1KBFA

Solution structure of the cysteine-rich c1 domain of kinase suppressor of ras
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
49
structure length
49
Chain Sequence
GSVTHRFSTKSWLSQVCNVCQKSMIFGVKCKHCRLKCHNKCTKEAPACR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Kinase Suppressor of Ras
publication title Solution structure and functional analysis of the cysteine-rich C1 domain of kinase suppressor of Ras (KSR).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 3
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2001-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1kbfA00
3E2IA 2ELIA 1TBNA 1RFHA 1TBOA 1XX6A 1KBFA 2ROWA 3UGDA 1W4RA 4B6DA 2E73A 2QQEA 3CXLA 4UXHA 1KBEA 1PTQA 2QQ0A 2WVJA 5FUVA 1Y8FA 3UEYA 4UXJA 2B8TA 2ENZA 1FARA 5FUXA 2J9RA 2J87A 2QPOA 3BJIA 1FAQA 5FUYA 3UGIA 5FUWA 2UZ3A 4L9MA 2YUUA 2ENNA 2FNFX 3UFFA 1XA6A 3KY9A 4UXIA 3UGLA 1XBTA 2ORWA 4FKDA 2VRWB 3UEJA 2DB6A 1R79A 2GVIA 2JA1A 1PTRA 2ORVA
chains in the Genus database with same CATH superfamily
3E2IA 4A24A 1TBNA 2RIJA 4HGUA 1TIHA 3R5DA 1RFHA 3TOBA 1HEVA 1TURA 1CGII 2JW6A 2X3TA 1X74A 2JZMA 1FY7A 2UVOA 9WGAA 1Y1CA 1Q9BA 2B0UC 2NU3I 3OXFA 7WGAA 3SGQI 1PTQA 2QQ0A 1WGTA 3QAHA 3TJQA 3TO7A 1K7TA 2WGCA 1DS2I 1PPFI 3HH2C 1HJAI 1YU6C 3GOXA 2QQCA 1FARA 1MJBA 2J9RA 2SGQI 1BUSA 1CT2I 4JCVE 1CSOI 1FAQA 2SGFI 2CWFA 1OYVI 1NXUA 4L9MA 3OL0A 3OXGA 4E1RA 2F3CI 3KY9A 5EX0A 3E59A 4UXIA 1XBTA 2ORWA 4DNCA 4FKDA 2VRWB 4OVOA 2N71A 1WTJA 2JXDA 4E1PA 2GKVA 1NUBA 1XX6A 2K9HA 1M8CA 1ULKA 2LB7A 2KMQA 1M8BA 3TO6A 1SGNI 2SGPI 4B6DA 1UUCA 2QQEA 1BMOA 5E3PA 1V1HA 1ULMA 1CE3A 1MJAA 2SGDI 1DS3I 2WVJA 5FUVA 3SEKC 4UXJA 3OXLA 3UEYA 1UHAA 2LUYA 2ENZA 5DAEA 1UVFA 1TUSA 1Y1BA 1K7VA 5CCLA 5HQ8A 2N52A 2E5RA 4WP4A 2WCYA 5JHWC 1IY6A 2A20A 1PJUA 1TBQR 5J8FA 3MEKA 1HDLA 2GIVA 1MJ9A 1Z2IA 2ERWA 2YQPA 1X4SA 3VDPA 1XA6A 1TBRR 3TOAA 2V53A 1TGSI 3VDUA 1MT1A 2GVIA 2OU2A 4GI3C 2V1CA 4SGBI 2CWHA 2N17A 1SGQI 2ELIA 2N1AB 2ORVA 3SGBI 2KCXA 3B4VC 2KMPA 2ODDA 2OD1A 1IW4A 1YTPA 1UVGA 5CCMA 1R0RI 2E73A 3CXLA 2PQ8A 1IY5A 1P9ZA 3RU0A 2DIPA 2KMOA 1OMTA 2NU4I 2P6AC 1Y8FA 3VE5A 5EX3A 2GKRI 2Y0MA 1KMAA 2V1CC 1TOTA 3R5AA 5E3QA 1OVOA 2OVOA 2QPOA 3QTLD 2BUSA 3OVOA 1P9GA 1V1IA 2NU0I 5FUYA 3UGIA 1H0ZA 2ARPF 2UZ3A 1LR9A 5FUWA 2NU1I 1PCEA 2ENNA 2FNFX 1Z7KB 3FSXA 3UFFA 1WGCA 3UGLA 2CJSC 3UEJA 2OZUA 2QQDA 3UOEA 1SGDI 2LEOA 2JA1A 2XRCA 3QWPA 1CT0I 2KMRA 1LR7A 1TBOA 1U5KA 1WKXA 3FSYA 1ULNA 1FYBA 1KBFA 2CWGA 2ROWA 5E3RA 1LR8A 1W4RA 2DKVA 3UGDA 1K7UA 2GKTI 1W3SA 2NU2I 3R5CA 4UXHA 1KBEA 2L8EA 2W0TA 3PDNA 1CT4I 2B8TA 2X52A 2M5XA 5FUXA 1SGRI 2J87A 1SGEI 1AN1I 1OMUA 3BJIA 3D00A 3TO9A 1CGJI 1CHOI 1HPTA 5HI7A 2RC4A 2YUUA 2SGEI 4MPIA 1SGYI 5J8CA 4AMLA 3FC3A 1S20A 1SGPI 2DB6A 2JYYA 1R79A 1N13A 3R5BA 1VDDA 1PTRA 2L7XA
chains in the Genus database with same CATH topology
3E2IA 4A24A 1TBNA 4HGUA 1TIHA 1RFHA 1TURA 1CGII 2JW6A 1X74A 2JZMA 1Y1CA 2B0UC 2NU3I 3OXFA 3SGQI 1PTQA 2QQ0A 3TJQA 1DS2I 1PPFI 3HH2C 1HJAI 1YU6C 3GOXA 2QQCA 1FARA 2J9RA 2SGQI 1BUSA 1CT2I 4JCVE 1CSOI 1FAQA 2SGFI 1OYVI 4L9MA 3OL0A 3OXGA 4E1RA 2F3CI 3KY9A 5EX0A 3E59A 4UXIA 1XBTA 2ORWA 4FKDA 2VRWB 4OVOA 2N71A 2JXDA 4E1PA 2GKVA 1NUBA 1XX6A 2K9HA 1M8CA 2KMQA 1M8BA 1SGNI 2SGPI 4B6DA 1UUCA 2QQEA 1BMOA 1V1HA 1CE3A 2WVJA 2SGDI 1DS3I 5FUVA 3SEKC 3UEYA 4UXJA 3OXLA 2LUYA 2ENZA 5DAEA 1UVFA 1TUSA 1Y1BA 5CCLA 5HQ8A 2N52A 2E5RA 2WCYA 5JHWC 1IY6A 2A20A 1PJUA 1TBQR 1HDLA 3MEKA 2ERWA 2YQPA 1X4SA 3VDPA 1XA6A 1TBRR 2V53A 1TGSI 3VDUA 1MT1A 2GVIA 4GI3C 2V1CA 4SGBI 2N17A 2ORVA 1SGQI 2ELIA 2N1AB 3SGBI 2KCXA 3B4VC 2KMPA 2ODDA 2OD1A 1IW4A 1YTPA 1UVGA 5CCMA 1R0RI 2E73A 3CXLA 1IY5A 3RU0A 2DIPA 2KMOA 1OMTA 2NU4I 2P6AC 1Y8FA 3VE5A 5EX3A 2GKRI 1KMAA 2V1CC 1TOTA 1OVOA 2OVOA 2QPOA 3QTLD 2BUSA 3OVOA 1V1IA 2NU0I 5FUYA 1H0ZA 3UGIA 2ARPF 2UZ3A 1LR9A 5FUWA 2NU1I 1PCEA 2ENNA 2FNFX 1Z7KB 3UFFA 3UGLA 2CJSC 3UEJA 2QQDA 1SGDI 2LEOA 2JA1A 2XRCA 3QWPA 1CT0I 2KMRA 1LR7A 1TBOA 1U5KA 1KBFA 1FYBA 2ROWA 3UGDA 1LR8A 1W4RA 2GKTI 1W3SA 2NU2I 4UXHA 1KBEA 2L8EA 2W0TA 3PDNA 1CT4I 2B8TA 2M5XA 5FUXA 1SGRI 2J87A 1SGEI 1AN1I 1OMUA 3BJIA 3D00A 1CGJI 1CHOI 1HPTA 5HI7A 2YUUA 2SGEI 1SGYI 3FC3A 1SGPI 2DB6A 2JYYA 1R79A 1N13A 1VDDA 1PTRA 2L7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E2I A;  2ELI A;  1TBN A;  1RFH A;  1TBO A;  1XX6 A;  1KBF A;  2ROW A;  3UGD A;  1W4R A;  4B6D A;  2E73 A;  2QQE A;  3CXL A;  4UXH A;  1KBE A;  1PTQ A;  2QQ0 A;  2WVJ A;  5FUV A;  1Y8F A;  3UEY A;  4UXJ A;  2B8T A;  2ENZ A;  1FAR A;  5FUX A;  2J9R A;  2J87 A;  2QPO A;  3BJI A;  1FAQ A;  5FUY A;  3UGI A;  5FUW A;  2UZ3 A;  4L9M A;  2YUU A;  2ENN A;  2FNF X;  3UFF A;  1XA6 A;  3KY9 A;  4UXI A;  3UGL A;  1XBT A;  2ORW A;  4FKD A;  2VRW B;  3UEJ A;  2DB6 A;  1R79 A;  2GVI A;  2JA1 A;  1PTR A;  2ORV A; 
#chains in the Genus database with same CATH topology
 3E2I A;  4A24 A;  1TBN A;  2RIJ A;  4HGU A;  1TIH A;  3R5D A;  1RFH A;  3TOB A;  1HEV A;  1TUR A;  1CGI I;  2JW6 A;  2X3T A;  1X74 A;  2JZM A;  1FY7 A;  2UVO A;  9WGA A;  1Y1C A;  1Q9B A;  2B0U C;  2NU3 I;  3OXF A;  7WGA A;  3SGQ I;  1PTQ A;  2QQ0 A;  1WGT A;  3QAH A;  3TJQ A;  3TO7 A;  1K7T A;  2WGC A;  1DS2 I;  1PPF I;  3HH2 C;  1HJA I;  1YU6 C;  3GOX A;  2QQC A;  1FAR A;  1MJB A;  2J9R A;  2SGQ I;  1BUS A;  1CT2 I;  4JCV E;  1CSO I;  1FAQ A;  2SGF I;  2CWF A;  1OYV I;  1NXU A;  4L9M A;  3OL0 A;  3OXG A;  4E1R A;  2F3C I;  3KY9 A;  5EX0 A;  3E59 A;  4UXI A;  1XBT A;  2ORW A;  4DNC A;  4FKD A;  2VRW B;  4OVO A;  2N71 A;  1WTJ A;  2JXD A;  4E1P A;  2GKV A;  1NUB A;  1XX6 A;  2K9H A;  1M8C A;  1ULK A;  2LB7 A;  2KMQ A;  1M8B A;  3TO6 A;  1SGN I;  2SGP I;  4B6D A;  1UUC A;  2QQE A;  1BMO A;  5E3P A;  1V1H A;  1ULM A;  1CE3 A;  1MJA A;  2SGD I;  1DS3 I;  2WVJ A;  5FUV A;  3SEK C;  4UXJ A;  3OXL A;  3UEY A;  1UHA A;  2LUY A;  2ENZ A;  5DAE A;  1UVF A;  1TUS A;  1Y1B A;  1K7V A;  5CCL A;  5HQ8 A;  2N52 A;  2E5R A;  4WP4 A;  2WCY A;  5JHW C;  1IY6 A;  2A20 A;  1PJU A;  1TBQ R;  5J8F A;  3MEK A;  1HDL A;  2GIV A;  1MJ9 A;  1Z2I A;  2ERW A;  2YQP A;  1X4S A;  3VDP A;  1XA6 A;  1TBR R;  3TOA A;  2V53 A;  1TGS I;  3VDU A;  1MT1 A;  2GVI A;  2OU2 A;  4GI3 C;  2V1C A;  4SGB I;  2CWH A;  2N17 A;  1SGQ I;  2ELI A;  2N1A B;  2ORV A;  3SGB I;  2KCX A;  3B4V C;  2KMP A;  2ODD A;  2OD1 A;  1IW4 A;  1YTP A;  1UVG A;  5CCM A;  1R0R I;  2E73 A;  3CXL A;  2PQ8 A;  1IY5 A;  1P9Z A;  3RU0 A;  2DIP A;  2KMO A;  1OMT A;  2NU4 I;  2P6A C;  1Y8F A;  3VE5 A;  5EX3 A;  2GKR I;  2Y0M A;  1KMA A;  2V1C C;  1TOT A;  3R5A A;  5E3Q A;  1OVO A;  2OVO A;  2QPO A;  3QTL D;  2BUS A;  3OVO A;  1P9G A;  1V1I A;  2NU0 I;  5FUY A;  3UGI A;  1H0Z A;  2ARP F;  2UZ3 A;  1LR9 A;  5FUW A;  2NU1 I;  1PCE A;  2ENN A;  2FNF X;  1Z7K B;  3FSX A;  3UFF A;  1WGC A;  3UGL A;  2CJS C;  3UEJ A;  2OZU A;  2QQD A;  3UOE A;  1SGD I;  2LEO A;  2JA1 A;  2XRC A;  3QWP A;  1CT0 I;  2KMR A;  1LR7 A;  1TBO A;  1U5K A;  1WKX A;  3FSY A;  1ULN A;  1FYB A;  1KBF A;  2CWG A;  2ROW A;  5E3R A;  1LR8 A;  1W4R A;  2DKV A;  3UGD A;  1K7U A;  2GKT I;  1W3S A;  2NU2 I;  3R5C A;  4UXH A;  1KBE A;  2L8E A;  2W0T A;  3PDN A;  1CT4 I;  2B8T A;  2X52 A;  2M5X A;  5FUX A;  1SGR I;  2J87 A;  1SGE I;  1AN1 I;  1OMU A;  3BJI A;  3D00 A;  3TO9 A;  1CGJ I;  1CHO I;  1HPT A;  5HI7 A;  2RC4 A;  2YUU A;  2SGE I;  4MPI A;  1SGY I;  5J8C A;  4AML A;  3FC3 A;  1S20 A;  1SGP I;  2DB6 A;  2JYY A;  1R79 A;  1N13 A;  3R5B A;  1VDD A;  1PTR A;  2L7X A; 
#chains in the Genus database with same CATH homology
 3E2I A;  4A24 A;  1TBN A;  4HGU A;  1TIH A;  1RFH A;  1TUR A;  1CGI I;  2JW6 A;  1X74 A;  2JZM A;  1Y1C A;  2B0U C;  2NU3 I;  3OXF A;  3SGQ I;  1PTQ A;  2QQ0 A;  3TJQ A;  1DS2 I;  1PPF I;  3HH2 C;  1HJA I;  1YU6 C;  3GOX A;  2QQC A;  1FAR A;  2J9R A;  2SGQ I;  1BUS A;  1CT2 I;  4JCV E;  1CSO I;  1FAQ A;  2SGF I;  1OYV I;  4L9M A;  3OL0 A;  3OXG A;  4E1R A;  2F3C I;  3KY9 A;  5EX0 A;  3E59 A;  4UXI A;  1XBT A;  2ORW A;  4FKD A;  2VRW B;  4OVO A;  2N71 A;  2JXD A;  4E1P A;  2GKV A;  1NUB A;  1XX6 A;  2K9H A;  1M8C A;  2KMQ A;  1M8B A;  1SGN I;  2SGP I;  4B6D A;  1UUC A;  2QQE A;  1BMO A;  1V1H A;  1CE3 A;  2WVJ A;  2SGD I;  1DS3 I;  5FUV A;  3SEK C;  3UEY A;  4UXJ A;  3OXL A;  2LUY A;  2ENZ A;  5DAE A;  1UVF A;  1TUS A;  1Y1B A;  5CCL A;  5HQ8 A;  2N52 A;  2E5R A;  2WCY A;  5JHW C;  1IY6 A;  2A20 A;  1PJU A;  1TBQ R;  1HDL A;  3MEK A;  2ERW A;  2YQP A;  1X4S A;  3VDP A;  1XA6 A;  1TBR R;  2V53 A;  1TGS I;  3VDU A;  1MT1 A;  2GVI A;  4GI3 C;  2V1C A;  4SGB I;  2N17 A;  2ORV A;  1SGQ I;  2ELI A;  2N1A B;  3SGB I;  2KCX A;  3B4V C;  2KMP A;  2ODD A;  2OD1 A;  1IW4 A;  1YTP A;  1UVG A;  5CCM A;  1R0R I;  2E73 A;  3CXL A;  1IY5 A;  3RU0 A;  2DIP A;  2KMO A;  1OMT A;  2NU4 I;  2P6A C;  1Y8F A;  3VE5 A;  5EX3 A;  2GKR I;  1KMA A;  2V1C C;  1TOT A;  1OVO A;  2OVO A;  2QPO A;  3QTL D;  2BUS A;  3OVO A;  1V1I A;  2NU0 I;  5FUY A;  1H0Z A;  3UGI A;  2ARP F;  2UZ3 A;  1LR9 A;  5FUW A;  2NU1 I;  1PCE A;  2ENN A;  2FNF X;  1Z7K B;  3UFF A;  3UGL A;  2CJS C;  3UEJ A;  2QQD A;  1SGD I;  2LEO A;  2JA1 A;  2XRC A;  3QWP A;  1CT0 I;  2KMR A;  1LR7 A;  1TBO A;  1U5K A;  1KBF A;  1FYB A;  2ROW A;  3UGD A;  1LR8 A;  1W4R A;  2GKT I;  1W3S A;  2NU2 I;  4UXH A;  1KBE A;  2L8E A;  2W0T A;  3PDN A;  1CT4 I;  2B8T A;  2M5X A;  5FUX A;  1SGR I;  2J87 A;  1SGE I;  1AN1 I;  1OMU A;  3BJI A;  3D00 A;  1CGJ I;  1CHO I;  1HPT A;  5HI7 A;  2YUU A;  2SGE I;  1SGY I;  3FC3 A;  1SGP I;  2DB6 A;  2JYY A;  1R79 A;  1N13 A;  1VDD A;  1PTR A;  2L7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...