5DAEA

Kazal type inhibitor from salivary glands of aedes aegypti mosquito
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
GVCACPRIYMPVCGSNLKTYNNDCLLRCEINSDLGRANNLRKIADQACDNLTDNVND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAEL006007-PA
publication title High-resolution structure of a Kazal-type serine protease inhibitor from the dengue vector Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Protein binding
total genus 14
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5daeA00
2KCXA 1IY6A 3TJQA 1M8CA 1SGDI 2QQDA 3B4VC 1LR9A 1LR8A 1LR7A 1CT2I 2NU3I 3HH2C 1Y1CA 2GKRI 1KMAA 2JXDA 2BUSA 1CT4I 2JZMA 1CHOI 1OMTA 2F3CI 1DS3I 1TGSI 3SEKC 1TBRR 2LEOA 2KMPA 2SGPI 3QTLD 2B0UC 2SGQI 1OYVI 1PJUA 1SGNI 1UUCA 3SGBI 1Y1BA 2SGEI 1PPFI 1YTPA 1TUSA 1SGQI 2NU0I 1CGII 1H0ZA 2N71A 2KMRA 2ERWA 1R0RI 2NU1I 1CGJI 3OVOA 1Z7KB 1OMUA 1M8BA 2M5XA 2XRCA 1AN1I 2N17A 1HPTA 1HDLA 1FYBA 4SGBI 2NU2I 2WCYA 1UVGA 1TIHA 2JYYA 1PCEA 1N13A 1BUSA 2N52A 1CE3A 1HJAI 2P6AC 2ARPF 1MT1A 1CSOI 2QQCA 1CT0I 5DAEA 1IY5A 2GKVA 2KMQA 1BMOA 2NU4I 2SGFI 4GI3C 2V53A 1SGEI 2KMOA 4HGUA 2SGDI 1IW4A 1UVFA 1SGRI 1YU6C 1TBQR 1SGYI 4OVOA 5JHWC 3SGQI 1DS2I 1NUBA 1OVOA 1SGPI 2OVOA 1TURA 2GKTI
chains in the Genus database with same CATH superfamily
2KCXA 4UXJA 1K7UA 2W0TA 1IY6A 2LUYA 1W3SA 1PTRA 3MEKA 1FY7A 3OXGA 1M8CA 3TJQA 1SGDI 2DIPA 2QQDA 3B4VC 1LR9A 4WP4A 1PTQA 3UGLA 4B6DA 1TOTA 1LR8A 3UEJA 3R5BA 1LR7A 1CT2I 1W4RA 1Y8FA 2K9HA 2NU3I 4JCVE 1K7VA 2QQEA 3HH2C 2CWHA 1Y1CA 2GKRI 5E3QA 2V1CC 1KMAA 2JXDA 2BUSA 2WVJA 3R5CA 1CT4I 5J8CA 1TBOA 1MJAA 2JZMA 1V1IA 1CHOI 3OXLA 1WTJA 2YQPA 2VRWB 1Z2IA 5E3PA 1OMTA 2F3CI 1X74A 1FARA 1KBFA 1DS3I 1TGSI 5FUYA 3SEKC 1TBRR 3OXFA 5HQ8A 2UVOA 9WGAA 2LEOA 2DKVA 2KMPA 1WGTA 2SGPI 3QTLD 4DNCA 4E1PA 3UGIA 4UXIA 1MJ9A 2B0UC 1XX6A 2SGQI 1OYVI 1PJUA 1SGNI 3OL0A 1UUCA 2E5RA 2Y0MA 3RU0A 1VDDA 2B8TA 1NXUA 2J87A 3BJIA 3TO7A 2JA1A 3UFFA 3TOAA 3SGBI 2DB6A 1Y1BA 2SGEI 1PPFI 4UXHA 3CXLA 5FUWA 2A20A 5FUVA 1X4SA 5CCLA 1TBNA 1YTPA 1TUSA 1SGQI 1ULNA 4E1RA 7WGAA 2NU0I 2RIJA 1CGII 4MPIA 1H0ZA 2N71A 4FKDA 2ENNA 1FAQA 4AMLA 3KY9A 2KMRA 3VE5A 3D00A 2CJSC 1U5KA 2ERWA 2YUUA 2WGCA 1UHAA 1KBEA 1P9GA 1R0RI 2NU1I 1CGJI 2OU2A 3OVOA 2J9RA 2ODDA 1Z7KB 1OMUA 2QPOA 5E3RA 1M8BA 2M5XA 2FNFX 3E2IA 2XRCA 2JW6A 3PDNA 1AN1I 1V1HA 2N17A 3UGDA 2GIVA 1HPTA 2X52A 2E73A 2ORVA 3FSYA 1RFHA 1HDLA 1FYBA 2ROWA 4SGBI 2NU2I 2WCYA 1UVGA 1TIHA 3QAHA 5HI7A 3UEYA 2JYYA 1PCEA 1N13A 1BUSA 1WKXA 2ENZA 2N52A 3TO6A 1CE3A 1ULKA 2CWGA 1HJAI 1S20A 1XA6A 1ULMA 5J8FA 1XBTA 2CWFA 2P6AC 2N1AB 2ARPF 1MT1A 3GOXA 1CSOI 2QQCA 1CT0I 5DAEA 3VDPA 4A24A 1IY5A 2GKVA 2GVIA 2KMQA 2L7XA 2RC4A 5EX0A 3UOEA 1BMOA 3R5DA 2OZUA 2NU4I 2SGFI 3TO9A 3FSXA 4GI3C 2V53A 1WGCA 2LB7A 2ELIA 1K7TA 1SGEI 2KMOA 2OD1A 2SGDI 4HGUA 1UVFA 1R79A 3TOBA 1IW4A 1SGRI 2ORWA 3FC3A 1YU6C 2UZ3A 1TBQR 1SGYI 3QWPA 4OVOA 5FUXA 5CCMA 1HEVA 2PQ8A 2X3TA 4L9MA 5JHWC 3SGQI 2QQ0A 1DS2I 1NUBA 1OVOA 1MJBA 1P9ZA 3VDUA 3R5AA 3E59A 2L8EA 2V1CA 1SGPI 1Q9BA 2OVOA 1TURA 2GKTI 5EX3A
chains in the Genus database with same CATH topology
2KCXA 4UXJA 2W0TA 1IY6A 2LUYA 1W3SA 1PTRA 3MEKA 3OXGA 3TJQA 1M8CA 1SGDI 2DIPA 2QQDA 3B4VC 1LR9A 1PTQA 3UGLA 4B6DA 1TOTA 1LR8A 3UEJA 1LR7A 1CT2I 1W4RA 1Y8FA 2K9HA 2NU3I 4JCVE 2QQEA 3HH2C 1Y1CA 2GKRI 2V1CC 1KMAA 2JXDA 2BUSA 2WVJA 1CT4I 1TBOA 2JZMA 1V1IA 1CHOI 3OXLA 2YQPA 2VRWB 1OMTA 2F3CI 1X74A 1FARA 1KBFA 1DS3I 1TGSI 5FUYA 3SEKC 1TBRR 3OXFA 5HQ8A 2LEOA 2KMPA 2SGPI 3QTLD 4E1PA 3UGIA 4UXIA 2B0UC 1XX6A 2SGQI 1OYVI 1PJUA 1SGNI 3OL0A 1UUCA 2E5RA 3RU0A 1VDDA 2B8TA 2J87A 3BJIA 2JA1A 3UFFA 3SGBI 2DB6A 1Y1BA 2SGEI 1PPFI 4UXHA 3CXLA 5FUWA 2A20A 5FUVA 1X4SA 5CCLA 1TBNA 1YTPA 1TUSA 1SGQI 4E1RA 2NU0I 1CGII 1H0ZA 2N71A 4FKDA 2ENNA 1FAQA 3KY9A 2KMRA 3VE5A 3D00A 2CJSC 1U5KA 2ERWA 2YUUA 1KBEA 1R0RI 2NU1I 1CGJI 3OVOA 2J9RA 2ODDA 1Z7KB 1OMUA 2QPOA 1M8BA 2M5XA 2FNFX 3E2IA 2XRCA 2JW6A 3PDNA 1AN1I 1V1HA 2N17A 3UGDA 1HPTA 2E73A 2ORVA 1RFHA 1HDLA 1FYBA 2ROWA 4SGBI 2NU2I 2WCYA 1UVGA 1TIHA 5HI7A 3UEYA 2JYYA 1PCEA 1N13A 1BUSA 2ENZA 2N52A 1CE3A 1HJAI 1XA6A 1XBTA 2P6AC 2N1AB 2ARPF 1MT1A 3GOXA 1CSOI 2QQCA 1CT0I 5DAEA 3VDPA 4A24A 1IY5A 2GKVA 2GVIA 2KMQA 2L7XA 5EX0A 1BMOA 2NU4I 2SGFI 4GI3C 2V53A 2ELIA 1SGEI 2KMOA 2OD1A 2SGDI 4HGUA 1UVFA 1R79A 1IW4A 1SGRI 2ORWA 3FC3A 1YU6C 2UZ3A 1TBQR 1SGYI 3QWPA 4OVOA 5FUXA 5CCMA 4L9MA 5JHWC 3SGQI 2QQ0A 1DS2I 1NUBA 1OVOA 3VDUA 3E59A 2L8EA 2V1CA 1SGPI 2OVOA 1TURA 2GKTI 5EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCX A;  1IY6 A;  3TJQ A;  1M8C A;  1SGD I;  2QQD A;  3B4V C;  1LR9 A;  1LR8 A;  1LR7 A;  1CT2 I;  2NU3 I;  3HH2 C;  1Y1C A;  2GKR I;  1KMA A;  2JXD A;  2BUS A;  1CT4 I;  2JZM A;  1CHO I;  1OMT A;  2F3C I;  1DS3 I;  1TGS I;  3SEK C;  1TBR R;  2LEO A;  2KMP A;  2SGP I;  3QTL D;  2B0U C;  2SGQ I;  1OYV I;  1PJU A;  1SGN I;  1UUC A;  3SGB I;  1Y1B A;  2SGE I;  1PPF I;  1YTP A;  1TUS A;  1SGQ I;  2NU0 I;  1CGI I;  1H0Z A;  2N71 A;  2KMR A;  2ERW A;  1R0R I;  2NU1 I;  1CGJ I;  3OVO A;  1Z7K B;  1OMU A;  1M8B A;  2M5X A;  2XRC A;  1AN1 I;  2N17 A;  1HPT A;  1HDL A;  1FYB A;  4SGB I;  2NU2 I;  2WCY A;  1UVG A;  1TIH A;  2JYY A;  1PCE A;  1N13 A;  1BUS A;  2N52 A;  1CE3 A;  1HJA I;  2P6A C;  2ARP F;  1MT1 A;  1CSO I;  2QQC A;  1CT0 I;  5DAE A;  1IY5 A;  2GKV A;  2KMQ A;  1BMO A;  2NU4 I;  2SGF I;  4GI3 C;  2V53 A;  1SGE I;  2KMO A;  4HGU A;  2SGD I;  1IW4 A;  1UVF A;  1SGR I;  1YU6 C;  1TBQ R;  1SGY I;  4OVO A;  5JHW C;  3SGQ I;  1DS2 I;  1NUB A;  1OVO A;  1SGP I;  2OVO A;  1TUR A;  2GKT I; 
#chains in the Genus database with same CATH topology
 2KCX A;  4UXJ A;  1K7U A;  2W0T A;  1IY6 A;  2LUY A;  1W3S A;  1PTR A;  3MEK A;  1FY7 A;  3OXG A;  1M8C A;  3TJQ A;  1SGD I;  2DIP A;  2QQD A;  3B4V C;  1LR9 A;  4WP4 A;  1PTQ A;  3UGL A;  4B6D A;  1TOT A;  1LR8 A;  3UEJ A;  3R5B A;  1LR7 A;  1CT2 I;  1W4R A;  1Y8F A;  2K9H A;  2NU3 I;  4JCV E;  1K7V A;  2QQE A;  3HH2 C;  2CWH A;  1Y1C A;  2GKR I;  5E3Q A;  2V1C C;  1KMA A;  2JXD A;  2BUS A;  2WVJ A;  3R5C A;  1CT4 I;  5J8C A;  1TBO A;  1MJA A;  2JZM A;  1V1I A;  1CHO I;  3OXL A;  1WTJ A;  2YQP A;  2VRW B;  1Z2I A;  5E3P A;  1OMT A;  2F3C I;  1X74 A;  1FAR A;  1KBF A;  1DS3 I;  1TGS I;  5FUY A;  3SEK C;  1TBR R;  3OXF A;  5HQ8 A;  2UVO A;  9WGA A;  2LEO A;  2DKV A;  2KMP A;  1WGT A;  2SGP I;  3QTL D;  4DNC A;  4E1P A;  3UGI A;  4UXI A;  1MJ9 A;  2B0U C;  1XX6 A;  2SGQ I;  1OYV I;  1PJU A;  1SGN I;  3OL0 A;  1UUC A;  2E5R A;  2Y0M A;  3RU0 A;  1VDD A;  2B8T A;  1NXU A;  2J87 A;  3BJI A;  3TO7 A;  2JA1 A;  3UFF A;  3TOA A;  3SGB I;  2DB6 A;  1Y1B A;  2SGE I;  1PPF I;  4UXH A;  3CXL A;  5FUW A;  2A20 A;  5FUV A;  1X4S A;  5CCL A;  1TBN A;  1YTP A;  1TUS A;  1SGQ I;  1ULN A;  4E1R A;  7WGA A;  2NU0 I;  2RIJ A;  1CGI I;  4MPI A;  1H0Z A;  2N71 A;  4FKD A;  2ENN A;  1FAQ A;  4AML A;  3KY9 A;  2KMR A;  3VE5 A;  3D00 A;  2CJS C;  1U5K A;  2ERW A;  2YUU A;  2WGC A;  1UHA A;  1KBE A;  1P9G A;  1R0R I;  2NU1 I;  1CGJ I;  2OU2 A;  3OVO A;  2J9R A;  2ODD A;  1Z7K B;  1OMU A;  2QPO A;  5E3R A;  1M8B A;  2M5X A;  2FNF X;  3E2I A;  2XRC A;  2JW6 A;  3PDN A;  1AN1 I;  1V1H A;  2N17 A;  3UGD A;  2GIV A;  1HPT A;  2X52 A;  2E73 A;  2ORV A;  3FSY A;  1RFH A;  1HDL A;  1FYB A;  2ROW A;  4SGB I;  2NU2 I;  2WCY A;  1UVG A;  1TIH A;  3QAH A;  5HI7 A;  3UEY A;  2JYY A;  1PCE A;  1N13 A;  1BUS A;  1WKX A;  2ENZ A;  2N52 A;  3TO6 A;  1CE3 A;  1ULK A;  2CWG A;  1HJA I;  1S20 A;  1XA6 A;  1ULM A;  5J8F A;  1XBT A;  2CWF A;  2P6A C;  2N1A B;  2ARP F;  1MT1 A;  3GOX A;  1CSO I;  2QQC A;  1CT0 I;  5DAE A;  3VDP A;  4A24 A;  1IY5 A;  2GKV A;  2GVI A;  2KMQ A;  2L7X A;  2RC4 A;  5EX0 A;  3UOE A;  1BMO A;  3R5D A;  2OZU A;  2NU4 I;  2SGF I;  3TO9 A;  3FSX A;  4GI3 C;  2V53 A;  1WGC A;  2LB7 A;  2ELI A;  1K7T A;  1SGE I;  2KMO A;  2OD1 A;  2SGD I;  4HGU A;  1UVF A;  1R79 A;  3TOB A;  1IW4 A;  1SGR I;  2ORW A;  3FC3 A;  1YU6 C;  2UZ3 A;  1TBQ R;  1SGY I;  3QWP A;  4OVO A;  5FUX A;  5CCM A;  1HEV A;  2PQ8 A;  2X3T A;  4L9M A;  5JHW C;  3SGQ I;  2QQ0 A;  1DS2 I;  1NUB A;  1OVO A;  1MJB A;  1P9Z A;  3VDU A;  3R5A A;  3E59 A;  2L8E A;  2V1C A;  1SGP I;  1Q9B A;  2OVO A;  1TUR A;  2GKT I;  5EX3 A; 
#chains in the Genus database with same CATH homology
 2KCX A;  4UXJ A;  2W0T A;  1IY6 A;  2LUY A;  1W3S A;  1PTR A;  3MEK A;  3OXG A;  3TJQ A;  1M8C A;  1SGD I;  2DIP A;  2QQD A;  3B4V C;  1LR9 A;  1PTQ A;  3UGL A;  4B6D A;  1TOT A;  1LR8 A;  3UEJ A;  1LR7 A;  1CT2 I;  1W4R A;  1Y8F A;  2K9H A;  2NU3 I;  4JCV E;  2QQE A;  3HH2 C;  1Y1C A;  2GKR I;  2V1C C;  1KMA A;  2JXD A;  2BUS A;  2WVJ A;  1CT4 I;  1TBO A;  2JZM A;  1V1I A;  1CHO I;  3OXL A;  2YQP A;  2VRW B;  1OMT A;  2F3C I;  1X74 A;  1FAR A;  1KBF A;  1DS3 I;  1TGS I;  5FUY A;  3SEK C;  1TBR R;  3OXF A;  5HQ8 A;  2LEO A;  2KMP A;  2SGP I;  3QTL D;  4E1P A;  3UGI A;  4UXI A;  2B0U C;  1XX6 A;  2SGQ I;  1OYV I;  1PJU A;  1SGN I;  3OL0 A;  1UUC A;  2E5R A;  3RU0 A;  1VDD A;  2B8T A;  2J87 A;  3BJI A;  2JA1 A;  3UFF A;  3SGB I;  2DB6 A;  1Y1B A;  2SGE I;  1PPF I;  4UXH A;  3CXL A;  5FUW A;  2A20 A;  5FUV A;  1X4S A;  5CCL A;  1TBN A;  1YTP A;  1TUS A;  1SGQ I;  4E1R A;  2NU0 I;  1CGI I;  1H0Z A;  2N71 A;  4FKD A;  2ENN A;  1FAQ A;  3KY9 A;  2KMR A;  3VE5 A;  3D00 A;  2CJS C;  1U5K A;  2ERW A;  2YUU A;  1KBE A;  1R0R I;  2NU1 I;  1CGJ I;  3OVO A;  2J9R A;  2ODD A;  1Z7K B;  1OMU A;  2QPO A;  1M8B A;  2M5X A;  2FNF X;  3E2I A;  2XRC A;  2JW6 A;  3PDN A;  1AN1 I;  1V1H A;  2N17 A;  3UGD A;  1HPT A;  2E73 A;  2ORV A;  1RFH A;  1HDL A;  1FYB A;  2ROW A;  4SGB I;  2NU2 I;  2WCY A;  1UVG A;  1TIH A;  5HI7 A;  3UEY A;  2JYY A;  1PCE A;  1N13 A;  1BUS A;  2ENZ A;  2N52 A;  1CE3 A;  1HJA I;  1XA6 A;  1XBT A;  2P6A C;  2N1A B;  2ARP F;  1MT1 A;  3GOX A;  1CSO I;  2QQC A;  1CT0 I;  5DAE A;  3VDP A;  4A24 A;  1IY5 A;  2GKV A;  2GVI A;  2KMQ A;  2L7X A;  5EX0 A;  1BMO A;  2NU4 I;  2SGF I;  4GI3 C;  2V53 A;  2ELI A;  1SGE I;  2KMO A;  2OD1 A;  2SGD I;  4HGU A;  1UVF A;  1R79 A;  1IW4 A;  1SGR I;  2ORW A;  3FC3 A;  1YU6 C;  2UZ3 A;  1TBQ R;  1SGY I;  3QWP A;  4OVO A;  5FUX A;  5CCM A;  4L9M A;  5JHW C;  3SGQ I;  2QQ0 A;  1DS2 I;  1NUB A;  1OVO A;  3VDU A;  3E59 A;  2L8E A;  2V1C A;  1SGP I;  2OVO A;  1TUR A;  2GKT I;  5EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...