1SGNI

Asn 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTNEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
total genus 12
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgnI00
2GKVA 2NU4I 1YTPA 2WCYA 4GI3C 1MT1A 2M5XA 5DAEA 2SGDI 1NUBA 1HPTA 2GKTI 2NU0I 1CT0I 3HH2C 1CT2I 3B4VC 1BUSA 3SGQI 1N13A 1M8BA 1SGPI 1CGII 1LR8A 2F3CI 2N17A 1M8CA 2LEOA 1PCEA 2N71A 1SGNI 1LR9A 1IW4A 3SGBI 1AN1I 1OMUA 1CT4I 1HJAI 1SGRI 2ARPF 2KCXA 2QQDA 1TUSA 1SGEI 2QQCA 1CGJI 2KMRA 1UVGA 1H0ZA 1SGYI 4HGUA 1Y1CA 2NU2I 1PPFI 2P6AC 2JXDA 1HDLA 2KMPA 2V53A 2NU1I 2ERWA 2B0UC 1CHOI 2OVOA 1CE3A 2SGPI 1SGQI 2NU3I 2JYYA 1YU6C 1OMTA 1OVOA 2KMQA 1TBRR 3SEKC 1KMAA 1BMOA 1TURA 2GKRI 1IY5A 3TJQA 1Z7KB 1FYBA 1TGSI 2JZMA 1R0RI 2SGQI 2SGFI 1IY6A 1SGDI 1UVFA 2SGEI 1CSOI 2BUSA 4SGBI 4OVOA 1UUCA 1OYVI 2KMOA 3OVOA 2N52A 1DS3I 1PJUA 1TIHA 3QTLD 2XRCA 1LR7A 1TBQR 1Y1BA 1DS2I 5JHWC
chains in the Genus database with same CATH superfamily
2GKVA 2NU4I 4MPIA 1YTPA 1X4SA 2WCYA 4GI3C 1HEVA 2LUYA 3D00A 1R79A 1NXUA 1UHAA 1MT1A 1WKXA 2M5XA 3R5BA 5DAEA 2SGDI 1V1HA 1Y8FA 2B8TA 2DIPA 3OL0A 4A24A 3TO7A 1NUBA 2E73A 2LB7A 5FUVA 4UXIA 1K7UA 1HPTA 2GKTI 2NU0I 1PTQA 2GIVA 3UFFA 1CT0I 3HH2C 1CT2I 3UEJA 4DNCA 3FSXA 2E5RA 3B4VC 3VE5A 1KBEA 4WP4A 2ELIA 3PDNA 3SGQI 1BUSA 1FARA 3QAHA 1N13A 1W4RA 2W0TA 2CWGA 2OU2A 2WVJA 1M8BA 1SGPI 2OD1A 1TBOA 5E3RA 7WGAA 2UVOA 1CGII 1LR8A 2PQ8A 3GOXA 1MJBA 3VDUA 3R5AA 4FKDA 2F3CI 3R5CA 3UGLA 1Z2IA 3QWPA 1MJ9A 2CJSC 1M8CA 2N17A 2ORWA 2LEOA 5HI7A 1PCEA 2N71A 1SGNI 2RIJA 1LR9A 3R5DA 1IW4A 3SGBI 2K9HA 2QQEA 1ULNA 2VRWB 2WGCA 4JCVE 1XBTA 2A20A 2YUUA 3FSYA 1AN1I 1Q9BA 3TOBA 9WGAA 1OMUA 1CT4I 1HJAI 1SGRI 2ARPF 2KCXA 2QQDA 1PTRA 1SGEI 1TUSA 1CGJI 2J9RA 2KMRA 2QQCA 3CXLA 1KBFA 1VDDA 5EX0A 5FUXA 2V1CA 5FUWA 1UVGA 1XX6A 1SGYI 4HGUA 1H0ZA 1Y1CA 3E2IA 2V1CC 4AMLA 5HQ8A 2NU2I 1WGCA 1PPFI 1W3SA 2CWHA 5FUYA 2P6AC 4E1RA 4UXHA 2JXDA 2YQPA 1U5KA 2KMPA 2JW6A 1HDLA 2ROWA 2DKVA 3UGIA 5E3QA 1FY7A 2V53A 2ENNA 1FAQA 2DB6A 2RC4A 2NU1I 5CCMA 2ERWA 2Y0MA 2J87A 2B0UC 1K7VA 1CHOI 1P9GA 2OVOA 2ODDA 3UGDA 1CE3A 2JA1A 1V1IA 1X74A 2X3TA 2SGPI 1SGQI 2NU3I 5EX3A 2JYYA 5J8CA 3UEYA 4B6DA 3OXFA 1YU6C 1OMTA 1S20A 4UXJA 1OVOA 2FNFX 1TBRR 2CWFA 2KMQA 2L8EA 2QQ0A 3SEKC 1BMOA 1TURA 3TOAA 3VDPA 3MEKA 2GKRI 1KMAA 5E3PA 3OXLA 1TOTA 1IY5A 1K7TA 1P9ZA 1Z7KB 2GVIA 3TJQA 1WGTA 2OZUA 2ENZA 5J8FA 1FYBA 1TGSI 2JZMA 1R0RI 2SGQI 4L9MA 2SGFI 1IY6A 1ULMA 1TBNA 1WTJA 1SGDI 1UVFA 1RFHA 2L7XA 2SGEI 1CSOI 1ULKA 2BUSA 1MJAA 2UZ3A 4OVOA 4SGBI 2N1AB 3TO9A 1UUCA 3KY9A 3UOEA 1OYVI 2KMOA 3OVOA 3RU0A 2X52A 3E59A 2ORVA 2N52A 5CCLA 1DS3I 3TO6A 1PJUA 1TIHA 3BJIA 1XA6A 3QTLD 2XRCA 1LR7A 3FC3A 4E1PA 1TBQR 1Y1BA 1DS2I 5JHWC 2QPOA 3OXGA
chains in the Genus database with same CATH topology
2GKVA 2NU4I 1YTPA 1X4SA 2WCYA 4GI3C 2LUYA 3D00A 1R79A 1MT1A 2M5XA 5DAEA 2SGDI 2B8TA 1V1HA 1Y8FA 2DIPA 3OL0A 4A24A 1NUBA 2E73A 5FUVA 4UXIA 1HPTA 2GKTI 2NU0I 1PTQA 3UFFA 1CT0I 3HH2C 1CT2I 3UEJA 2E5RA 3B4VC 3VE5A 1KBEA 2ELIA 3PDNA 3SGQI 1BUSA 1FARA 1N13A 1W4RA 2W0TA 2WVJA 1M8BA 1SGPI 2OD1A 1TBOA 1CGII 1LR8A 3GOXA 3VDUA 4FKDA 2F3CI 3UGLA 3QWPA 2CJSC 1M8CA 2N17A 2ORWA 2LEOA 5HI7A 1PCEA 2N71A 1SGNI 1LR9A 1IW4A 3SGBI 2K9HA 2QQEA 2VRWB 4JCVE 1XBTA 2A20A 2YUUA 1AN1I 1OMUA 1CT4I 1HJAI 1SGRI 2ARPF 2KCXA 2QQDA 1PTRA 1SGEI 1TUSA 1CGJI 2J9RA 2KMRA 2QQCA 3CXLA 1KBFA 1VDDA 5EX0A 5FUXA 2V1CA 5FUWA 1UVGA 1XX6A 1SGYI 4HGUA 1H0ZA 1Y1CA 3E2IA 2V1CC 5HQ8A 2NU2I 1PPFI 1W3SA 5FUYA 4E1RA 2P6AC 4UXHA 2JXDA 2YQPA 1U5KA 2KMPA 2JW6A 1HDLA 2ROWA 3UGIA 1FAQA 2V53A 2ENNA 2DB6A 2NU1I 5CCMA 2ERWA 2J87A 2B0UC 1CHOI 2OVOA 2ODDA 3UGDA 1CE3A 2JA1A 1V1IA 1X74A 2SGPI 1SGQI 2NU3I 5EX3A 2JYYA 3UEYA 4B6DA 3OXFA 1YU6C 1OMTA 4UXJA 1OVOA 2FNFX 1TBRR 2KMQA 2L8EA 2QQ0A 3SEKC 3VDPA 1BMOA 1TURA 1KMAA 3MEKA 2GKRI 3OXLA 1TOTA 1IY5A 3TJQA 1Z7KB 2GVIA 2ENZA 1FYBA 1TGSI 2JZMA 1R0RI 2SGQI 4L9MA 2SGFI 1IY6A 1TBNA 1SGDI 1UVFA 1RFHA 2L7XA 2SGEI 1CSOI 2BUSA 2UZ3A 4OVOA 4SGBI 2N1AB 1UUCA 3KY9A 1OYVI 2KMOA 3OVOA 3RU0A 3E59A 2ORVA 2N52A 5CCLA 1DS3I 1PJUA 1TIHA 3BJIA 1XA6A 3QTLD 2XRCA 1LR7A 3FC3A 4E1PA 1TBQR 1Y1BA 1DS2I 5JHWC 2QPOA 3OXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GKV A;  2NU4 I;  1YTP A;  2WCY A;  4GI3 C;  1MT1 A;  2M5X A;  5DAE A;  2SGD I;  1NUB A;  1HPT A;  2GKT I;  2NU0 I;  1CT0 I;  3HH2 C;  1CT2 I;  3B4V C;  1BUS A;  3SGQ I;  1N13 A;  1M8B A;  1SGP I;  1CGI I;  1LR8 A;  2F3C I;  2N17 A;  1M8C A;  2LEO A;  1PCE A;  2N71 A;  1SGN I;  1LR9 A;  1IW4 A;  3SGB I;  1AN1 I;  1OMU A;  1CT4 I;  1HJA I;  1SGR I;  2ARP F;  2KCX A;  2QQD A;  1TUS A;  1SGE I;  2QQC A;  1CGJ I;  2KMR A;  1UVG A;  1H0Z A;  1SGY I;  4HGU A;  1Y1C A;  2NU2 I;  1PPF I;  2P6A C;  2JXD A;  1HDL A;  2KMP A;  2V53 A;  2NU1 I;  2ERW A;  2B0U C;  1CHO I;  2OVO A;  1CE3 A;  2SGP I;  1SGQ I;  2NU3 I;  2JYY A;  1YU6 C;  1OMT A;  1OVO A;  2KMQ A;  1TBR R;  3SEK C;  1KMA A;  1BMO A;  1TUR A;  2GKR I;  1IY5 A;  3TJQ A;  1Z7K B;  1FYB A;  1TGS I;  2JZM A;  1R0R I;  2SGQ I;  2SGF I;  1IY6 A;  1SGD I;  1UVF A;  2SGE I;  1CSO I;  2BUS A;  4SGB I;  4OVO A;  1UUC A;  1OYV I;  2KMO A;  3OVO A;  2N52 A;  1DS3 I;  1PJU A;  1TIH A;  3QTL D;  2XRC A;  1LR7 A;  1TBQ R;  1Y1B A;  1DS2 I;  5JHW C; 
#chains in the Genus database with same CATH topology
 2GKV A;  2NU4 I;  4MPI A;  1YTP A;  1X4S A;  2WCY A;  4GI3 C;  1HEV A;  2LUY A;  3D00 A;  1R79 A;  1NXU A;  1UHA A;  1MT1 A;  1WKX A;  2M5X A;  3R5B A;  5DAE A;  2SGD I;  1V1H A;  1Y8F A;  2B8T A;  2DIP A;  3OL0 A;  4A24 A;  3TO7 A;  1NUB A;  2E73 A;  2LB7 A;  5FUV A;  4UXI A;  1K7U A;  1HPT A;  2GKT I;  2NU0 I;  1PTQ A;  2GIV A;  3UFF A;  1CT0 I;  3HH2 C;  1CT2 I;  3UEJ A;  4DNC A;  3FSX A;  2E5R A;  3B4V C;  3VE5 A;  1KBE A;  4WP4 A;  2ELI A;  3PDN A;  3SGQ I;  1BUS A;  1FAR A;  3QAH A;  1N13 A;  1W4R A;  2W0T A;  2CWG A;  2OU2 A;  2WVJ A;  1M8B A;  1SGP I;  2OD1 A;  1TBO A;  5E3R A;  7WGA A;  2UVO A;  1CGI I;  1LR8 A;  2PQ8 A;  3GOX A;  1MJB A;  3VDU A;  3R5A A;  4FKD A;  2F3C I;  3R5C A;  3UGL A;  1Z2I A;  3QWP A;  1MJ9 A;  2CJS C;  1M8C A;  2N17 A;  2ORW A;  2LEO A;  5HI7 A;  1PCE A;  2N71 A;  1SGN I;  2RIJ A;  1LR9 A;  3R5D A;  1IW4 A;  3SGB I;  2K9H A;  2QQE A;  1ULN A;  2VRW B;  2WGC A;  4JCV E;  1XBT A;  2A20 A;  2YUU A;  3FSY A;  1AN1 I;  1Q9B A;  3TOB A;  9WGA A;  1OMU A;  1CT4 I;  1HJA I;  1SGR I;  2ARP F;  2KCX A;  2QQD A;  1PTR A;  1SGE I;  1TUS A;  1CGJ I;  2J9R A;  2KMR A;  2QQC A;  3CXL A;  1KBF A;  1VDD A;  5EX0 A;  5FUX A;  2V1C A;  5FUW A;  1UVG A;  1XX6 A;  1SGY I;  4HGU A;  1H0Z A;  1Y1C A;  3E2I A;  2V1C C;  4AML A;  5HQ8 A;  2NU2 I;  1WGC A;  1PPF I;  1W3S A;  2CWH A;  5FUY A;  2P6A C;  4E1R A;  4UXH A;  2JXD A;  2YQP A;  1U5K A;  2KMP A;  2JW6 A;  1HDL A;  2ROW A;  2DKV A;  3UGI A;  5E3Q A;  1FY7 A;  2V53 A;  2ENN A;  1FAQ A;  2DB6 A;  2RC4 A;  2NU1 I;  5CCM A;  2ERW A;  2Y0M A;  2J87 A;  2B0U C;  1K7V A;  1CHO I;  1P9G A;  2OVO A;  2ODD A;  3UGD A;  1CE3 A;  2JA1 A;  1V1I A;  1X74 A;  2X3T A;  2SGP I;  1SGQ I;  2NU3 I;  5EX3 A;  2JYY A;  5J8C A;  3UEY A;  4B6D A;  3OXF A;  1YU6 C;  1OMT A;  1S20 A;  4UXJ A;  1OVO A;  2FNF X;  1TBR R;  2CWF A;  2KMQ A;  2L8E A;  2QQ0 A;  3SEK C;  1BMO A;  1TUR A;  3TOA A;  3VDP A;  3MEK A;  2GKR I;  1KMA A;  5E3P A;  3OXL A;  1TOT A;  1IY5 A;  1K7T A;  1P9Z A;  1Z7K B;  2GVI A;  3TJQ A;  1WGT A;  2OZU A;  2ENZ A;  5J8F A;  1FYB A;  1TGS I;  2JZM A;  1R0R I;  2SGQ I;  4L9M A;  2SGF I;  1IY6 A;  1ULM A;  1TBN A;  1WTJ A;  1SGD I;  1UVF A;  1RFH A;  2L7X A;  2SGE I;  1CSO I;  1ULK A;  2BUS A;  1MJA A;  2UZ3 A;  4OVO A;  4SGB I;  2N1A B;  3TO9 A;  1UUC A;  3KY9 A;  3UOE A;  1OYV I;  2KMO A;  3OVO A;  3RU0 A;  2X52 A;  3E59 A;  2ORV A;  2N52 A;  5CCL A;  1DS3 I;  3TO6 A;  1PJU A;  1TIH A;  3BJI A;  1XA6 A;  3QTL D;  2XRC A;  1LR7 A;  3FC3 A;  4E1P A;  1TBQ R;  1Y1B A;  1DS2 I;  5JHW C;  2QPO A;  3OXG A; 
#chains in the Genus database with same CATH homology
 2GKV A;  2NU4 I;  1YTP A;  1X4S A;  2WCY A;  4GI3 C;  2LUY A;  3D00 A;  1R79 A;  1MT1 A;  2M5X A;  5DAE A;  2SGD I;  2B8T A;  1V1H A;  1Y8F A;  2DIP A;  3OL0 A;  4A24 A;  1NUB A;  2E73 A;  5FUV A;  4UXI A;  1HPT A;  2GKT I;  2NU0 I;  1PTQ A;  3UFF A;  1CT0 I;  3HH2 C;  1CT2 I;  3UEJ A;  2E5R A;  3B4V C;  3VE5 A;  1KBE A;  2ELI A;  3PDN A;  3SGQ I;  1BUS A;  1FAR A;  1N13 A;  1W4R A;  2W0T A;  2WVJ A;  1M8B A;  1SGP I;  2OD1 A;  1TBO A;  1CGI I;  1LR8 A;  3GOX A;  3VDU A;  4FKD A;  2F3C I;  3UGL A;  3QWP A;  2CJS C;  1M8C A;  2N17 A;  2ORW A;  2LEO A;  5HI7 A;  1PCE A;  2N71 A;  1SGN I;  1LR9 A;  1IW4 A;  3SGB I;  2K9H A;  2QQE A;  2VRW B;  4JCV E;  1XBT A;  2A20 A;  2YUU A;  1AN1 I;  1OMU A;  1CT4 I;  1HJA I;  1SGR I;  2ARP F;  2KCX A;  2QQD A;  1PTR A;  1SGE I;  1TUS A;  1CGJ I;  2J9R A;  2KMR A;  2QQC A;  3CXL A;  1KBF A;  1VDD A;  5EX0 A;  5FUX A;  2V1C A;  5FUW A;  1UVG A;  1XX6 A;  1SGY I;  4HGU A;  1H0Z A;  1Y1C A;  3E2I A;  2V1C C;  5HQ8 A;  2NU2 I;  1PPF I;  1W3S A;  5FUY A;  4E1R A;  2P6A C;  4UXH A;  2JXD A;  2YQP A;  1U5K A;  2KMP A;  2JW6 A;  1HDL A;  2ROW A;  3UGI A;  1FAQ A;  2V53 A;  2ENN A;  2DB6 A;  2NU1 I;  5CCM A;  2ERW A;  2J87 A;  2B0U C;  1CHO I;  2OVO A;  2ODD A;  3UGD A;  1CE3 A;  2JA1 A;  1V1I A;  1X74 A;  2SGP I;  1SGQ I;  2NU3 I;  5EX3 A;  2JYY A;  3UEY A;  4B6D A;  3OXF A;  1YU6 C;  1OMT A;  4UXJ A;  1OVO A;  2FNF X;  1TBR R;  2KMQ A;  2L8E A;  2QQ0 A;  3SEK C;  3VDP A;  1BMO A;  1TUR A;  1KMA A;  3MEK A;  2GKR I;  3OXL A;  1TOT A;  1IY5 A;  3TJQ A;  1Z7K B;  2GVI A;  2ENZ A;  1FYB A;  1TGS I;  2JZM A;  1R0R I;  2SGQ I;  4L9M A;  2SGF I;  1IY6 A;  1TBN A;  1SGD I;  1UVF A;  1RFH A;  2L7X A;  2SGE I;  1CSO I;  2BUS A;  2UZ3 A;  4OVO A;  4SGB I;  2N1A B;  1UUC A;  3KY9 A;  1OYV I;  2KMO A;  3OVO A;  3RU0 A;  3E59 A;  2ORV A;  2N52 A;  5CCL A;  1DS3 I;  1PJU A;  1TIH A;  3BJI A;  1XA6 A;  3QTL D;  2XRC A;  1LR7 A;  3FC3 A;  4E1P A;  1TBQ R;  1Y1B A;  1DS2 I;  5JHW C;  2QPO A;  3OXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...