1SGNI

Asn 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTNEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
total genus 12
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgnI00
1SGPI 1DS2I 2SGFI 1CT4I 2KMQA 2QQCA 1OVOA 1Z7KB 1TBRR 5JHWC 2KMRA 2N71A 3B4VC 1OMTA 1KMAA 1H0ZA 3SEKC 1CGJI 2SGEI 1LR9A 3HH2C 1HDLA 2B0UC 3OVOA 2XRCA 1Y1CA 2NU4I 2JZMA 2SGDI 1TGSI 1M8BA 2V53A 1PCEA 2SGQI 1CE3A 1IY6A 2GKVA 5DAEA 1CHOI 1CGII 1HPTA 1IW4A 1UVFA 1SGNI 1AN1I 2NU3I 2KCXA 2QQDA 1TUSA 1SGQI 1SGDI 4GI3C 2KMPA 1Y1BA 3SGBI 2F3CI 2BUSA 1OMUA 3QTLD 2GKTI 1M8CA 4OVOA 2N52A 3SGQI 1YTPA 1CT0I 2ERWA 1BMOA 2M5XA 1DS3I 1MT1A 2N17A 1CT2I 1NUBA 1CSOI 1OYVI 1N13A 1IY5A 2SGPI 1FYBA 2LEOA 1UUCA 1PPFI 1TURA 2OVOA 1LR8A 1HJAI 1SGYI 1TIHA 2NU0I 1LR7A 1TBQR 2ARPF 1SGEI 1YU6C 2KMOA 1SGRI 4HGUA 1UVGA 2WCYA 2JXDA 2P6AC 1R0RI 2GKRI 4SGBI 1BUSA 2NU1I 3TJQA 2NU2I 2JYYA 1PJUA
chains in the Genus database with same CATH superfamily
3QWPA 3UEJA 5CCLA 1RFHA 1SGPI 1P9ZA 5HI7A 1XX6A 2QQEA 1DS2I 3OXFA 2SGFI 2YUUA 3VDUA 1CT4I 1K7UA 4UXIA 2CWHA 2KMQA 1OVOA 2QQCA 2L7XA 1VDDA 3VE5A 4DNCA 1Z7KB 1TBRR 1ULNA 3TJQA 5JHWC 1Z2IA 2VRWB 1ULKA 2KMRA 3QAHA 2N71A 4MPIA 3UGLA 3R5DA 3TO6A 3CXLA 3B4VC 2WVJA 3R5CA 1OMTA 1WGCA 5E3RA 1KMAA 3BJIA 3MEKA 1H0ZA 1WGTA 3SEKC 1CGJI 1FY7A 2OD1A 2SGEI 2OU2A 1LR9A 3HH2C 1HDLA 1PTQA 4FKDA 9WGAA 2LB7A 5FUWA 2ENNA 3D00A 1V1HA 2J87A 2B0UC 3OVOA 5J8CA 2XRCA 2GIVA 1Y1CA 4AMLA 2J9RA 2NU4I 5E3PA 3UGDA 1FARA 2JZMA 2L8EA 1TGSI 2SGDI 1M8BA 3TOBA 1W4RA 3UGIA 1K7TA 2V53A 3R5AA 1PCEA 2SGQI 4A24A 1P9GA 1W3SA 2ORVA 1CE3A 1IY6A 2GKVA 5DAEA 2GVIA 2YQPA 1NXUA 1CHOI 1TBNA 2K9HA 4E1RA 1CGII 3FSYA 1R79A 4WP4A 1HPTA 3TOAA 3RU0A 3OXGA 1UVFA 1IW4A 1SGNI 1FAQA 2CJSC 2ENZA 2PQ8A 2UVOA 2UZ3A 1AN1I 5E3QA 1XA6A 2NU3I 2KCXA 2N1AB 2ORWA 2QQDA 1S20A 1TUSA 2LUYA 3VDPA 5J8FA 3PDNA 1SGQI 1SGDI 4GI3C 2KMPA 1Y1BA 2Y0MA 2F3CI 5FUYA 3SGBI 3E59A 2BUSA 1MJ9A 1TOTA 1WTJA 3TO7A 1OMUA 1KBFA 3QTLD 1MJBA 1Y8FA 2GKTI 2QPOA 2DKVA 1M8CA 2JA1A 4OVOA 1X4SA 2N52A 3KY9A 3SGQI 2E5RA 1MJAA 1Q9BA 1YTPA 1CT0I 1HEVA 2ERWA 1U5KA 2OZUA 1BMOA 2X52A 3UFFA 1XBTA 7WGAA 2M5XA 1DS3I 2RC4A 2RIJA 1MT1A 2E73A 2N17A 2V1CA 5HQ8A 1CT2I 3E2IA 1NUBA 1CSOI 3R5BA 3UOEA 1OYVI 1N13A 3FC3A 5FUVA 2ROWA 4B6DA 2SGPI 5CCMA 1KBEA 1IY5A 2V1CC 3FSXA 3OXLA 1FYBA 2LEOA 5EX0A 1UUCA 1PPFI 1TURA 2OVOA 1LR8A 4L9MA 1HJAI 2A20A 1SGYI 2X3TA 5EX3A 1V1IA 1TIHA 2NU0I 1LR7A 2ODDA 1WKXA 1UHAA 2B8TA 1TBQR 2ARPF 1SGEI 2ELIA 1YU6C 2DIPA 2QQ0A 2KMOA 1X74A 4UXJA 2FNFX 1SGRI 3OL0A 2CWGA 3UEYA 4E1PA 4HGUA 1UVGA 3TO9A 2WCYA 2JXDA 2P6AC 1R0RI 2GKRI 4SGBI 1PTRA 1ULMA 2DB6A 5FUXA 4JCVE 1BUSA 2NU1I 1TBOA 4UXHA 3GOXA 2W0TA 2JW6A 2WGCA 2NU2I 1K7VA 2JYYA 1PJUA 2CWFA
chains in the Genus database with same CATH topology
3QWPA 3UEJA 5CCLA 1RFHA 1SGPI 5HI7A 1XX6A 2QQEA 1DS2I 3OXFA 2SGFI 2YUUA 3VDUA 1CT4I 4UXIA 2KMQA 2QQCA 1OVOA 2L7XA 1VDDA 3VE5A 1Z7KB 1TBRR 5JHWC 2VRWB 2KMRA 2N71A 3UGLA 3CXLA 3B4VC 2WVJA 1OMTA 1KMAA 3BJIA 3MEKA 1H0ZA 3SEKC 1CGJI 2OD1A 2SGEI 1LR9A 3HH2C 1HDLA 1PTQA 4FKDA 5FUWA 2ENNA 3D00A 1V1HA 2J87A 2B0UC 3OVOA 2XRCA 1Y1CA 2J9RA 2NU4I 3UGDA 1FARA 2JZMA 2L8EA 1TGSI 2SGDI 1M8BA 1W4RA 3UGIA 2V53A 1PCEA 2SGQI 4A24A 1CE3A 1W3SA 1IY6A 2GKVA 5DAEA 2GVIA 2YQPA 1CHOI 1TBNA 2K9HA 4E1RA 1CGII 1R79A 1HPTA 1IW4A 3RU0A 3OXGA 1UVFA 1SGNI 1FAQA 2CJSC 2ENZA 2UZ3A 1AN1I 1XA6A 2NU3I 2KCXA 2N1AB 2ORWA 2QQDA 1TUSA 2LUYA 3VDPA 3PDNA 1SGQI 1SGDI 4GI3C 2KMPA 1Y1BA 3SGBI 2F3CI 5FUYA 3E59A 2BUSA 1TOTA 1OMUA 1KBFA 3QTLD 1Y8FA 2GKTI 2QPOA 1M8CA 2JA1A 4OVOA 1X4SA 2N52A 3KY9A 3SGQI 2E5RA 1YTPA 1CT0I 2ERWA 1U5KA 1BMOA 3UFFA 1XBTA 2M5XA 1DS3I 1MT1A 2E73A 2N17A 2V1CA 5HQ8A 1CT2I 3E2IA 1NUBA 1CSOI 1OYVI 1N13A 3FC3A 5FUVA 2ROWA 4B6DA 2SGPI 5CCMA 1KBEA 1IY5A 2V1CC 3OXLA 1FYBA 2LEOA 5EX0A 1UUCA 1PPFI 1TURA 2OVOA 1LR8A 4L9MA 1HJAI 2A20A 1SGYI 5EX3A 1V1IA 1TIHA 2NU0I 1LR7A 2ODDA 2B8TA 1TBQR 2ARPF 1SGEI 2ELIA 1YU6C 2DIPA 2QQ0A 2KMOA 1X74A 4UXJA 2FNFX 1SGRI 3OL0A 3UEYA 4E1PA 4HGUA 1UVGA 2WCYA 2JXDA 2P6AC 1R0RI 2GKRI 4SGBI 1PTRA 2DB6A 5FUXA 4JCVE 1BUSA 2NU1I 1TBOA 4UXHA 3GOXA 2W0TA 2JW6A 3TJQA 2NU2I 2ORVA 2JYYA 1PJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGP I;  1DS2 I;  2SGF I;  1CT4 I;  2KMQ A;  2QQC A;  1OVO A;  1Z7K B;  1TBR R;  5JHW C;  2KMR A;  2N71 A;  3B4V C;  1OMT A;  1KMA A;  1H0Z A;  3SEK C;  1CGJ I;  2SGE I;  1LR9 A;  3HH2 C;  1HDL A;  2B0U C;  3OVO A;  2XRC A;  1Y1C A;  2NU4 I;  2JZM A;  2SGD I;  1TGS I;  1M8B A;  2V53 A;  1PCE A;  2SGQ I;  1CE3 A;  1IY6 A;  2GKV A;  5DAE A;  1CHO I;  1CGI I;  1HPT A;  1IW4 A;  1UVF A;  1SGN I;  1AN1 I;  2NU3 I;  2KCX A;  2QQD A;  1TUS A;  1SGQ I;  1SGD I;  4GI3 C;  2KMP A;  1Y1B A;  3SGB I;  2F3C I;  2BUS A;  1OMU A;  3QTL D;  2GKT I;  1M8C A;  4OVO A;  2N52 A;  3SGQ I;  1YTP A;  1CT0 I;  2ERW A;  1BMO A;  2M5X A;  1DS3 I;  1MT1 A;  2N17 A;  1CT2 I;  1NUB A;  1CSO I;  1OYV I;  1N13 A;  1IY5 A;  2SGP I;  1FYB A;  2LEO A;  1UUC A;  1PPF I;  1TUR A;  2OVO A;  1LR8 A;  1HJA I;  1SGY I;  1TIH A;  2NU0 I;  1LR7 A;  1TBQ R;  2ARP F;  1SGE I;  1YU6 C;  2KMO A;  1SGR I;  4HGU A;  1UVG A;  2WCY A;  2JXD A;  2P6A C;  1R0R I;  2GKR I;  4SGB I;  1BUS A;  2NU1 I;  3TJQ A;  2NU2 I;  2JYY A;  1PJU A; 
#chains in the Genus database with same CATH topology
 3QWP A;  3UEJ A;  5CCL A;  1RFH A;  1SGP I;  1P9Z A;  5HI7 A;  1XX6 A;  2QQE A;  1DS2 I;  3OXF A;  2SGF I;  2YUU A;  3VDU A;  1CT4 I;  1K7U A;  4UXI A;  2CWH A;  2KMQ A;  1OVO A;  2QQC A;  2L7X A;  1VDD A;  3VE5 A;  4DNC A;  1Z7K B;  1TBR R;  1ULN A;  3TJQ A;  5JHW C;  1Z2I A;  2VRW B;  1ULK A;  2KMR A;  3QAH A;  2N71 A;  4MPI A;  3UGL A;  3R5D A;  3TO6 A;  3CXL A;  3B4V C;  2WVJ A;  3R5C A;  1OMT A;  1WGC A;  5E3R A;  1KMA A;  3BJI A;  3MEK A;  1H0Z A;  1WGT A;  3SEK C;  1CGJ I;  1FY7 A;  2OD1 A;  2SGE I;  2OU2 A;  1LR9 A;  3HH2 C;  1HDL A;  1PTQ A;  4FKD A;  9WGA A;  2LB7 A;  5FUW A;  2ENN A;  3D00 A;  1V1H A;  2J87 A;  2B0U C;  3OVO A;  5J8C A;  2XRC A;  2GIV A;  1Y1C A;  4AML A;  2J9R A;  2NU4 I;  5E3P A;  3UGD A;  1FAR A;  2JZM A;  2L8E A;  1TGS I;  2SGD I;  1M8B A;  3TOB A;  1W4R A;  3UGI A;  1K7T A;  2V53 A;  3R5A A;  1PCE A;  2SGQ I;  4A24 A;  1P9G A;  1W3S A;  2ORV A;  1CE3 A;  1IY6 A;  2GKV A;  5DAE A;  2GVI A;  2YQP A;  1NXU A;  1CHO I;  1TBN A;  2K9H A;  4E1R A;  1CGI I;  3FSY A;  1R79 A;  4WP4 A;  1HPT A;  3TOA A;  3RU0 A;  3OXG A;  1UVF A;  1IW4 A;  1SGN I;  1FAQ A;  2CJS C;  2ENZ A;  2PQ8 A;  2UVO A;  2UZ3 A;  1AN1 I;  5E3Q A;  1XA6 A;  2NU3 I;  2KCX A;  2N1A B;  2ORW A;  2QQD A;  1S20 A;  1TUS A;  2LUY A;  3VDP A;  5J8F A;  3PDN A;  1SGQ I;  1SGD I;  4GI3 C;  2KMP A;  1Y1B A;  2Y0M A;  2F3C I;  5FUY A;  3SGB I;  3E59 A;  2BUS A;  1MJ9 A;  1TOT A;  1WTJ A;  3TO7 A;  1OMU A;  1KBF A;  3QTL D;  1MJB A;  1Y8F A;  2GKT I;  2QPO A;  2DKV A;  1M8C A;  2JA1 A;  4OVO A;  1X4S A;  2N52 A;  3KY9 A;  3SGQ I;  2E5R A;  1MJA A;  1Q9B A;  1YTP A;  1CT0 I;  1HEV A;  2ERW A;  1U5K A;  2OZU A;  1BMO A;  2X52 A;  3UFF A;  1XBT A;  7WGA A;  2M5X A;  1DS3 I;  2RC4 A;  2RIJ A;  1MT1 A;  2E73 A;  2N17 A;  2V1C A;  5HQ8 A;  1CT2 I;  3E2I A;  1NUB A;  1CSO I;  3R5B A;  3UOE A;  1OYV I;  1N13 A;  3FC3 A;  5FUV A;  2ROW A;  4B6D A;  2SGP I;  5CCM A;  1KBE A;  1IY5 A;  2V1C C;  3FSX A;  3OXL A;  1FYB A;  2LEO A;  5EX0 A;  1UUC A;  1PPF I;  1TUR A;  2OVO A;  1LR8 A;  4L9M A;  1HJA I;  2A20 A;  1SGY I;  2X3T A;  5EX3 A;  1V1I A;  1TIH A;  2NU0 I;  1LR7 A;  2ODD A;  1WKX A;  1UHA A;  2B8T A;  1TBQ R;  2ARP F;  1SGE I;  2ELI A;  1YU6 C;  2DIP A;  2QQ0 A;  2KMO A;  1X74 A;  4UXJ A;  2FNF X;  1SGR I;  3OL0 A;  2CWG A;  3UEY A;  4E1P A;  4HGU A;  1UVG A;  3TO9 A;  2WCY A;  2JXD A;  2P6A C;  1R0R I;  2GKR I;  4SGB I;  1PTR A;  1ULM A;  2DB6 A;  5FUX A;  4JCV E;  1BUS A;  2NU1 I;  1TBO A;  4UXH A;  3GOX A;  2W0T A;  2JW6 A;  2WGC A;  2NU2 I;  1K7V A;  2JYY A;  1PJU A;  2CWF A; 
#chains in the Genus database with same CATH homology
 3QWP A;  3UEJ A;  5CCL A;  1RFH A;  1SGP I;  5HI7 A;  1XX6 A;  2QQE A;  1DS2 I;  3OXF A;  2SGF I;  2YUU A;  3VDU A;  1CT4 I;  4UXI A;  2KMQ A;  2QQC A;  1OVO A;  2L7X A;  1VDD A;  3VE5 A;  1Z7K B;  1TBR R;  5JHW C;  2VRW B;  2KMR A;  2N71 A;  3UGL A;  3CXL A;  3B4V C;  2WVJ A;  1OMT A;  1KMA A;  3BJI A;  3MEK A;  1H0Z A;  3SEK C;  1CGJ I;  2OD1 A;  2SGE I;  1LR9 A;  3HH2 C;  1HDL A;  1PTQ A;  4FKD A;  5FUW A;  2ENN A;  3D00 A;  1V1H A;  2J87 A;  2B0U C;  3OVO A;  2XRC A;  1Y1C A;  2J9R A;  2NU4 I;  3UGD A;  1FAR A;  2JZM A;  2L8E A;  1TGS I;  2SGD I;  1M8B A;  1W4R A;  3UGI A;  2V53 A;  1PCE A;  2SGQ I;  4A24 A;  1CE3 A;  1W3S A;  1IY6 A;  2GKV A;  5DAE A;  2GVI A;  2YQP A;  1CHO I;  1TBN A;  2K9H A;  4E1R A;  1CGI I;  1R79 A;  1HPT A;  1IW4 A;  3RU0 A;  3OXG A;  1UVF A;  1SGN I;  1FAQ A;  2CJS C;  2ENZ A;  2UZ3 A;  1AN1 I;  1XA6 A;  2NU3 I;  2KCX A;  2N1A B;  2ORW A;  2QQD A;  1TUS A;  2LUY A;  3VDP A;  3PDN A;  1SGQ I;  1SGD I;  4GI3 C;  2KMP A;  1Y1B A;  3SGB I;  2F3C I;  5FUY A;  3E59 A;  2BUS A;  1TOT A;  1OMU A;  1KBF A;  3QTL D;  1Y8F A;  2GKT I;  2QPO A;  1M8C A;  2JA1 A;  4OVO A;  1X4S A;  2N52 A;  3KY9 A;  3SGQ I;  2E5R A;  1YTP A;  1CT0 I;  2ERW A;  1U5K A;  1BMO A;  3UFF A;  1XBT A;  2M5X A;  1DS3 I;  1MT1 A;  2E73 A;  2N17 A;  2V1C A;  5HQ8 A;  1CT2 I;  3E2I A;  1NUB A;  1CSO I;  1OYV I;  1N13 A;  3FC3 A;  5FUV A;  2ROW A;  4B6D A;  2SGP I;  5CCM A;  1KBE A;  1IY5 A;  2V1C C;  3OXL A;  1FYB A;  2LEO A;  5EX0 A;  1UUC A;  1PPF I;  1TUR A;  2OVO A;  1LR8 A;  4L9M A;  1HJA I;  2A20 A;  1SGY I;  5EX3 A;  1V1I A;  1TIH A;  2NU0 I;  1LR7 A;  2ODD A;  2B8T A;  1TBQ R;  2ARP F;  1SGE I;  2ELI A;  1YU6 C;  2DIP A;  2QQ0 A;  2KMO A;  1X74 A;  4UXJ A;  2FNF X;  1SGR I;  3OL0 A;  3UEY A;  4E1P A;  4HGU A;  1UVG A;  2WCY A;  2JXD A;  2P6A C;  1R0R I;  2GKR I;  4SGB I;  1PTR A;  2DB6 A;  5FUX A;  4JCV E;  1BUS A;  2NU1 I;  1TBO A;  4UXH A;  3GOX A;  2W0T A;  2JW6 A;  3TJQ A;  2NU2 I;  2ORV A;  2JYY A;  1PJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...