1KBFA

Solution structure of the cysteine-rich c1 domain of kinase suppressor of ras
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
49
structure length
49
Chain Sequence
b'GSVTHRFSTKSWLSQVCNVCQKSMIFGVKCKHCRLKCHNKCTKEAPACR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure and functional analysis of the cysteine-rich C1 domain of kinase suppressor of Ras (KSR).
pubmed doi rcsb
molecule keywords Kinase Suppressor of Ras
source organism Mus musculus
molecule tags Signaling protein
total genus 3
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2001-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1kbfA00
1RFHA 4UXJA 1XBTA 3UGDA 1KBFA 2ORWA 3BJIA 1TBOA 3UEJA 1FAQA 2B8TA 2ENZA 2QQ0A 4L9MA 4B6DA 5FUWA 2QQEA 3E2IA 2DB6A 1W4RA 2WVJA 5FUVA 4UXIA 3UGIA 3UGLA 2ELIA 2J9RA 1FARA 2E73A 1PTQA 3KY9A 2QPOA 3UFFA 2ENNA 4FKDA 2FNFX 2JA1A 1XA6A 4UXHA 2ROWA 2VRWB 1PTRA 2ORVA 1KBEA 2UZ3A 2YUUA 1Y8FA 1TBNA 1XX6A 2GVIA 2J87A 3UEYA 5FUYA 5FUXA 1R79A 3CXLA
chains in the Genus database with same CATH superfamily
3UOEA 1LR9A 3R5AA 3B4VC 1MJAA 1V1IA 2NU3I 2X3TA 2DIPA 1KBFA 1SGQI 2ORWA 1ULKA 1CGJI 1PPFI 1TBOA 1AN1I 1UVFA 2F3CI 1CHOI 2ARPF 2KMPA 2SGFI 5EX3A 4DNCA 2L7XA 2NU4I 2Y0MA 1S20A 2OZUA 5DAEA 3FSYA 1VDDA 2KMRA 2PQ8A 1W4RA 1SGDI 1V1HA 2N1AB 2YQPA 4UXIA 1ULMA 3UGLA 1UHAA 2SGDI 2L8EA 2J9RA 1YTPA 1FARA 5E3RA 1PTQA 1X74A 1Y1CA 4FKDA 3RU0A 1TBQR 5CCLA 3SEKC 2RC4A 1SGYI 3SGQI 2OU2A 1TBNA 1BUSA 1XX6A 2RIJA 3UEYA 2QQCA 4AMLA 1K7TA 3CXLA 3TO6A 3OXFA 1NXUA 2KMQA 1PJUA 1BMOA 1H0ZA 1TUSA 4JCVE 1HDLA 1PCEA 1OYVI 2KCXA 1M8BA 2GKTI 2B8TA 3UEJA 1FAQA 4B6DA 1CE3A 1CT2I 2N52A 5FUWA 2DB6A 1FY7A 1YU6C 2N71A 2WVJA 5FUVA 3UGIA 2SGQI 2QQDA 1Z7KB 1K7UA 1MJBA 2E73A 3KY9A 3PDNA 2QPOA 1FYBA 1CT4I 1WKXA 3QAHA 3UFFA 2FNFX 2K9HA 2P6AC 4SGBI 5J8CA 1WGCA 2B0UC 2M5XA 1SGEI 1TIHA 2ROWA 3HH2C 3E59A 2CJSC 2LUYA 2V1CA 2UZ3A 1SGRI 3VDPA 2GVIA 1R0RI 1Z2IA 1OMTA 1P9GA 1TOTA 1Y1BA 4E1PA 5JHWC 1M8CA 1CSOI 1RFHA 2N17A 4OVOA 4UXJA 2V1CC 2W0TA 3TO9A 3UGDA 1N13A 2OVOA 5HQ8A 2NU1I 3BJIA 4MPIA 1ULNA 1SGPI 2ENZA 2QQ0A 3OXGA 2QQEA 2BUSA 2LB7A 1MJ9A 3QWPA 9WGAA 1OMUA 1HJAI 1NUBA 2SGEI 4WP4A 2JYYA 2SGPI 2CWHA 2XRCA 2NU2I 1WGTA 2JA1A 1XA6A 1TGSI 3TOBA 1SGNI 1K7VA 5HI7A 1KBEA 1Q9BA 3GOXA 1Y8FA 2E5RA 2GKVA 4HGUA 5FUYA 2X52A 3VE5A 2V53A 5E3PA 2KMOA 2WCYA 5J8FA 3OVOA 1IY6A 1R79A 3QTLD 2DKVA 4E1RA 2CWFA 2LEOA 1DS3I 2GIVA 2ODDA 1IW4A 1X4SA 2JZMA 4GI3C 1XBTA 1TURA 3MEKA 3TOAA 5EX0A 2OD1A 3OXLA 1LR7A 1UUCA 2CWGA 2UVOA 4L9MA 1CGII 1OVOA 1HEVA 3E2IA 3SGBI 1P9ZA 3TJQA 1CT0I 1MT1A 2JW6A 5E3QA 2ELIA 1KMAA 2GKRI 3R5CA 1WTJA 1DS2I 2JXDA 1UVGA 2ERWA 3D00A 3R5BA 2ENNA 5CCMA 1IY5A 4UXHA 3VDUA 2VRWB 3FSXA 3R5DA 4A24A 1PTRA 2ORVA 2WGCA 2NU0I 2YUUA 1TBRR 3OL0A 2A20A 7WGAA 3FC3A 1U5KA 2J87A 1HPTA 5FUXA 1LR8A 3TO7A 1W3SA
chains in the Genus database with same CATH topology
1LR9A 3B4VC 1V1IA 2NU3I 2DIPA 1KBFA 1SGQI 2ORWA 5EX3A 1CGJI 1PPFI 1TBOA 1AN1I 1UVFA 2F3CI 1CHOI 2ARPF 2KMPA 2SGFI 2L7XA 2NU4I 5DAEA 1VDDA 2KMRA 1W4RA 1SGDI 1V1HA 2N1AB 2YQPA 4UXIA 3UGLA 2SGDI 2L8EA 2J9RA 1YTPA 1FARA 1PTQA 1X74A 1Y1CA 4FKDA 3RU0A 1TBQR 5CCLA 3SEKC 1SGYI 3SGQI 1TBNA 1BUSA 1XX6A 3UEYA 2QQCA 3CXLA 3OXFA 2KMQA 1PJUA 1BMOA 1H0ZA 1TUSA 4JCVE 1HDLA 1PCEA 1OYVI 2KCXA 1M8BA 2GKTI 2B8TA 3UEJA 1FAQA 4B6DA 1CE3A 1CT2I 2N52A 5FUWA 2DB6A 2WVJA 1YU6C 2N71A 5FUVA 3UGIA 2SGQI 2QQDA 1Z7KB 2E73A 3PDNA 3KY9A 1FYBA 2QPOA 1CT4I 3UFFA 2FNFX 2K9HA 2P6AC 4SGBI 2B0UC 2M5XA 1SGEI 1TIHA 2ROWA 3HH2C 3E59A 2CJSC 2LUYA 2V1CA 2UZ3A 1SGRI 3VDPA 2GVIA 1R0RI 1OMTA 1TOTA 1Y1BA 4E1PA 5JHWC 1M8CA 1CSOI 1RFHA 2N17A 4OVOA 4UXJA 2V1CC 2W0TA 3UGDA 1N13A 2OVOA 5HQ8A 2NU1I 3BJIA 1SGPI 2ENZA 2QQ0A 3OXGA 2QQEA 2BUSA 3QWPA 1OMUA 1HJAI 1NUBA 2SGEI 2JYYA 2SGPI 2XRCA 2NU2I 2JA1A 1XA6A 1TGSI 1SGNI 5HI7A 1KBEA 3GOXA 1Y8FA 2E5RA 2GKVA 4HGUA 5FUYA 3VE5A 2V53A 2KMOA 2WCYA 3OVOA 1IY6A 1R79A 3QTLD 4E1RA 2LEOA 1DS3I 2ODDA 1IW4A 1X4SA 2JZMA 4GI3C 1XBTA 1TURA 3MEKA 5EX0A 2OD1A 3OXLA 1LR7A 1UUCA 4L9MA 1CGII 1OVOA 3E2IA 3SGBI 3TJQA 1CT0I 1MT1A 2JW6A 2ELIA 1KMAA 2GKRI 1DS2I 2JXDA 1UVGA 2ERWA 3D00A 5CCMA 2ENNA 1IY5A 4UXHA 3VDUA 2VRWB 4A24A 1PTRA 2ORVA 2NU0I 2YUUA 1TBRR 3OL0A 2A20A 3FC3A 1U5KA 2J87A 1HPTA 5FUXA 1LR8A 1W3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFH A;  4UXJ A;  1XBT A;  3UGD A;  1KBF A;  2ORW A;  3BJI A;  1TBO A;  3UEJ A;  1FAQ A;  2B8T A;  2ENZ A;  2QQ0 A;  4L9M A;  4B6D A;  5FUW A;  2QQE A;  3E2I A;  2DB6 A;  1W4R A;  2WVJ A;  5FUV A;  4UXI A;  3UGI A;  3UGL A;  2ELI A;  2J9R A;  1FAR A;  2E73 A;  1PTQ A;  3KY9 A;  2QPO A;  3UFF A;  2ENN A;  4FKD A;  2FNF X;  2JA1 A;  1XA6 A;  4UXH A;  2ROW A;  2VRW B;  1PTR A;  2ORV A;  1KBE A;  2UZ3 A;  2YUU A;  1Y8F A;  1TBN A;  1XX6 A;  2GVI A;  2J87 A;  3UEY A;  5FUY A;  5FUX A;  1R79 A;  3CXL A; 
#chains in the Genus database with same CATH topology
 3UOE A;  1LR9 A;  3R5A A;  3B4V C;  1MJA A;  1V1I A;  2NU3 I;  2X3T A;  2DIP A;  1KBF A;  1SGQ I;  2ORW A;  1ULK A;  1CGJ I;  1PPF I;  1TBO A;  1AN1 I;  1UVF A;  2F3C I;  1CHO I;  2ARP F;  2KMP A;  2SGF I;  5EX3 A;  4DNC A;  2L7X A;  2NU4 I;  2Y0M A;  1S20 A;  2OZU A;  5DAE A;  3FSY A;  1VDD A;  2KMR A;  2PQ8 A;  1W4R A;  1SGD I;  1V1H A;  2N1A B;  2YQP A;  4UXI A;  1ULM A;  3UGL A;  1UHA A;  2SGD I;  2L8E A;  2J9R A;  1YTP A;  1FAR A;  5E3R A;  1PTQ A;  1X74 A;  1Y1C A;  4FKD A;  3RU0 A;  1TBQ R;  5CCL A;  3SEK C;  2RC4 A;  1SGY I;  3SGQ I;  2OU2 A;  1TBN A;  1BUS A;  1XX6 A;  2RIJ A;  3UEY A;  2QQC A;  4AML A;  1K7T A;  3CXL A;  3TO6 A;  3OXF A;  1NXU A;  2KMQ A;  1PJU A;  1BMO A;  1H0Z A;  1TUS A;  4JCV E;  1HDL A;  1PCE A;  1OYV I;  2KCX A;  1M8B A;  2GKT I;  2B8T A;  3UEJ A;  1FAQ A;  4B6D A;  1CE3 A;  1CT2 I;  2N52 A;  5FUW A;  2DB6 A;  1FY7 A;  1YU6 C;  2N71 A;  2WVJ A;  5FUV A;  3UGI A;  2SGQ I;  2QQD A;  1Z7K B;  1K7U A;  1MJB A;  2E73 A;  3KY9 A;  3PDN A;  2QPO A;  1FYB A;  1CT4 I;  1WKX A;  3QAH A;  3UFF A;  2FNF X;  2K9H A;  2P6A C;  4SGB I;  5J8C A;  1WGC A;  2B0U C;  2M5X A;  1SGE I;  1TIH A;  2ROW A;  3HH2 C;  3E59 A;  2CJS C;  2LUY A;  2V1C A;  2UZ3 A;  1SGR I;  3VDP A;  2GVI A;  1R0R I;  1Z2I A;  1OMT A;  1P9G A;  1TOT A;  1Y1B A;  4E1P A;  5JHW C;  1M8C A;  1CSO I;  1RFH A;  2N17 A;  4OVO A;  4UXJ A;  2V1C C;  2W0T A;  3TO9 A;  3UGD A;  1N13 A;  2OVO A;  5HQ8 A;  2NU1 I;  3BJI A;  4MPI A;  1ULN A;  1SGP I;  2ENZ A;  2QQ0 A;  3OXG A;  2QQE A;  2BUS A;  2LB7 A;  1MJ9 A;  3QWP A;  9WGA A;  1OMU A;  1HJA I;  1NUB A;  2SGE I;  4WP4 A;  2JYY A;  2SGP I;  2CWH A;  2XRC A;  2NU2 I;  1WGT A;  2JA1 A;  1XA6 A;  1TGS I;  3TOB A;  1SGN I;  1K7V A;  5HI7 A;  1KBE A;  1Q9B A;  3GOX A;  1Y8F A;  2E5R A;  2GKV A;  4HGU A;  5FUY A;  2X52 A;  3VE5 A;  2V53 A;  5E3P A;  2KMO A;  2WCY A;  5J8F A;  3OVO A;  1IY6 A;  1R79 A;  3QTL D;  2DKV A;  4E1R A;  2CWF A;  2LEO A;  1DS3 I;  2GIV A;  2ODD A;  1IW4 A;  1X4S A;  2JZM A;  4GI3 C;  1XBT A;  1TUR A;  3MEK A;  3TOA A;  5EX0 A;  2OD1 A;  3OXL A;  1LR7 A;  1UUC A;  2CWG A;  2UVO A;  4L9M A;  1CGI I;  1OVO A;  1HEV A;  3E2I A;  3SGB I;  1P9Z A;  3TJQ A;  1CT0 I;  1MT1 A;  2JW6 A;  5E3Q A;  2ELI A;  1KMA A;  2GKR I;  3R5C A;  1WTJ A;  1DS2 I;  2JXD A;  1UVG A;  2ERW A;  3D00 A;  3R5B A;  2ENN A;  5CCM A;  1IY5 A;  4UXH A;  3VDU A;  2VRW B;  3FSX A;  3R5D A;  4A24 A;  1PTR A;  2ORV A;  2WGC A;  2NU0 I;  2YUU A;  1TBR R;  3OL0 A;  2A20 A;  7WGA A;  3FC3 A;  1U5K A;  2J87 A;  1HPT A;  5FUX A;  1LR8 A;  3TO7 A;  1W3S A; 
#chains in the Genus database with same CATH homology
 1LR9 A;  3B4V C;  1V1I A;  2NU3 I;  2DIP A;  1KBF A;  1SGQ I;  2ORW A;  5EX3 A;  1CGJ I;  1PPF I;  1TBO A;  1AN1 I;  1UVF A;  2F3C I;  1CHO I;  2ARP F;  2KMP A;  2SGF I;  2L7X A;  2NU4 I;  5DAE A;  1VDD A;  2KMR A;  1W4R A;  1SGD I;  1V1H A;  2N1A B;  2YQP A;  4UXI A;  3UGL A;  2SGD I;  2L8E A;  2J9R A;  1YTP A;  1FAR A;  1PTQ A;  1X74 A;  1Y1C A;  4FKD A;  3RU0 A;  1TBQ R;  5CCL A;  3SEK C;  1SGY I;  3SGQ I;  1TBN A;  1BUS A;  1XX6 A;  3UEY A;  2QQC A;  3CXL A;  3OXF A;  2KMQ A;  1PJU A;  1BMO A;  1H0Z A;  1TUS A;  4JCV E;  1HDL A;  1PCE A;  1OYV I;  2KCX A;  1M8B A;  2GKT I;  2B8T A;  3UEJ A;  1FAQ A;  4B6D A;  1CE3 A;  1CT2 I;  2N52 A;  5FUW A;  2DB6 A;  2WVJ A;  1YU6 C;  2N71 A;  5FUV A;  3UGI A;  2SGQ I;  2QQD A;  1Z7K B;  2E73 A;  3PDN A;  3KY9 A;  1FYB A;  2QPO A;  1CT4 I;  3UFF A;  2FNF X;  2K9H A;  2P6A C;  4SGB I;  2B0U C;  2M5X A;  1SGE I;  1TIH A;  2ROW A;  3HH2 C;  3E59 A;  2CJS C;  2LUY A;  2V1C A;  2UZ3 A;  1SGR I;  3VDP A;  2GVI A;  1R0R I;  1OMT A;  1TOT A;  1Y1B A;  4E1P A;  5JHW C;  1M8C A;  1CSO I;  1RFH A;  2N17 A;  4OVO A;  4UXJ A;  2V1C C;  2W0T A;  3UGD A;  1N13 A;  2OVO A;  5HQ8 A;  2NU1 I;  3BJI A;  1SGP I;  2ENZ A;  2QQ0 A;  3OXG A;  2QQE A;  2BUS A;  3QWP A;  1OMU A;  1HJA I;  1NUB A;  2SGE I;  2JYY A;  2SGP I;  2XRC A;  2NU2 I;  2JA1 A;  1XA6 A;  1TGS I;  1SGN I;  5HI7 A;  1KBE A;  3GOX A;  1Y8F A;  2E5R A;  2GKV A;  4HGU A;  5FUY A;  3VE5 A;  2V53 A;  2KMO A;  2WCY A;  3OVO A;  1IY6 A;  1R79 A;  3QTL D;  4E1R A;  2LEO A;  1DS3 I;  2ODD A;  1IW4 A;  1X4S A;  2JZM A;  4GI3 C;  1XBT A;  1TUR A;  3MEK A;  5EX0 A;  2OD1 A;  3OXL A;  1LR7 A;  1UUC A;  4L9M A;  1CGI I;  1OVO A;  3E2I A;  3SGB I;  3TJQ A;  1CT0 I;  1MT1 A;  2JW6 A;  2ELI A;  1KMA A;  2GKR I;  1DS2 I;  2JXD A;  1UVG A;  2ERW A;  3D00 A;  5CCM A;  2ENN A;  1IY5 A;  4UXH A;  3VDU A;  2VRW B;  4A24 A;  1PTR A;  2ORV A;  2NU0 I;  2YUU A;  1TBR R;  3OL0 A;  2A20 A;  3FC3 A;  1U5K A;  2J87 A;  1HPT A;  5FUX A;  1LR8 A;  1W3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...