNCA 2LEOA 2GKRI 3OXFA 1M8BA 2KMQA 1CT4I 1CT0I 1P9GA 5EX3A 3GOXA 1OMTA 1TURA 1R79A 2B8TA 1XBTA 3QAHA 3OXLA 3R5CA 1LR8A 1K7TA 4B6DA 2WVJA 2UZ3A 1IY5A 1FYBA 5J8FA 2ENZA 3UFFA 2X3TA 1CT2I 1K7VA 1HDLA 1MJ9A 1R0RI 5FUWA 5CCLA 1ULNA 3R5BA 2NU2I 3E59A 2N17A 2WGCA 1X4SA 3FSYA 3R5DA 1HPTA 1UHAA 4JCVE 1PTQA 1SGYI 2DKVA 3UOEA 4A24A 2FNFX 3UEJA 1M8CA 2OD1A 2NU1I 2JZMA 2GVIA 3D00A 3UGDA 4E1PA 1TBNA 3FSXA 4FKDA 5JHWC 1W4RA 1HJAI 1CSOI 2XRCA 1PPFI 2QQDA 2GKVA 3CXLA 3PDNA 1CHOI 5DAEA 2KMRA 3OL0A 2OVOA 2BUSA 2SGQI 2JYYA 4AMLA 5E3PA 2NU3I 2YUUA 1TBOA 4SGBI 3BJIA 4UXHA 1RFHA 3TOAA 1WTJA 3SGBI
chains in the Genus database with same CATH topology
3UGLA 1TBQR 2KCXA 1X74A 2JA1A 2JW6A 2SGFI 2WCYA 3QWPA 1LR7A 3SGBI 4UXJA 3KY9A 1PJUA 1MT1A 2J87A 5HQ8A 2M5XA 2L8EA 1N13A 2QQ0A 1Z7KB 3OXGA 1KBFA 1FARA 2ODDA 2LUYA 3SGQI 1V1IA 2QQEA 2KMOA 4E1RA 1VDDA 5EX0A 3OVOA 3UGIA 1LR9A 1Y8FA 1U5KA 2A20A 2ROWA 2SGDI 1BMOA 1TUSA 1SGPI 1TOTA 1Y1BA 5FUVA 2ENNA 1H0ZA 2VRWB 4HGUA 1OMUA 1OYVI 3RU0A 1IW4A 1DS2I 4L9MA 1W3SA 1UVGA 5HI7A 2KMPA 1TIHA 1TBRR 1V1HA 2DB6A 1YU6C 2V1CC 2B0UC 2ELIA 5FUYA 2SGEI 2N71A 2QQCA 2ARPF 3B4VC 2L7XA 1KBEA 2DIPA 3MEKA 2N52A 2F3CI 3SEKC 5FUXA 2K9HA 2ORVA 1SGEI 1DS3I 1TGSI 2J9RA 2ORWA 2V53A 1PCEA 2N1AB 2QPOA 2P6AC 4UXIA 4GI3C 1SGQI 1SGRI 3QTLD 2V1CA 1UVFA 1YTPA 1CGJI 1SGDI 3VDUA 2GKTI 1XA6A 1FAQA 3E2IA 3VE5A 3UEYA 1OVOA 1IY6A 1UUCA 1SGNI 1NUBA 1AN1I 1PTRA 1XX6A 2NU4I 5CCMA 1KMAA 2CJSC 3FC3A 3TJQA 2E73A 2YQPA 1BUSA 3VDPA 2JXDA 2NU0I 2SGPI 1CGII 2E5RA 1Y1CA 2ERWA 2W0TA 3HH2C 4OVOA 2LEOA 2GKRI 3OXFA 1M8BA 2KMQA 1CT4I 1CT0I 5EX3A 3GOXA 1OMTA 1TURA 1R79A 2B8TA 1XBTA 3OXLA 1LR8A 4B6DA 2WVJA 2UZ3A 1IY5A 1FYBA 2ENZA 3UFFA 1CT2I 1HDLA 5FUWA 1R0RI 5CCLA 2NU2I 3E59A 2N17A 1X4SA 1HPTA 4JCVE 1PTQA 1SGYI 4A24A 1CE3A 2FNFX 3UEJA 1M8CA 2OD1A 2NU1I 2JZMA 2GVIA 3D00A 3UGDA 4E1PA 1TBNA 4FKDA 5JHWC 1W4RA 1HJAI 1CSOI 2XRCA 1PPFI 2QQDA 2GKVA 3CXLA 3PDNA 1CHOI 5DAEA 2KMRA 3OL0A 2OVOA 2BUSA 2SGQI 2JYYA 2NU3I 2YUUA 1TBOA 4SGBI 3BJIA 4UXHA 1RFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCM A;  3MEK A;  2OD1 A;  5EX3 A;  3OXG A;  3QWP A;  2JW6 A;  5EX0 A;  2ODD A;  5HI7 A;  3OXL A;  3OXF A;  3PDN A;  3RU0 A;  5HQ8 A;  4A24 A;  5CCL A; 
#chains in the Genus database with same CATH topology
 3UGL A;  1TBQ R;  2KCX A;  1X74 A;  2JA1 A;  2JW6 A;  2SGF I;  2WCY A;  3QWP A;  1LR7 A;  2OZU A;  4UXJ A;  3KY9 A;  1PJU A;  2UVO A;  1MT1 A;  2J87 A;  5HQ8 A;  4MPI A;  2M5X A;  2L8E A;  1N13 A;  2QQ0 A;  1Z7K B;  1K7U A;  1Z2I A;  2CWF A;  3OXG A;  1FAR A;  7WGA A;  2ODD A;  1KBF A;  1P9Z A;  3TOB A;  2LUY A;  3SGQ I;  1V1I A;  1Q9B A;  2PQ8 A;  2KMO A;  2QQE A;  4E1R A;  1VDD A;  5EX0 A;  3OVO A;  3UGI A;  1LR9 A;  1Y8F A;  1NXU A;  1U5K A;  2A20 A;  2ROW A;  2X52 A;  1WGC A;  1MJA A;  2SGD I;  1BMO A;  2GIV A;  1TUS A;  1SGP I;  1TOT A;  1Y1B A;  1FY7 A;  2ENN A;  5FUV A;  2VRW B;  4HGU A;  1H0Z A;  1OMU A;  1OYV I;  1ULK A;  3RU0 A;  1IW4 A;  1HEV A;  1DS2 I;  1S20 A;  3R5A A;  4L9M A;  1W3S A;  1UVG A;  5J8C A;  5HI7 A;  2KMP A;  1TIH A;  1TBR R;  3TO7 A;  9WGA A;  1V1H A;  2DB6 A;  1YU6 C;  2V1C C;  2B0U C;  1WKX A;  2ELI A;  5FUY A;  2SGE I;  2N71 A;  2QQC A;  2ARP F;  3B4V C;  2L7X A;  1CE3 A;  1KBE A;  1MJB A;  2CWG A;  2DIP A;  2CWH A;  3MEK A;  2N52 A;  2F3C I;  3SEK C;  5FUX A;  3TO6 A;  2Y0M A;  2K9H A;  2ORV A;  1SGE I;  1DS3 I;  1TGS I;  2J9R A;  2ORW A;  2V53 A;  1PCE A;  4WP4 A;  2N1A B;  2QPO A;  2P6A C;  4UXI A;  4GI3 C;  1SGQ I;  1SGR I;  3QTL D;  2V1C A;  1UVF A;  2OU2 A;  1YTP A;  5E3R A;  1CGJ I;  1SGD I;  3VDU A;  2RIJ A;  2GKT I;  1XA6 A;  1FAQ A;  3E2I A;  3VE5 A;  3UEY A;  1OVO A;  3TO9 A;  1IY6 A;  1UUC A;  2LB7 A;  1SGN I;  1NUB A;  1AN1 I;  1PTR A;  1XX6 A;  2NU4 I;  5CCM A;  1ULM A;  1KMA A;  2CJS C;  3FC3 A;  1WGT A;  3TJQ A;  2E73 A;  2YQP A;  2RC4 A;  1BUS A;  3VDP A;  2JXD A;  2NU0 I;  2SGP I;  1CGI I;  2E5R A;  1Y1C A;  5E3Q A;  2ERW A;  2W0T A;  3HH2 C;  4OVO A;  4DNC A;  2LEO A;  2GKR I;  3OXF A;  1M8B A;  2KMQ A;  1CT4 I;  1CT0 I;  1P9G A;  5EX3 A;  3GOX A;  1OMT A;  1TUR A;  1R79 A;  2B8T A;  1XBT A;  3QAH A;  3OXL A;  3R5C A;  1LR8 A;  1K7T A;  4B6D A;  2WVJ A;  2UZ3 A;  1IY5 A;  1FYB A;  5J8F A;  2ENZ A;  3UFF A;  2X3T A;  1CT2 I;  1K7V A;  1HDL A;  1MJ9 A;  1R0R I;  5FUW A;  5CCL A;  1ULN A;  3R5B A;  2NU2 I;  3E59 A;  2N17 A;  2WGC A;  1X4S A;  3FSY A;  3R5D A;  1HPT A;  1UHA A;  4JCV E;  1PTQ A;  1SGY I;  2DKV A;  3UOE A;  4A24 A;  2FNF X;  3UEJ A;  1M8C A;  2OD1 A;  2NU1 I;  2JZM A;  2GVI A;  3D00 A;  3UGD A;  4E1P A;  1TBN A;  3FSX A;  4FKD A;  5JHW C;  1W4R A;  1HJA I;  1CSO I;  2XRC A;  1PPF I;  2QQD A;  2GKV A;  3CXL A;  3PDN A;  1CHO I;  5DAE A;  2KMR A;  3OL0 A;  2OVO A;  2BUS A;  2SGQ I;  2JYY A;  4AML A;  5E3P A;  2NU3 I;  2YUU A;  1TBO A;  4SGB I;  3BJI A;  4UXH A;  1RFH A;  3TOA A;  1WTJ A;  3SGB I; 
#chains in the Genus database with same CATH homology
 3UGL A;  1TBQ R;  2KCX A;  1X74 A;  2JA1 A;  2JW6 A;  2SGF I;  2WCY A;  3QWP A;  1LR7 A;  3SGB I;  4UXJ A;  3KY9 A;  1PJU A;  1MT1 A;  2J87 A;  5HQ8 A;  2M5X A;  2L8E A;  1N13 A;  2QQ0 A;  1Z7K B;  3OXG A;  1KBF A;  1FAR A;  2ODD A;  2LUY A;  3SGQ I;  1V1I A;  2QQE A;  2KMO A;  4E1R A;  1VDD A;  5EX0 A;  3OVO A;  3UGI A;  1LR9 A;  1Y8F A;  1U5K A;  2A20 A;  2ROW A;  2SGD I;  1BMO A;  1TUS A;  1SGP I;  1TOT A;  1Y1B A;  5FUV A;  2ENN A;  1H0Z A;  2VRW B;  4HGU A;  1OMU A;  1OYV I;  3RU0 A;  1IW4 A;  1DS2 I;  4L9M A;  1W3S A;  1UVG A;  5HI7 A;  2KMP A;  1TIH A;  1TBR R;  1V1H A;  2DB6 A;  1YU6 C;  2V1C C;  2B0U C;  2ELI A;  5FUY A;  2SGE I;  2N71 A;  2QQC A;  2ARP F;  3B4V C;  2L7X A;  1KBE A;  2DIP A;  3MEK A;  2N52 A;  2F3C I;  3SEK C;  5FUX A;  2K9H A;  2ORV A;  1SGE I;  1DS3 I;  1TGS I;  2J9R A;  2ORW A;  2V53 A;  1PCE A;  2N1A B;  2QPO A;  2P6A C;  4UXI A;  4GI3 C;  1SGQ I;  1SGR I;  3QTL D;  2V1C A;  1UVF A;  1YTP A;  1CGJ I;  1SGD I;  3VDU A;  2GKT I;  1XA6 A;  1FAQ A;  3E2I A;  3VE5 A;  3UEY A;  1OVO A;  1IY6 A;  1UUC A;  1SGN I;  1NUB A;  1AN1 I;  1PTR A;  1XX6 A;  2NU4 I;  5CCM A;  1KMA A;  2CJS C;  3FC3 A;  3TJQ A;  2E73 A;  2YQP A;  1BUS A;  3VDP A;  2JXD A;  2NU0 I;  2SGP I;  1CGI I;  2E5R A;  1Y1C A;  2ERW A;  2W0T A;  3HH2 C;  4OVO A;  2LEO A;  2GKR I;  3OXF A;  1M8B A;  2KMQ A;  1CT4 I;  1CT0 I;  5EX3 A;  3GOX A;  1OMT A;  1TUR A;  1R79 A;  2B8T A;  1XBT A;  3OXL A;  1LR8 A;  4B6D A;  2WVJ A;  2UZ3 A;  1IY5 A;  1FYB A;  2ENZ A;  3UFF A;  1CT2 I;  1HDL A;  5FUW A;  1R0R I;  5CCL A;  2NU2 I;  3E59 A;  2N17 A;  1X4S A;  1HPT A;  4JCV E;  1PTQ A;  1SGY I;  4A24 A;  1CE3 A;  2FNF X;  3UEJ A;  1M8C A;  2OD1 A;  2NU1 I;  2JZM A;  2GVI A;  3D00 A;  3UGD A;  4E1P A;  1TBN A;  4FKD A;  5JHW C;  1W4R A;  1HJA I;  1CSO I;  2XRC A;  1PPF I;  2QQD A;  2GKV A;  3CXL A;  3PDN A;  1CHO I;  5DAE A;  2KMR A;  3OL0 A;  2OVO A;  2BUS A;  2SGQ I;  2JYY A;  2NU3 I;  2YUU A;  1TBO A;  4SGB I;  3BJI A;  4UXH A;  1RFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...