1KBFA

Solution structure of the cysteine-rich c1 domain of kinase suppressor of ras
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
49
structure length
49
Chain Sequence
GSVTHRFSTKSWLSQVCNVCQKSMIFGVKCKHCRLKCHNKCTKEAPACR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Kinase Suppressor of Ras
publication title Solution structure and functional analysis of the cysteine-rich C1 domain of kinase suppressor of Ras (KSR).
pubmed doi rcsb
source organism Mus musculus
total genus 3
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2001-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1kbfA00
3UEJA 2QQEA 2UZ3A 2J9RA 2QQ0A 3UGIA 1XX6A 1TBOA 3UEYA 3UFFA 3UGLA 2J87A 4L9MA 1FAQA 4UXHA 3UGDA 1PTQA 2ENZA 1TBNA 2ELIA 2JA1A 2ROWA 4UXIA 1KBFA 1FARA 2QPOA 2DB6A 1RFHA 2E73A 1PTRA 2FNFX 2YUUA 1R79A 3CXLA 1Y8FA 5FUVA 2B8TA 4UXJA 2ENNA 5FUXA 5FUWA 1XA6A 3E2IA 2ORVA 5FUYA 1XBTA 3BJIA 2VRWB 2GVIA 3KY9A 2WVJA 2ORWA 4FKDA 1W4RA 4B6DA 1KBEA
chains in the Genus database with same CATH superfamily
2GKRI 1X4SA 2JW6A 1K7TA 4GI3C 2NU2I 2KMOA 2E5RA 2NU1I 3UFFA 2WGCA 1MJAA 3GOXA 3UGLA 1WTJA 2B0UC 2SGQI 1NXUA 1TBRR 1K7VA 2OU2A 3FC3A 2XRCA 1P9ZA 1TBNA 2A20A 2ELIA 5E3RA 2RIJA 2CWFA 2QPOA 1CGJI 2GKTI 1RFHA 2E73A 2YUUA 3PDNA 2ARPF 3VDPA 1FYBA 1DS2I 5CCLA 1ULKA 1WKXA 4OVOA 2NU4I 1TGSI 1CSOI 1SGRI 2BUSA 3D00A 3E2IA 3QTLD 2ORVA 5FUYA 1HJAI 1R0RI 3B4VC 1UUCA 1MT1A 1LR7A 3R5DA 2VRWB 1BUSA 2WVJA 1PPFI 4FKDA 3FSYA 1TUSA 2X52A 2QQEA 4MPIA 2QQ0A 4JCVE 3SGBI 3OXLA 2Y0MA 2SGPI 5EX3A 1IY6A 1TBOA 1N13A 2V53A 1Z2IA 1MJ9A 2KMQA 5HI7A 1YU6C 2NU3I 4SGBI 2KMRA 3TOBA 4E1PA 1V1IA 1PTQA 1MJBA 1CT0I 2JA1A 1TOTA 1YTPA 3FSXA 3UEYA 1HPTA 5EX0A 2GIVA 3VE5A 1ULMA 2FNFX 1Y8FA 2KMPA 1TBQR 2OZUA 4UXJA 1X74A 1FY7A 5FUVA 3R5AA 1P9GA 2N71A 5FUWA 4DNCA 2ODDA 3SGQI 1Z7KB 5J8FA 2LEOA 5J8CA 2LB7A 2UVOA 1M8CA 3BJIA 3E59A 2JYYA 2CWHA 2ORWA 3OXGA 2QQDA 1Y1BA 2CWGA 2QQCA 9WGAA 2V1CC 1SGDI 3UEJA 4E1RA 1TURA 2DIPA 1LR8A 2UZ3A 1CGII 1HEVA 2YQPA 1TIHA 2F3CI 1PJUA 1U5KA 1Y1CA 1SGNI 1LR9A 1OVOA 2N1AB 2NU0I 2OD1A 1SGPI 2X3TA 3MEKA 2JXDA 4B6DA 1OYVI 1UVGA 4UXHA 2ENZA 2W0TA 5DAEA 2ROWA 2L8EA 2PQ8A 4UXIA 1IW4A 1KBFA 1CHOI 1FARA 3HH2C 4HGUA 2DB6A 3CXLA 1OMUA 1PTRA 1SGYI 2N17A 1V1HA 2L7XA 2LUYA 2B8TA 2CJSC 4WP4A 2SGEI 2ENNA 1SGQI 1W3SA 1KMAA 1XA6A 1XBTA 3TJQA 2KCXA 3QAHA 3KY9A 5E3PA 4A24A 1DS3I 2N52A 3TO7A 2J9RA 1UVFA 2K9HA 3UGIA 1XX6A 1SGEI 1VDDA 2DKVA 3OL0A 1AN1I 2J87A 3OXFA 5CCMA 1H0ZA 2GKVA 4L9MA 1KBEA 1FAQA 3UGDA 5HQ8A 2SGDI 1CT2I 1WGTA 1K7UA 2SGFI 1PCEA 1S20A 3RU0A 4AMLA 1HDLA 3TO9A 3R5CA 1IY5A 2ERWA 3TOAA 1UHAA 3R5BA 1OMTA 1R79A 1Q9BA 5JHWC 3OVOA 5FUXA 1WGCA 2V1CA 2JZMA 2M5XA 3SEKC 7WGAA 1BMOA 2OVOA 3TO6A 2WCYA 1NUBA 1M8BA 2P6AC 2GVIA 3UOEA 3VDUA 1CE3A 5E3QA 1W4RA 1ULNA 2RC4A 3QWPA 1CT4I
chains in the Genus database with same CATH topology
2GKRI 1X4SA 2JW6A 4GI3C 2NU2I 2KMOA 2E5RA 2NU1I 3UFFA 3GOXA 3UGLA 2SGQI 2B0UC 3FC3A 1TBRR 2XRCA 1TBNA 2A20A 2ELIA 2QPOA 1CGJI 2GKTI 1RFHA 2E73A 2YUUA 3PDNA 2ARPF 3VDPA 1FYBA 1DS2I 5CCLA 4OVOA 2NU4I 1TGSI 1CSOI 1SGRI 2BUSA 3D00A 3E2IA 3QTLD 2ORVA 5FUYA 1HJAI 1R0RI 3B4VC 1UUCA 1MT1A 1LR7A 2VRWB 1BUSA 2WVJA 1PPFI 4FKDA 1TUSA 2QQEA 2QQ0A 4JCVE 3SGBI 3OXLA 2SGPI 5EX3A 1IY6A 1TBOA 1N13A 2V53A 2KMQA 5HI7A 1YU6C 2NU3I 4SGBI 2KMRA 4E1PA 1V1IA 1PTQA 2JA1A 1CT0I 3UEYA 1TOTA 1YTPA 1HPTA 5EX0A 3VE5A 2FNFX 1Y8FA 2KMPA 1TBQR 4UXJA 5FUVA 1X74A 2N71A 5FUWA 2ODDA 3SGQI 1Z7KB 2LEOA 1M8CA 3BJIA 3E59A 2JYYA 2ORWA 3OXGA 2QQDA 1Y1BA 2QQCA 2V1CC 1SGDI 3UEJA 1TURA 2DIPA 1LR8A 2UZ3A 1CGII 2YQPA 1TIHA 2F3CI 1PJUA 1U5KA 1Y1CA 1SGNI 1LR9A 1OVOA 2N1AB 2NU0I 2OD1A 1SGPI 3MEKA 4E1RA 2JXDA 1OYVI 1UVGA 4UXHA 2ENZA 2W0TA 5DAEA 2ROWA 2L8EA 4UXIA 1KBFA 1IW4A 1CHOI 1FARA 3HH2C 4HGUA 2DB6A 3CXLA 1OMUA 1PTRA 1SGYI 2N17A 1V1HA 2L7XA 2LUYA 2B8TA 2CJSC 2SGEI 2ENNA 1SGQI 1W3SA 1KMAA 1XA6A 1XBTA 3TJQA 2KCXA 3KY9A 4A24A 1DS3I 2N52A 2J9RA 1UVFA 2K9HA 3UGIA 1XX6A 1SGEI 1VDDA 3OL0A 1AN1I 2J87A 3OXFA 5CCMA 1H0ZA 2GKVA 4L9MA 1KBEA 1FAQA 3UGDA 5HQ8A 2SGDI 1CT2I 3RU0A 2SGFI 1HDLA 1PCEA 1IY5A 2ERWA 1OMTA 1R79A 5JHWC 3OVOA 5FUXA 2V1CA 2JZMA 2M5XA 3SEKC 1BMOA 2OVOA 2WCYA 1NUBA 1M8BA 2P6AC 2GVIA 1CE3A 3VDUA 1W4RA 4B6DA 3QWPA 1CT4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UEJ A;  2QQE A;  2UZ3 A;  2J9R A;  2QQ0 A;  3UGI A;  1XX6 A;  1TBO A;  3UEY A;  3UFF A;  3UGL A;  2J87 A;  4L9M A;  1FAQ A;  4UXH A;  3UGD A;  1PTQ A;  2ENZ A;  1TBN A;  2ELI A;  2JA1 A;  2ROW A;  4UXI A;  1KBF A;  1FAR A;  2QPO A;  2DB6 A;  1RFH A;  2E73 A;  1PTR A;  2FNF X;  2YUU A;  1R79 A;  3CXL A;  1Y8F A;  5FUV A;  2B8T A;  4UXJ A;  2ENN A;  5FUX A;  5FUW A;  1XA6 A;  3E2I A;  2ORV A;  5FUY A;  1XBT A;  3BJI A;  2VRW B;  2GVI A;  3KY9 A;  2WVJ A;  2ORW A;  4FKD A;  1W4R A;  4B6D A;  1KBE A; 
#chains in the Genus database with same CATH topology
 2GKR I;  1X4S A;  2JW6 A;  1K7T A;  4GI3 C;  2NU2 I;  2KMO A;  2E5R A;  2NU1 I;  3UFF A;  2WGC A;  1MJA A;  3GOX A;  3UGL A;  1WTJ A;  2B0U C;  2SGQ I;  1NXU A;  1TBR R;  1K7V A;  2OU2 A;  3FC3 A;  2XRC A;  1P9Z A;  1TBN A;  2A20 A;  2ELI A;  5E3R A;  2RIJ A;  2CWF A;  2QPO A;  1CGJ I;  2GKT I;  1RFH A;  2E73 A;  2YUU A;  3PDN A;  2ARP F;  3VDP A;  1FYB A;  1DS2 I;  5CCL A;  1ULK A;  1WKX A;  4OVO A;  2NU4 I;  1TGS I;  1CSO I;  1SGR I;  2BUS A;  3D00 A;  3E2I A;  3QTL D;  2ORV A;  5FUY A;  1HJA I;  1R0R I;  3B4V C;  1UUC A;  1MT1 A;  1LR7 A;  3R5D A;  2VRW B;  1BUS A;  2WVJ A;  1PPF I;  4FKD A;  3FSY A;  1TUS A;  2X52 A;  2QQE A;  4MPI A;  2QQ0 A;  4JCV E;  3SGB I;  3OXL A;  2Y0M A;  2SGP I;  5EX3 A;  1IY6 A;  1TBO A;  1N13 A;  2V53 A;  1Z2I A;  1MJ9 A;  2KMQ A;  5HI7 A;  1YU6 C;  2NU3 I;  4SGB I;  2KMR A;  3TOB A;  4E1P A;  1V1I A;  1PTQ A;  1MJB A;  1CT0 I;  2JA1 A;  1TOT A;  1YTP A;  3FSX A;  3UEY A;  1HPT A;  5EX0 A;  2GIV A;  3VE5 A;  1ULM A;  2FNF X;  1Y8F A;  2KMP A;  1TBQ R;  2OZU A;  4UXJ A;  1X74 A;  1FY7 A;  5FUV A;  3R5A A;  1P9G A;  2N71 A;  5FUW A;  4DNC A;  2ODD A;  3SGQ I;  1Z7K B;  5J8F A;  2LEO A;  5J8C A;  2LB7 A;  2UVO A;  1M8C A;  3BJI A;  3E59 A;  2JYY A;  2CWH A;  2ORW A;  3OXG A;  2QQD A;  1Y1B A;  2CWG A;  2QQC A;  9WGA A;  2V1C C;  1SGD I;  3UEJ A;  4E1R A;  1TUR A;  2DIP A;  1LR8 A;  2UZ3 A;  1CGI I;  1HEV A;  2YQP A;  1TIH A;  2F3C I;  1PJU A;  1U5K A;  1Y1C A;  1SGN I;  1LR9 A;  1OVO A;  2N1A B;  2NU0 I;  2OD1 A;  1SGP I;  2X3T A;  3MEK A;  2JXD A;  4B6D A;  1OYV I;  1UVG A;  4UXH A;  2ENZ A;  2W0T A;  5DAE A;  2ROW A;  2L8E A;  2PQ8 A;  4UXI A;  1IW4 A;  1KBF A;  1CHO I;  1FAR A;  3HH2 C;  4HGU A;  2DB6 A;  3CXL A;  1OMU A;  1PTR A;  1SGY I;  2N17 A;  1V1H A;  2L7X A;  2LUY A;  2B8T A;  2CJS C;  4WP4 A;  2SGE I;  2ENN A;  1SGQ I;  1W3S A;  1KMA A;  1XA6 A;  1XBT A;  3TJQ A;  2KCX A;  3QAH A;  3KY9 A;  5E3P A;  4A24 A;  1DS3 I;  2N52 A;  3TO7 A;  2J9R A;  1UVF A;  2K9H A;  3UGI A;  1XX6 A;  1SGE I;  1VDD A;  2DKV A;  3OL0 A;  1AN1 I;  2J87 A;  3OXF A;  5CCM A;  1H0Z A;  2GKV A;  4L9M A;  1KBE A;  1FAQ A;  3UGD A;  5HQ8 A;  2SGD I;  1CT2 I;  1WGT A;  1K7U A;  2SGF I;  1PCE A;  1S20 A;  3RU0 A;  4AML A;  1HDL A;  3TO9 A;  3R5C A;  1IY5 A;  2ERW A;  3TOA A;  1UHA A;  3R5B A;  1OMT A;  1R79 A;  1Q9B A;  5JHW C;  3OVO A;  5FUX A;  1WGC A;  2V1C A;  2JZM A;  2M5X A;  3SEK C;  7WGA A;  1BMO A;  2OVO A;  3TO6 A;  2WCY A;  1NUB A;  1M8B A;  2P6A C;  2GVI A;  3UOE A;  3VDU A;  1CE3 A;  5E3Q A;  1W4R A;  1ULN A;  2RC4 A;  3QWP A;  1CT4 I; 
#chains in the Genus database with same CATH homology
 2GKR I;  1X4S A;  2JW6 A;  4GI3 C;  2NU2 I;  2KMO A;  2E5R A;  2NU1 I;  3UFF A;  3GOX A;  3UGL A;  2SGQ I;  2B0U C;  3FC3 A;  1TBR R;  2XRC A;  1TBN A;  2A20 A;  2ELI A;  2QPO A;  1CGJ I;  2GKT I;  1RFH A;  2E73 A;  2YUU A;  3PDN A;  2ARP F;  3VDP A;  1FYB A;  1DS2 I;  5CCL A;  4OVO A;  2NU4 I;  1TGS I;  1CSO I;  1SGR I;  2BUS A;  3D00 A;  3E2I A;  3QTL D;  2ORV A;  5FUY A;  1HJA I;  1R0R I;  3B4V C;  1UUC A;  1MT1 A;  1LR7 A;  2VRW B;  1BUS A;  2WVJ A;  1PPF I;  4FKD A;  1TUS A;  2QQE A;  2QQ0 A;  4JCV E;  3SGB I;  3OXL A;  2SGP I;  5EX3 A;  1IY6 A;  1TBO A;  1N13 A;  2V53 A;  2KMQ A;  5HI7 A;  1YU6 C;  2NU3 I;  4SGB I;  2KMR A;  4E1P A;  1V1I A;  1PTQ A;  2JA1 A;  1CT0 I;  3UEY A;  1TOT A;  1YTP A;  1HPT A;  5EX0 A;  3VE5 A;  2FNF X;  1Y8F A;  2KMP A;  1TBQ R;  4UXJ A;  5FUV A;  1X74 A;  2N71 A;  5FUW A;  2ODD A;  3SGQ I;  1Z7K B;  2LEO A;  1M8C A;  3BJI A;  3E59 A;  2JYY A;  2ORW A;  3OXG A;  2QQD A;  1Y1B A;  2QQC A;  2V1C C;  1SGD I;  3UEJ A;  1TUR A;  2DIP A;  1LR8 A;  2UZ3 A;  1CGI I;  2YQP A;  1TIH A;  2F3C I;  1PJU A;  1U5K A;  1Y1C A;  1SGN I;  1LR9 A;  1OVO A;  2N1A B;  2NU0 I;  2OD1 A;  1SGP I;  3MEK A;  4E1R A;  2JXD A;  1OYV I;  1UVG A;  4UXH A;  2ENZ A;  2W0T A;  5DAE A;  2ROW A;  2L8E A;  4UXI A;  1KBF A;  1IW4 A;  1CHO I;  1FAR A;  3HH2 C;  4HGU A;  2DB6 A;  3CXL A;  1OMU A;  1PTR A;  1SGY I;  2N17 A;  1V1H A;  2L7X A;  2LUY A;  2B8T A;  2CJS C;  2SGE I;  2ENN A;  1SGQ I;  1W3S A;  1KMA A;  1XA6 A;  1XBT A;  3TJQ A;  2KCX A;  3KY9 A;  4A24 A;  1DS3 I;  2N52 A;  2J9R A;  1UVF A;  2K9H A;  3UGI A;  1XX6 A;  1SGE I;  1VDD A;  3OL0 A;  1AN1 I;  2J87 A;  3OXF A;  5CCM A;  1H0Z A;  2GKV A;  4L9M A;  1KBE A;  1FAQ A;  3UGD A;  5HQ8 A;  2SGD I;  1CT2 I;  3RU0 A;  2SGF I;  1HDL A;  1PCE A;  1IY5 A;  2ERW A;  1OMT A;  1R79 A;  5JHW C;  3OVO A;  5FUX A;  2V1C A;  2JZM A;  2M5X A;  3SEK C;  1BMO A;  2OVO A;  2WCY A;  1NUB A;  1M8B A;  2P6A C;  2GVI A;  1CE3 A;  3VDU A;  1W4R A;  4B6D A;  3QWP A;  1CT4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...