1SGNI

Asn 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTNEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 12
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgnI00
3OVOA 1DS3I 1SGDI 1TUSA 1LR8A 1IY5A 1TGSI 1PJUA 3SEKC 2KMPA 2V53A 1CHOI 2NU4I 2NU0I 2WCYA 2N17A 2LEOA 5DAEA 1H0ZA 3QTLD 1CGII 2N52A 1Y1CA 1IW4A 1KMAA 1Y1BA 2SGFI 2SGPI 2QQCA 4GI3C 2F3CI 1LR7A 1HDLA 1IY6A 1FYBA 2P6AC 1SGNI 2ARPF 4OVOA 2SGDI 2B0UC 1CE3A 1SGYI 2KMRA 2NU3I 5JHWC 1TIHA 2GKVA 1M8BA 3SGBI 1CSOI 1M8CA 1SGRI 2JYYA 1HJAI 2XRCA 2KMOA 1PPFI 2JXDA 1OYVI 1NUBA 3HH2C 2NU2I 1CGJI 2GKTI 1UUCA 1LR9A 1HPTA 2NU1I 1SGQI 2GKRI 1SGPI 2JZMA 2KMQA 2M5XA 1MT1A 1R0RI 2KCXA 1OVOA 1CT2I 1PCEA 2QQDA 1YTPA 1YU6C 1SGEI 1TBRR 1BUSA 1UVGA 1TURA 1AN1I 2BUSA 3B4VC 2SGEI 4SGBI 2SGQI 1N13A 1CT0I 1Z7KB 2OVOA 3TJQA 2ERWA 1DS2I 3SGQI 1TBQR 2N71A 1BMOA 1CT4I 4HGUA 1OMTA 1OMUA 1UVFA
chains in the Genus database with same CATH superfamily
9WGAA 1TOTA 3OVOA 5HI7A 1FAQA 2ORVA 4E1PA 1DS3I 3VDUA 1SGDI 1KBEA 5EX0A 1K7TA 4B6DA 1TUSA 2E73A 1R79A 2X3TA 1LR8A 2Y0MA 1IY5A 1TGSI 2JW6A 1PJUA 2CWGA 3R5BA 5FUXA 3SEKC 1UHAA 2KMPA 1W4RA 2V53A 4FKDA 2OZUA 3BJIA 2CJSC 1CHOI 1V1HA 2ELIA 2GVIA 4JCVE 2NU4I 2NU0I 1ULMA 1FARA 1PTRA 2WCYA 4MPIA 2N17A 2J9RA 2LEOA 4UXHA 3UGIA 5DAEA 1H0ZA 5CCLA 3QTLD 1K7UA 1CGII 2N52A 3OXLA 1Y1CA 1IW4A 1KMAA 2L8EA 1XA6A 1Y8FA 1ULKA 2ODDA 1Y1BA 1RFHA 2A20A 2QQCA 2SGFI 2SGPI 1WKXA 1MJBA 3R5CA 4GI3C 2F3CI 2N1AB 1LR7A 1HDLA 4WP4A 1IY6A 5E3RA 2LB7A 1W3SA 1FYBA 5E3PA 3E2IA 2P6AC 1SGNI 2ARPF 1KBFA 4OVOA 2QQ0A 2L7XA 3FSXA 3UEYA 3GOXA 2K9HA 3OL0A 2SGDI 2B0UC 2QQEA 3UGLA 1CE3A 2DB6A 1SGYI 1MJAA 3VDPA 2RIJA 3TO6A 3OXFA 4AMLA 2KMRA 2NU3I 1WTJA 4E1RA 5JHWC 1TIHA 3QWPA 2JA1A 1Z2IA 2GKVA 3PDNA 1HEVA 2ENNA 1M8BA 2WGCA 3SGBI 4DNCA 5CCMA 1M8CA 1CSOI 1SGRI 5J8CA 2FNFX 2JYYA 3TO7A 3UOEA 2E5RA 1HJAI 2XRCA 2UZ3A 2KMOA 5FUVA 1PPFI 2RC4A 3TOBA 2DKVA 3KY9A 2PQ8A 2JXDA 4L9MA 2V1CC 2X52A 1OYVI 1NUBA 2CWFA 3HH2C 2NU2I 3R5DA 1CGJI 2YUUA 1VDDA 2J87A 1PTQA 2GKTI 3CXLA 1P9ZA 1X74A 2CWHA 1UUCA 1LR9A 2WVJA 1HPTA 2NU1I 1TBNA 1SGQI 2GKRI 1SGPI 2ENZA 2JZMA 3MEKA 2KMQA 1U5KA 4A24A 2LUYA 3FC3A 2M5XA 2QPOA 3E59A 3UEJA 2GIVA 1MT1A 1R0RI 2KCXA 2OU2A 2DIPA 1OVOA 5FUYA 1CT2I 1PCEA 2QQDA 1YTPA 3TOAA 1WGCA 1V1IA 3UGDA 1YU6C 4UXIA 1SGEI 1TBRR 1WGTA 1FY7A 3OXGA 1S20A 2V1CA 1XX6A 1BUSA 3UFFA 1UVGA 1K7VA 1TURA 4UXJA 5EX3A 1AN1I 2YQPA 2BUSA 3QAHA 2ORWA 3B4VC 2SGEI 4SGBI 1NXUA 2SGQI 1N13A 2UVOA 5HQ8A 1CT0I 3VE5A 1Z7KB 2OVOA 3TJQA 1ULNA 3RU0A 2ERWA 1DS2I 5FUWA 1TBOA 1X4SA 3SGQI 1TBQR 2W0TA 1MJ9A 3FSYA 2N71A 1BMOA 1CT4I 4HGUA 2OD1A 1XBTA 1OMTA 1OMUA 3R5AA 1Q9BA 5E3QA 7WGAA 1P9GA 2ROWA 1UVFA 3TO9A 2VRWB 5J8FA 3D00A 2B8TA
chains in the Genus database with same CATH topology
1TOTA 3OVOA 5HI7A 1FAQA 2ORVA 4E1PA 1DS3I 3VDUA 1SGDI 1KBEA 5EX0A 4B6DA 1TUSA 2E73A 1R79A 1LR8A 1IY5A 1TGSI 2JW6A 1PJUA 5FUXA 3SEKC 2KMPA 1W4RA 2V53A 4FKDA 3BJIA 2CJSC 1CHOI 1V1HA 2ELIA 2GVIA 4JCVE 2NU4I 2NU0I 1FARA 1PTRA 2WCYA 2N17A 2J9RA 2LEOA 4UXHA 3UGIA 5DAEA 1H0ZA 5CCLA 3QTLD 1CGII 2N52A 3OXLA 1Y1CA 1IW4A 1KMAA 2L8EA 1XA6A 1Y8FA 2ODDA 1Y1BA 1RFHA 2A20A 2QQCA 2SGFI 2SGPI 4GI3C 2F3CI 2N1AB 1LR7A 1HDLA 1IY6A 1W3SA 1FYBA 3E2IA 2P6AC 1SGNI 2ARPF 1KBFA 4OVOA 2QQ0A 2L7XA 3UEYA 3GOXA 2K9HA 3OL0A 2SGDI 2B0UC 2QQEA 3UGLA 1CE3A 2DB6A 1SGYI 3VDPA 3OXFA 2KMRA 2NU3I 4E1RA 5JHWC 1TIHA 3QWPA 2JA1A 2GKVA 3PDNA 2ENNA 1M8BA 3SGBI 5CCMA 1CSOI 1M8CA 1SGRI 2FNFX 2JYYA 2E5RA 1HJAI 2XRCA 2UZ3A 2KMOA 5FUVA 1PPFI 3KY9A 2JXDA 4L9MA 2V1CC 1OYVI 1NUBA 3HH2C 2NU2I 1CGJI 2YUUA 1VDDA 2J87A 1PTQA 2GKTI 3CXLA 1X74A 1UUCA 1LR9A 2WVJA 1HPTA 2NU1I 1TBNA 1SGQI 2GKRI 1SGPI 2ENZA 2JZMA 3MEKA 2KMQA 1U5KA 4A24A 2LUYA 3FC3A 2M5XA 2QPOA 3E59A 3UEJA 1MT1A 1R0RI 2KCXA 2DIPA 1OVOA 5FUYA 1CT2I 1PCEA 2QQDA 1YTPA 1V1IA 3UGDA 1YU6C 4UXIA 1SGEI 1TBRR 3OXGA 2V1CA 1XX6A 1BUSA 3UFFA 1UVGA 1TURA 4UXJA 5EX3A 1AN1I 2YQPA 2BUSA 2ORWA 3B4VC 2SGEI 4SGBI 2SGQI 1N13A 5HQ8A 1CT0I 3VE5A 1Z7KB 2OVOA 3TJQA 3RU0A 2ERWA 1DS2I 5FUWA 1TBOA 1X4SA 3SGQI 1TBQR 2W0TA 2N71A 1BMOA 1CT4I 4HGUA 2OD1A 1XBTA 1OMTA 1OMUA 2ROWA 1UVFA 2VRWB 3D00A 2B8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OVO A;  1DS3 I;  1SGD I;  1TUS A;  1LR8 A;  1IY5 A;  1TGS I;  1PJU A;  3SEK C;  2KMP A;  2V53 A;  1CHO I;  2NU4 I;  2NU0 I;  2WCY A;  2N17 A;  2LEO A;  5DAE A;  1H0Z A;  3QTL D;  1CGI I;  2N52 A;  1Y1C A;  1IW4 A;  1KMA A;  1Y1B A;  2SGF I;  2SGP I;  2QQC A;  4GI3 C;  2F3C I;  1LR7 A;  1HDL A;  1IY6 A;  1FYB A;  2P6A C;  1SGN I;  2ARP F;  4OVO A;  2SGD I;  2B0U C;  1CE3 A;  1SGY I;  2KMR A;  2NU3 I;  5JHW C;  1TIH A;  2GKV A;  1M8B A;  3SGB I;  1CSO I;  1M8C A;  1SGR I;  2JYY A;  1HJA I;  2XRC A;  2KMO A;  1PPF I;  2JXD A;  1OYV I;  1NUB A;  3HH2 C;  2NU2 I;  1CGJ I;  2GKT I;  1UUC A;  1LR9 A;  1HPT A;  2NU1 I;  1SGQ I;  2GKR I;  1SGP I;  2JZM A;  2KMQ A;  2M5X A;  1MT1 A;  1R0R I;  2KCX A;  1OVO A;  1CT2 I;  1PCE A;  2QQD A;  1YTP A;  1YU6 C;  1SGE I;  1TBR R;  1BUS A;  1UVG A;  1TUR A;  1AN1 I;  2BUS A;  3B4V C;  2SGE I;  4SGB I;  2SGQ I;  1N13 A;  1CT0 I;  1Z7K B;  2OVO A;  3TJQ A;  2ERW A;  1DS2 I;  3SGQ I;  1TBQ R;  2N71 A;  1BMO A;  1CT4 I;  4HGU A;  1OMT A;  1OMU A;  1UVF A; 
#chains in the Genus database with same CATH topology
 9WGA A;  1TOT A;  3OVO A;  5HI7 A;  1FAQ A;  2ORV A;  4E1P A;  1DS3 I;  3VDU A;  1SGD I;  1KBE A;  5EX0 A;  1K7T A;  4B6D A;  1TUS A;  2E73 A;  1R79 A;  2X3T A;  1LR8 A;  2Y0M A;  1IY5 A;  1TGS I;  2JW6 A;  1PJU A;  2CWG A;  3R5B A;  5FUX A;  3SEK C;  1UHA A;  2KMP A;  1W4R A;  2V53 A;  4FKD A;  2OZU A;  3BJI A;  2CJS C;  1CHO I;  1V1H A;  2ELI A;  2GVI A;  4JCV E;  2NU4 I;  2NU0 I;  1ULM A;  1FAR A;  1PTR A;  2WCY A;  4MPI A;  2N17 A;  2J9R A;  2LEO A;  4UXH A;  3UGI A;  5DAE A;  1H0Z A;  5CCL A;  3QTL D;  1K7U A;  1CGI I;  2N52 A;  3OXL A;  1Y1C A;  1IW4 A;  1KMA A;  2L8E A;  1XA6 A;  1Y8F A;  1ULK A;  2ODD A;  1Y1B A;  1RFH A;  2A20 A;  2QQC A;  2SGF I;  2SGP I;  1WKX A;  1MJB A;  3R5C A;  4GI3 C;  2F3C I;  2N1A B;  1LR7 A;  1HDL A;  4WP4 A;  1IY6 A;  5E3R A;  2LB7 A;  1W3S A;  1FYB A;  5E3P A;  3E2I A;  2P6A C;  1SGN I;  2ARP F;  1KBF A;  4OVO A;  2QQ0 A;  2L7X A;  3FSX A;  3UEY A;  3GOX A;  2K9H A;  3OL0 A;  2SGD I;  2B0U C;  2QQE A;  3UGL A;  1CE3 A;  2DB6 A;  1SGY I;  1MJA A;  3VDP A;  2RIJ A;  3TO6 A;  3OXF A;  4AML A;  2KMR A;  2NU3 I;  1WTJ A;  4E1R A;  5JHW C;  1TIH A;  3QWP A;  2JA1 A;  1Z2I A;  2GKV A;  3PDN A;  1HEV A;  2ENN A;  1M8B A;  2WGC A;  3SGB I;  4DNC A;  5CCM A;  1M8C A;  1CSO I;  1SGR I;  5J8C A;  2FNF X;  2JYY A;  3TO7 A;  3UOE A;  2E5R A;  1HJA I;  2XRC A;  2UZ3 A;  2KMO A;  5FUV A;  1PPF I;  2RC4 A;  3TOB A;  2DKV A;  3KY9 A;  2PQ8 A;  2JXD A;  4L9M A;  2V1C C;  2X52 A;  1OYV I;  1NUB A;  2CWF A;  3HH2 C;  2NU2 I;  3R5D A;  1CGJ I;  2YUU A;  1VDD A;  2J87 A;  1PTQ A;  2GKT I;  3CXL A;  1P9Z A;  1X74 A;  2CWH A;  1UUC A;  1LR9 A;  2WVJ A;  1HPT A;  2NU1 I;  1TBN A;  1SGQ I;  2GKR I;  1SGP I;  2ENZ A;  2JZM A;  3MEK A;  2KMQ A;  1U5K A;  4A24 A;  2LUY A;  3FC3 A;  2M5X A;  2QPO A;  3E59 A;  3UEJ A;  2GIV A;  1MT1 A;  1R0R I;  2KCX A;  2OU2 A;  2DIP A;  1OVO A;  5FUY A;  1CT2 I;  1PCE A;  2QQD A;  1YTP A;  3TOA A;  1WGC A;  1V1I A;  3UGD A;  1YU6 C;  4UXI A;  1SGE I;  1TBR R;  1WGT A;  1FY7 A;  3OXG A;  1S20 A;  2V1C A;  1XX6 A;  1BUS A;  3UFF A;  1UVG A;  1K7V A;  1TUR A;  4UXJ A;  5EX3 A;  1AN1 I;  2YQP A;  2BUS A;  3QAH A;  2ORW A;  3B4V C;  2SGE I;  4SGB I;  1NXU A;  2SGQ I;  1N13 A;  2UVO A;  5HQ8 A;  1CT0 I;  3VE5 A;  1Z7K B;  2OVO A;  3TJQ A;  1ULN A;  3RU0 A;  2ERW A;  1DS2 I;  5FUW A;  1TBO A;  1X4S A;  3SGQ I;  1TBQ R;  2W0T A;  1MJ9 A;  3FSY A;  2N71 A;  1BMO A;  1CT4 I;  4HGU A;  2OD1 A;  1XBT A;  1OMT A;  1OMU A;  3R5A A;  1Q9B A;  5E3Q A;  7WGA A;  1P9G A;  2ROW A;  1UVF A;  3TO9 A;  2VRW B;  5J8F A;  3D00 A;  2B8T A; 
#chains in the Genus database with same CATH homology
 1TOT A;  3OVO A;  5HI7 A;  1FAQ A;  2ORV A;  4E1P A;  1DS3 I;  3VDU A;  1SGD I;  1KBE A;  5EX0 A;  4B6D A;  1TUS A;  2E73 A;  1R79 A;  1LR8 A;  1IY5 A;  1TGS I;  2JW6 A;  1PJU A;  5FUX A;  3SEK C;  2KMP A;  1W4R A;  2V53 A;  4FKD A;  3BJI A;  2CJS C;  1CHO I;  1V1H A;  2ELI A;  2GVI A;  4JCV E;  2NU4 I;  2NU0 I;  1FAR A;  1PTR A;  2WCY A;  2N17 A;  2J9R A;  2LEO A;  4UXH A;  3UGI A;  5DAE A;  1H0Z A;  5CCL A;  3QTL D;  1CGI I;  2N52 A;  3OXL A;  1Y1C A;  1IW4 A;  1KMA A;  2L8E A;  1XA6 A;  1Y8F A;  2ODD A;  1Y1B A;  1RFH A;  2A20 A;  2QQC A;  2SGF I;  2SGP I;  4GI3 C;  2F3C I;  2N1A B;  1LR7 A;  1HDL A;  1IY6 A;  1W3S A;  1FYB A;  3E2I A;  2P6A C;  1SGN I;  2ARP F;  1KBF A;  4OVO A;  2QQ0 A;  2L7X A;  3UEY A;  3GOX A;  2K9H A;  3OL0 A;  2SGD I;  2B0U C;  2QQE A;  3UGL A;  1CE3 A;  2DB6 A;  1SGY I;  3VDP A;  3OXF A;  2KMR A;  2NU3 I;  4E1R A;  5JHW C;  1TIH A;  3QWP A;  2JA1 A;  2GKV A;  3PDN A;  2ENN A;  1M8B A;  3SGB I;  5CCM A;  1CSO I;  1M8C A;  1SGR I;  2FNF X;  2JYY A;  2E5R A;  1HJA I;  2XRC A;  2UZ3 A;  2KMO A;  5FUV A;  1PPF I;  3KY9 A;  2JXD A;  4L9M A;  2V1C C;  1OYV I;  1NUB A;  3HH2 C;  2NU2 I;  1CGJ I;  2YUU A;  1VDD A;  2J87 A;  1PTQ A;  2GKT I;  3CXL A;  1X74 A;  1UUC A;  1LR9 A;  2WVJ A;  1HPT A;  2NU1 I;  1TBN A;  1SGQ I;  2GKR I;  1SGP I;  2ENZ A;  2JZM A;  3MEK A;  2KMQ A;  1U5K A;  4A24 A;  2LUY A;  3FC3 A;  2M5X A;  2QPO A;  3E59 A;  3UEJ A;  1MT1 A;  1R0R I;  2KCX A;  2DIP A;  1OVO A;  5FUY A;  1CT2 I;  1PCE A;  2QQD A;  1YTP A;  1V1I A;  3UGD A;  1YU6 C;  4UXI A;  1SGE I;  1TBR R;  3OXG A;  2V1C A;  1XX6 A;  1BUS A;  3UFF A;  1UVG A;  1TUR A;  4UXJ A;  5EX3 A;  1AN1 I;  2YQP A;  2BUS A;  2ORW A;  3B4V C;  2SGE I;  4SGB I;  2SGQ I;  1N13 A;  5HQ8 A;  1CT0 I;  3VE5 A;  1Z7K B;  2OVO A;  3TJQ A;  3RU0 A;  2ERW A;  1DS2 I;  5FUW A;  1TBO A;  1X4S A;  3SGQ I;  1TBQ R;  2W0T A;  2N71 A;  1BMO A;  1CT4 I;  4HGU A;  2OD1 A;  1XBT A;  1OMT A;  1OMU A;  2ROW A;  1UVF A;  2VRW B;  3D00 A;  2B8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...