2ODDA

Solution structure of the mynd domain from aml1-eto complexed with smrt, a corepressor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
50
structure length
50
Chain Sequence
b'DSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SMRT
publication title Structural basis for recognition of SMRT/N-CoR by the MYND domain and its contribution to AML1/ETO's activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 8
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.180 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2oddA00
4A24A 2OD1A 2ODDA 3PDNA 3RU0A 5CCMA 5CCLA 5HQ8A 3OXLA 3MEKA 5EX0A 5EX3A 3QWPA 3OXGA 3OXFA 2JW6A 5HI7A
chains in the Genus database with same CATH superfamily
3UFFA 1Y8FA 2NU1I 2CWHA 1TBOA 3OXLA 2SGPI 4JCVE 1YTPA 1MJBA 2J87A 4UXIA 2GKTI 3SGQI 2OD1A 1HJAI 2BUSA 2SGDI 4UXJA 3UGLA 1WKXA 3OVOA 1IY6A 1DS3I 9WGAA 4GI3C 1UVGA 2NU0I 2X3TA 2NU3I 3UEYA 4DNCA 3OL0A 2KMQA 2N71A 3SGBI 1M8BA 1V1IA 2J9RA 2V53A 2ERWA 1KBEA 1P9ZA 1PPFI 2LUYA 1Y1CA 1X4SA 1VDDA 1UHAA 2YUUA 2Y0MA 1XX6A 1TOTA 1OYVI 2ODDA 2OU2A 1OVOA 1TUSA 2B0UC 3VE5A 5CCMA 1U5KA 2QQ0A 1SGQI 2A20A 1OMUA 3UGIA 2GVIA 1RFHA 2P6AC 2WCYA 1ULNA 2KMPA 3GOXA 5J8FA 1SGYI 4L9MA 5HQ8A 2ELIA 2V1CC 1LR9A 2CWGA 2SGQI 5E3PA 2N52A 2ROWA 2FNFX 3QWPA 1N13A 2N17A 3TO7A 1CT2I 4B6DA 4WP4A 1FAQA 2KCXA 4HGUA 2ORVA 1LR7A 2K9HA 2UZ3A 2RIJA 3FSYA 2ORWA 1H0ZA 2B8TA 1KBFA 4SGBI 2VRWB 2JA1A 2LEOA 3KY9A 3E2IA 1NXUA 3R5AA 3TO9A 1DS2I 2GIVA 3TO6A 3VDUA 1HEVA 4OVOA 3OXGA 3SEKC 2YQPA 3HH2C 1CGII 1SGDI 1Z7KB 2NU2I 5E3RA 2JYYA 3R5CA 1ULMA 3UGDA 1BUSA 3D00A 3CXLA 4FKDA 1X74A 1WGCA 1R0RI 1SGPI 2GKRI 3TOBA 4E1PA 2CWFA 2CJSC 1MJ9A 1CHOI 3B4VC 1TBQR 2X52A 1WTJA 2WVJA 2XRCA 4AMLA 1Y1BA 4E1RA 5JHWC 2ENZA 3E59A 2ARPF 3FSXA 5E3QA 1IW4A 2RC4A 2N1AB 4UXHA 2UVOA 1PTQA 3RU0A 1ULKA 3FC3A 1HDLA 1FARA 5EX3A 1M8CA 1UVFA 2DKVA 2JW6A 1TURA 2KMOA 2QPOA 2JXDA 1K7TA 2SGEI 5FUWA 1XA6A 5DAEA 1PTRA 3QTLD 1TBRR 4MPIA 7WGAA 2GKVA 1TBNA 2M5XA 1SGRI 1AN1I 1WGTA 1LR8A 3TJQA 1FY7A 3PDNA 2L8EA 1IY5A 2DIPA 2F3CI 5FUYA 1BMOA 1YU6C 2OZUA 1PCEA 1V1HA 1P9GA 1TGSI 2E73A 1W3SA 3TOAA 1Q9BA 2ENNA 1MJAA 1K7VA 2QQCA 2WGCA 1CT0I 2KMRA 1CSOI 1FYBA 1K7UA 1S20A 2JZMA 2E5RA 5FUXA 3UEJA 2SGFI 4A24A 3BJIA 1R79A 5CCLA 5J8CA 2QQDA 3R5BA 1Z2IA 1UUCA 3QAHA 3R5DA 3VDPA 1SGNI 3UOEA 1CGJI 5HI7A 1OMTA 1KMAA 2OVOA 1CE3A 5FUVA 2LB7A 1W4RA 2DB6A 2L7XA 2PQ8A 3MEKA 1NUBA 2QQEA 3OXFA 2W0TA 1HPTA 1SGEI 2NU4I 1PJUA 5EX0A 1TIHA 1MT1A 1CT4I 1XBTA 2V1CA
chains in the Genus database with same CATH topology
1Y8FA 2NU1I 1TBOA 3OXLA 2SGPI 4JCVE 1YTPA 2J87A 4UXIA 2GKTI 3SGQI 2OD1A 1HJAI 2BUSA 2SGDI 4UXJA 3UGLA 3OVOA 1IY6A 1DS3I 4GI3C 1UVGA 2NU0I 2NU3I 3UEYA 3OL0A 2KMQA 2N71A 3SGBI 1M8BA 1V1IA 2J9RA 2V53A 2ERWA 1KBEA 1PPFI 2LUYA 1Y1CA 1X4SA 1VDDA 2YUUA 1XX6A 1TOTA 1OYVI 2ODDA 1OVOA 1TUSA 2B0UC 3VE5A 5CCMA 1U5KA 2QQ0A 1SGQI 2A20A 1OMUA 3UGIA 2GVIA 1RFHA 2P6AC 2WCYA 3GOXA 2KMPA 1SGYI 4L9MA 5HQ8A 2ELIA 2V1CC 1LR9A 2SGQI 2N52A 2ROWA 2FNFX 3QWPA 1N13A 2N17A 1CT2I 4B6DA 1FAQA 2KCXA 4HGUA 2ORVA 1LR7A 2K9HA 2UZ3A 2ORWA 1H0ZA 2B8TA 1KBFA 4SGBI 2VRWB 2JA1A 2LEOA 3KY9A 3E2IA 1DS2I 3VDUA 4OVOA 3OXGA 3SEKC 2YQPA 3HH2C 1CGII 1SGDI 1Z7KB 2NU2I 1BUSA 2JYYA 3UGDA 3D00A 3CXLA 4FKDA 1X74A 1R0RI 1SGPI 2GKRI 4E1PA 3B4VC 2CJSC 1CHOI 4E1RA 1TBQR 5JHWC 2WVJA 2XRCA 1Y1BA 2ENZA 3E59A 2ARPF 1IW4A 2N1AB 4UXHA 3RU0A 1PTQA 3FC3A 1HDLA 1FARA 5EX3A 1M8CA 1UVFA 2KMOA 2JW6A 1TURA 2QPOA 2JXDA 5FUWA 2SGEI 1XA6A 5DAEA 1PTRA 3QTLD 1TBRR 2GKVA 1TBNA 2M5XA 1SGRI 1AN1I 1LR8A 3TJQA 3PDNA 2L8EA 1IY5A 2DIPA 2F3CI 5FUYA 1BMOA 1YU6C 3UFFA 1PCEA 1V1HA 1TGSI 2E73A 1W3SA 2ENNA 2QQCA 1CT0I 2KMRA 1CSOI 1FYBA 2JZMA 2E5RA 5FUXA 3UEJA 2SGFI 4A24A 3BJIA 1R79A 5CCLA 2QQDA 1UUCA 3VDPA 1SGNI 1CGJI 5HI7A 1OMTA 1KMAA 2OVOA 1CE3A 5FUVA 1W4RA 2DB6A 2L7XA 3MEKA 1NUBA 2QQEA 3OXFA 2W0TA 1HPTA 1SGEI 2NU4I 1PJUA 5EX0A 1TIHA 1MT1A 1CT4I 1XBTA 2V1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A24 A;  2OD1 A;  2ODD A;  3PDN A;  3RU0 A;  5CCM A;  5CCL A;  5HQ8 A;  3OXL A;  3MEK A;  5EX0 A;  5EX3 A;  3QWP A;  3OXG A;  3OXF A;  2JW6 A;  5HI7 A; 
#chains in the Genus database with same CATH topology
 3UFF A;  1Y8F A;  2NU1 I;  2CWH A;  1TBO A;  3OXL A;  2SGP I;  4JCV E;  1YTP A;  1MJB A;  2J87 A;  4UXI A;  2GKT I;  3SGQ I;  2OD1 A;  1HJA I;  2BUS A;  2SGD I;  4UXJ A;  3UGL A;  1WKX A;  3OVO A;  1IY6 A;  1DS3 I;  9WGA A;  4GI3 C;  1UVG A;  2NU0 I;  2X3T A;  2NU3 I;  3UEY A;  4DNC A;  3OL0 A;  2KMQ A;  2N71 A;  3SGB I;  1M8B A;  1V1I A;  2J9R A;  2V53 A;  2ERW A;  1KBE A;  1P9Z A;  1PPF I;  2LUY A;  1Y1C A;  1X4S A;  1VDD A;  1UHA A;  2YUU A;  2Y0M A;  1XX6 A;  1TOT A;  1OYV I;  2ODD A;  2OU2 A;  1OVO A;  1TUS A;  2B0U C;  3VE5 A;  5CCM A;  1U5K A;  2QQ0 A;  1SGQ I;  2A20 A;  1OMU A;  3UGI A;  2GVI A;  1RFH A;  2P6A C;  2WCY A;  1ULN A;  2KMP A;  3GOX A;  5J8F A;  1SGY I;  4L9M A;  5HQ8 A;  2ELI A;  2V1C C;  1LR9 A;  2CWG A;  2SGQ I;  5E3P A;  2N52 A;  2ROW A;  2FNF X;  3QWP A;  1N13 A;  2N17 A;  3TO7 A;  1CT2 I;  4B6D A;  4WP4 A;  1FAQ A;  2KCX A;  4HGU A;  2ORV A;  1LR7 A;  2K9H A;  2UZ3 A;  2RIJ A;  3FSY A;  2ORW A;  1H0Z A;  2B8T A;  1KBF A;  4SGB I;  2VRW B;  2JA1 A;  2LEO A;  3KY9 A;  3E2I A;  1NXU A;  3R5A A;  3TO9 A;  1DS2 I;  2GIV A;  3TO6 A;  3VDU A;  1HEV A;  4OVO A;  3OXG A;  3SEK C;  2YQP A;  3HH2 C;  1CGI I;  1SGD I;  1Z7K B;  2NU2 I;  5E3R A;  2JYY A;  3R5C A;  1ULM A;  3UGD A;  1BUS A;  3D00 A;  3CXL A;  4FKD A;  1X74 A;  1WGC A;  1R0R I;  1SGP I;  2GKR I;  3TOB A;  4E1P A;  2CWF A;  2CJS C;  1MJ9 A;  1CHO I;  3B4V C;  1TBQ R;  2X52 A;  1WTJ A;  2WVJ A;  2XRC A;  4AML A;  1Y1B A;  4E1R A;  5JHW C;  2ENZ A;  3E59 A;  2ARP F;  3FSX A;  5E3Q A;  1IW4 A;  2RC4 A;  2N1A B;  4UXH A;  2UVO A;  1PTQ A;  3RU0 A;  1ULK A;  3FC3 A;  1HDL A;  1FAR A;  5EX3 A;  1M8C A;  1UVF A;  2DKV A;  2JW6 A;  1TUR A;  2KMO A;  2QPO A;  2JXD A;  1K7T A;  2SGE I;  5FUW A;  1XA6 A;  5DAE A;  1PTR A;  3QTL D;  1TBR R;  4MPI A;  7WGA A;  2GKV A;  1TBN A;  2M5X A;  1SGR I;  1AN1 I;  1WGT A;  1LR8 A;  3TJQ A;  1FY7 A;  3PDN A;  2L8E A;  1IY5 A;  2DIP A;  2F3C I;  5FUY A;  1BMO A;  1YU6 C;  2OZU A;  1PCE A;  1V1H A;  1P9G A;  1TGS I;  2E73 A;  1W3S A;  3TOA A;  1Q9B A;  2ENN A;  1MJA A;  1K7V A;  2QQC A;  2WGC A;  1CT0 I;  2KMR A;  1CSO I;  1FYB A;  1K7U A;  1S20 A;  2JZM A;  2E5R A;  5FUX A;  3UEJ A;  2SGF I;  4A24 A;  3BJI A;  1R79 A;  5CCL A;  5J8C A;  2QQD A;  3R5B A;  1Z2I A;  1UUC A;  3QAH A;  3R5D A;  3VDP A;  1SGN I;  3UOE A;  1CGJ I;  5HI7 A;  1OMT A;  1KMA A;  2OVO A;  1CE3 A;  5FUV A;  2LB7 A;  1W4R A;  2DB6 A;  2L7X A;  2PQ8 A;  3MEK A;  1NUB A;  2QQE A;  3OXF A;  2W0T A;  1HPT A;  1SGE I;  2NU4 I;  1PJU A;  5EX0 A;  1TIH A;  1MT1 A;  1CT4 I;  1XBT A;  2V1C A; 
#chains in the Genus database with same CATH homology
 1Y8F A;  2NU1 I;  1TBO A;  3OXL A;  2SGP I;  4JCV E;  1YTP A;  2J87 A;  4UXI A;  2GKT I;  3SGQ I;  2OD1 A;  1HJA I;  2BUS A;  2SGD I;  4UXJ A;  3UGL A;  3OVO A;  1IY6 A;  1DS3 I;  4GI3 C;  1UVG A;  2NU0 I;  2NU3 I;  3UEY A;  3OL0 A;  2KMQ A;  2N71 A;  3SGB I;  1M8B A;  1V1I A;  2J9R A;  2V53 A;  2ERW A;  1KBE A;  1PPF I;  2LUY A;  1Y1C A;  1X4S A;  1VDD A;  2YUU A;  1XX6 A;  1TOT A;  1OYV I;  2ODD A;  1OVO A;  1TUS A;  2B0U C;  3VE5 A;  5CCM A;  1U5K A;  2QQ0 A;  1SGQ I;  2A20 A;  1OMU A;  3UGI A;  2GVI A;  1RFH A;  2P6A C;  2WCY A;  3GOX A;  2KMP A;  1SGY I;  4L9M A;  5HQ8 A;  2ELI A;  2V1C C;  1LR9 A;  2SGQ I;  2N52 A;  2ROW A;  2FNF X;  3QWP A;  1N13 A;  2N17 A;  1CT2 I;  4B6D A;  1FAQ A;  2KCX A;  4HGU A;  2ORV A;  1LR7 A;  2K9H A;  2UZ3 A;  2ORW A;  1H0Z A;  2B8T A;  1KBF A;  4SGB I;  2VRW B;  2JA1 A;  2LEO A;  3KY9 A;  3E2I A;  1DS2 I;  3VDU A;  4OVO A;  3OXG A;  3SEK C;  2YQP A;  3HH2 C;  1CGI I;  1SGD I;  1Z7K B;  2NU2 I;  1BUS A;  2JYY A;  3UGD A;  3D00 A;  3CXL A;  4FKD A;  1X74 A;  1R0R I;  1SGP I;  2GKR I;  4E1P A;  3B4V C;  2CJS C;  1CHO I;  4E1R A;  1TBQ R;  5JHW C;  2WVJ A;  2XRC A;  1Y1B A;  2ENZ A;  3E59 A;  2ARP F;  1IW4 A;  2N1A B;  4UXH A;  3RU0 A;  1PTQ A;  3FC3 A;  1HDL A;  1FAR A;  5EX3 A;  1M8C A;  1UVF A;  2KMO A;  2JW6 A;  1TUR A;  2QPO A;  2JXD A;  5FUW A;  2SGE I;  1XA6 A;  5DAE A;  1PTR A;  3QTL D;  1TBR R;  2GKV A;  1TBN A;  2M5X A;  1SGR I;  1AN1 I;  1LR8 A;  3TJQ A;  3PDN A;  2L8E A;  1IY5 A;  2DIP A;  2F3C I;  5FUY A;  1BMO A;  1YU6 C;  3UFF A;  1PCE A;  1V1H A;  1TGS I;  2E73 A;  1W3S A;  2ENN A;  2QQC A;  1CT0 I;  2KMR A;  1CSO I;  1FYB A;  2JZM A;  2E5R A;  5FUX A;  3UEJ A;  2SGF I;  4A24 A;  3BJI A;  1R79 A;  5CCL A;  2QQD A;  1UUC A;  3VDP A;  1SGN I;  1CGJ I;  5HI7 A;  1OMT A;  1KMA A;  2OVO A;  1CE3 A;  5FUV A;  1W4R A;  2DB6 A;  2L7X A;  3MEK A;  1NUB A;  2QQE A;  3OXF A;  2W0T A;  1HPT A;  1SGE I;  2NU4 I;  1PJU A;  5EX0 A;  1TIH A;  1MT1 A;  1CT4 I;  1XBT A;  2V1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...