1SGNI

Asn 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTNEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 12
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1sgnI00
1IY6A 1TGSI 2F3CI 2GKRI 1CT0I 2XRCA 2GKTI 2LEOA 2KCXA 2M5XA 1UVGA 2N17A 2SGEI 1Z7KB 2KMPA 2NU1I 2B0UC 2QQCA 1AN1I 2N52A 1PJUA 2KMOA 4HGUA 3SGBI 1SGDI 1M8BA 1NUBA 4OVOA 1HJAI 1SGRI 3QTLD 1R0RI 1TUSA 1TIHA 2BUSA 3SGQI 1CT2I 1CE3A 1DS3I 1HDLA 1LR9A 2SGQI 2NU0I 1CSOI 1HPTA 1OMUA 1UUCA 2KMRA 4GI3C 2JXDA 1H0ZA 2NU4I 1OMTA 1M8CA 1DS2I 2NU2I 2JYYA 1IY5A 2NU3I 1TBQR 2V53A 1FYBA 1PPFI 1SGEI 1IW4A 1PCEA 1LR7A 1CHOI 2OVOA 2GKVA 5JHWC 1BMOA 1KMAA 1CGII 1BUSA 1LR8A 2QQDA 1SGYI 1CGJI 1MT1A 1Y1CA 1Y1BA 1SGNI 2ARPF 1OYVI 2P6AC 2ERWA 1SGPI 1CT4I 1OVOA 2WCYA 1N13A 1TBRR 1SGQI 2KMQA 2N71A 2SGDI 3OVOA 1TURA 1YTPA 3SEKC 2SGPI 3B4VC 3HH2C 1UVFA 2SGFI 3TJQA 1YU6C 4SGBI 2JZMA 5DAEA
chains in the Genus database with same CATH superfamily
3TOBA 1IY6A 2X52A 1TGSI 2N1AB 2GVIA 1XX6A 2F3CI 2GKRI 1WGCA 2FNFX 1CT0I 2W0TA 2XRCA 3KY9A 3FSYA 1WTJA 2GKTI 5E3QA 1MJ9A 3E2IA 1S20A 2LEOA 2KCXA 3MEKA 1K7TA 2OD1A 2M5XA 1UVGA 2N17A 2SGEI 3R5BA 3TO7A 4WP4A 3GOXA 3UEYA 1KBEA 3E59A 1Z7KB 2KMPA 1ULNA 2ENZA 2NU1I 3D00A 3OXFA 2B0UC 2QQCA 2QPOA 2QQ0A 1FAQA 1AN1I 2N52A 4DNCA 1P9GA 1PJUA 2KMOA 3OL0A 1ULKA 2B8TA 1RFHA 2J9RA 2ORWA 1SGDI 1M8BA 4HGUA 3SGBI 2GIVA 1NUBA 2PQ8A 1HJAI 1SGRI 3QTLD 4OVOA 5HI7A 4E1RA 1UHAA 3VDUA 3TO9A 2ELIA 1X74A 1R0RI 1FARA 2WVJA 1TUSA 1K7UA 1TIHA 2BUSA 3SGQI 5J8CA 4A24A 1CT2I 3TO6A 1CE3A 1DS3I 5EX3A 3CXLA 1Y8FA 1HDLA 3FSXA 1LR9A 4E1PA 2SGQI 2NU0I 3UOEA 1CSOI 1PTQA 1HPTA 2YQPA 1OMUA 2YUUA 3TOAA 1UUCA 2JW6A 1MJAA 2CWGA 2KMRA 4JCVE 5HQ8A 5J8FA 1Z2IA 4GI3C 2K9HA 5E3PA 2E73A 2JXDA 1H0ZA 2DKVA 1HEVA 1W4RA 2NU4I 1OMTA 1NXUA 1M8CA 1DS2I 2ENNA 2X3TA 2WGCA 2NU2I 3VDPA 3R5CA 2DIPA 2JYYA 5FUYA 3UGDA 1IY5A 1W3SA 2NU3I 1TBQR 2UZ3A 2V53A 2Y0MA 3UGLA 1PPFI 1FYBA 1R79A 1SGEI 3UEJA 1PCEA 1LR7A 1CHOI 1VDDA 2OVOA 1V1HA 2GKVA 2JA1A 4MPIA 5FUWA 5JHWC 2OU2A 5FUVA 1WGTA 1TBNA 1BMOA 2CJSC 1KMAA 2ODDA 1CGII 3OXLA 4AMLA 1BUSA 1LR8A 2LB7A 2QQDA 3R5AA 5CCLA 1SGYI 1CGJI 1MT1A 2VRWB 3QWPA 3OXGA 3VE5A 4B6DA 1Y1CA 2V1CA 2J87A 1P9ZA 2L7XA 2QQEA 1ULMA 1V1IA 1Y1BA 1PTRA 1SGNI 2ARPF 1OYVI 2P6AC 4L9MA 2ERWA 2UVOA 1SGPI 3BJIA 2CWFA 2OZUA 2V1CC 1CT4I 4FKDA 3UGIA 1OVOA 1WKXA 2WCYA 5CCMA 7WGAA 1IW4A 1N13A 1TOTA 1TBRR 2ORVA 1SGQI 2DB6A 1XBTA 1TBOA 2KMQA 2N71A 2CWHA 2RC4A 1Q9BA 2LUYA 2SGDI 3QAHA 3R5DA 4UXIA 5EX0A 3OVOA 1TURA 1YTPA 3SEKC 3PDNA 1FY7A 1X4SA 2SGPI 9WGAA 3RU0A 1KBFA 3B4VC 3FC3A 1U5KA 3HH2C 4UXJA 5FUXA 1UVFA 2SGFI 3TJQA 2E5RA 2ROWA 1K7VA 1XA6A 2A20A 1YU6C 4SGBI 1MJBA 2RIJA 2L8EA 2JZMA 4UXHA 3UFFA 5E3RA 5DAEA
chains in the Genus database with same CATH topology
1IY6A 1TGSI 2N1AB 2GVIA 1XX6A 2F3CI 2GKRI 2FNFX 1CT0I 2W0TA 2XRCA 3KY9A 2GKTI 3E2IA 2LEOA 2KCXA 3MEKA 2OD1A 2M5XA 1UVGA 2N17A 2SGEI 3GOXA 3UEYA 1KBEA 3E59A 1Z7KB 2KMPA 2ENZA 2NU1I 3D00A 3OXFA 2B0UC 2QQCA 2QPOA 2QQ0A 1FAQA 1AN1I 2N52A 1PJUA 2KMOA 3OL0A 2B8TA 1RFHA 2J9RA 2ORWA 1SGDI 1M8BA 4HGUA 3SGBI 1NUBA 4OVOA 1HJAI 1SGRI 3QTLD 5HI7A 4E1RA 3VDUA 2ELIA 1X74A 1R0RI 1FARA 2WVJA 1TUSA 1TIHA 2BUSA 3SGQI 4A24A 1CT2I 1CE3A 1DS3I 5EX3A 3CXLA 1Y8FA 1HDLA 1LR9A 4E1PA 2SGQI 2NU0I 1CSOI 1PTQA 1HPTA 2YQPA 1OMUA 2YUUA 1UUCA 2JW6A 4JCVE 2KMRA 5HQ8A 4GI3C 2K9HA 2E73A 2JXDA 1H0ZA 1W4RA 2NU4I 1OMTA 1M8CA 1DS2I 2ENNA 2NU2I 3VDPA 2DIPA 2JYYA 5FUYA 3UGDA 1IY5A 1W3SA 2NU3I 1TBQR 2UZ3A 2V53A 3UGLA 1FYBA 1PPFI 1R79A 1SGEI 3UEJA 1PCEA 1LR7A 1CHOI 1VDDA 2OVOA 1V1HA 2GKVA 2JA1A 5FUWA 5JHWC 5FUVA 1TBNA 1BMOA 2CJSC 1KMAA 2ODDA 1CGII 3OXLA 1BUSA 1LR8A 2QQDA 5CCLA 1SGYI 1CGJI 1MT1A 2VRWB 3QWPA 3OXGA 3VE5A 4B6DA 1Y1CA 2V1CA 2J87A 2L7XA 2QQEA 1V1IA 1Y1BA 1PTRA 1SGNI 2ARPF 1OYVI 2P6AC 4L9MA 2ERWA 1SGPI 3BJIA 2V1CC 1CT4I 4FKDA 3UGIA 1OVOA 2WCYA 5CCMA 1IW4A 1N13A 1TOTA 1TBRR 2ORVA 1SGQI 2DB6A 1XBTA 1TBOA 2KMQA 2N71A 2SGDI 2LUYA 4UXIA 5EX0A 3OVOA 1TURA 1YTPA 3SEKC 3PDNA 1X4SA 2SGPI 3RU0A 1KBFA 3B4VC 3FC3A 1U5KA 3HH2C 4UXJA 5FUXA 1UVFA 2SGFI 3TJQA 2E5RA 2ROWA 1XA6A 2A20A 1YU6C 4SGBI 2L8EA 2JZMA 4UXHA 3UFFA 5DAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IY6 A;  1TGS I;  2F3C I;  2GKR I;  1CT0 I;  2XRC A;  2GKT I;  2LEO A;  2KCX A;  2M5X A;  1UVG A;  2N17 A;  2SGE I;  1Z7K B;  2KMP A;  2NU1 I;  2B0U C;  2QQC A;  1AN1 I;  2N52 A;  1PJU A;  2KMO A;  4HGU A;  3SGB I;  1SGD I;  1M8B A;  1NUB A;  4OVO A;  1HJA I;  1SGR I;  3QTL D;  1R0R I;  1TUS A;  1TIH A;  2BUS A;  3SGQ I;  1CT2 I;  1CE3 A;  1DS3 I;  1HDL A;  1LR9 A;  2SGQ I;  2NU0 I;  1CSO I;  1HPT A;  1OMU A;  1UUC A;  2KMR A;  4GI3 C;  2JXD A;  1H0Z A;  2NU4 I;  1OMT A;  1M8C A;  1DS2 I;  2NU2 I;  2JYY A;  1IY5 A;  2NU3 I;  1TBQ R;  2V53 A;  1FYB A;  1PPF I;  1SGE I;  1IW4 A;  1PCE A;  1LR7 A;  1CHO I;  2OVO A;  2GKV A;  5JHW C;  1BMO A;  1KMA A;  1CGI I;  1BUS A;  1LR8 A;  2QQD A;  1SGY I;  1CGJ I;  1MT1 A;  1Y1C A;  1Y1B A;  1SGN I;  2ARP F;  1OYV I;  2P6A C;  2ERW A;  1SGP I;  1CT4 I;  1OVO A;  2WCY A;  1N13 A;  1TBR R;  1SGQ I;  2KMQ A;  2N71 A;  2SGD I;  3OVO A;  1TUR A;  1YTP A;  3SEK C;  2SGP I;  3B4V C;  3HH2 C;  1UVF A;  2SGF I;  3TJQ A;  1YU6 C;  4SGB I;  2JZM A;  5DAE A; 
#chains in the Genus database with same CATH topology
 3TOB A;  1IY6 A;  2X52 A;  1TGS I;  2N1A B;  2GVI A;  1XX6 A;  2F3C I;  2GKR I;  1WGC A;  2FNF X;  1CT0 I;  2W0T A;  2XRC A;  3KY9 A;  3FSY A;  1WTJ A;  2GKT I;  5E3Q A;  1MJ9 A;  3E2I A;  1S20 A;  2LEO A;  2KCX A;  3MEK A;  1K7T A;  2OD1 A;  2M5X A;  1UVG A;  2N17 A;  2SGE I;  3R5B A;  3TO7 A;  4WP4 A;  3GOX A;  3UEY A;  1KBE A;  3E59 A;  1Z7K B;  2KMP A;  1ULN A;  2ENZ A;  2NU1 I;  3D00 A;  3OXF A;  2B0U C;  2QQC A;  2QPO A;  2QQ0 A;  1FAQ A;  1AN1 I;  2N52 A;  4DNC A;  1P9G A;  1PJU A;  2KMO A;  3OL0 A;  1ULK A;  2B8T A;  1RFH A;  2J9R A;  2ORW A;  1SGD I;  1M8B A;  4HGU A;  3SGB I;  2GIV A;  1NUB A;  2PQ8 A;  1HJA I;  1SGR I;  3QTL D;  4OVO A;  5HI7 A;  4E1R A;  1UHA A;  3VDU A;  3TO9 A;  2ELI A;  1X74 A;  1R0R I;  1FAR A;  2WVJ A;  1TUS A;  1K7U A;  1TIH A;  2BUS A;  3SGQ I;  5J8C A;  4A24 A;  1CT2 I;  3TO6 A;  1CE3 A;  1DS3 I;  5EX3 A;  3CXL A;  1Y8F A;  1HDL A;  3FSX A;  1LR9 A;  4E1P A;  2SGQ I;  2NU0 I;  3UOE A;  1CSO I;  1PTQ A;  1HPT A;  2YQP A;  1OMU A;  2YUU A;  3TOA A;  1UUC A;  2JW6 A;  1MJA A;  2CWG A;  2KMR A;  4JCV E;  5HQ8 A;  5J8F A;  1Z2I A;  4GI3 C;  2K9H A;  5E3P A;  2E73 A;  2JXD A;  1H0Z A;  2DKV A;  1HEV A;  1W4R A;  2NU4 I;  1OMT A;  1NXU A;  1M8C A;  1DS2 I;  2ENN A;  2X3T A;  2WGC A;  2NU2 I;  3VDP A;  3R5C A;  2DIP A;  2JYY A;  5FUY A;  3UGD A;  1IY5 A;  1W3S A;  2NU3 I;  1TBQ R;  2UZ3 A;  2V53 A;  2Y0M A;  3UGL A;  1PPF I;  1FYB A;  1R79 A;  1SGE I;  3UEJ A;  1PCE A;  1LR7 A;  1CHO I;  1VDD A;  2OVO A;  1V1H A;  2GKV A;  2JA1 A;  4MPI A;  5FUW A;  5JHW C;  2OU2 A;  5FUV A;  1WGT A;  1TBN A;  1BMO A;  2CJS C;  1KMA A;  2ODD A;  1CGI I;  3OXL A;  4AML A;  1BUS A;  1LR8 A;  2LB7 A;  2QQD A;  3R5A A;  5CCL A;  1SGY I;  1CGJ I;  1MT1 A;  2VRW B;  3QWP A;  3OXG A;  3VE5 A;  4B6D A;  1Y1C A;  2V1C A;  2J87 A;  1P9Z A;  2L7X A;  2QQE A;  1ULM A;  1V1I A;  1Y1B A;  1PTR A;  1SGN I;  2ARP F;  1OYV I;  2P6A C;  4L9M A;  2ERW A;  2UVO A;  1SGP I;  3BJI A;  2CWF A;  2OZU A;  2V1C C;  1CT4 I;  4FKD A;  3UGI A;  1OVO A;  1WKX A;  2WCY A;  5CCM A;  7WGA A;  1IW4 A;  1N13 A;  1TOT A;  1TBR R;  2ORV A;  1SGQ I;  2DB6 A;  1XBT A;  1TBO A;  2KMQ A;  2N71 A;  2CWH A;  2RC4 A;  1Q9B A;  2LUY A;  2SGD I;  3QAH A;  3R5D A;  4UXI A;  5EX0 A;  3OVO A;  1TUR A;  1YTP A;  3SEK C;  3PDN A;  1FY7 A;  1X4S A;  2SGP I;  9WGA A;  3RU0 A;  1KBF A;  3B4V C;  3FC3 A;  1U5K A;  3HH2 C;  4UXJ A;  5FUX A;  1UVF A;  2SGF I;  3TJQ A;  2E5R A;  2ROW A;  1K7V A;  1XA6 A;  2A20 A;  1YU6 C;  4SGB I;  1MJB A;  2RIJ A;  2L8E A;  2JZM A;  4UXH A;  3UFF A;  5E3R A;  5DAE A; 
#chains in the Genus database with same CATH homology
 1IY6 A;  1TGS I;  2N1A B;  2GVI A;  1XX6 A;  2F3C I;  2GKR I;  2FNF X;  1CT0 I;  2W0T A;  2XRC A;  3KY9 A;  2GKT I;  3E2I A;  2LEO A;  2KCX A;  3MEK A;  2OD1 A;  2M5X A;  1UVG A;  2N17 A;  2SGE I;  3GOX A;  3UEY A;  1KBE A;  3E59 A;  1Z7K B;  2KMP A;  2ENZ A;  2NU1 I;  3D00 A;  3OXF A;  2B0U C;  2QQC A;  2QPO A;  2QQ0 A;  1FAQ A;  1AN1 I;  2N52 A;  1PJU A;  2KMO A;  3OL0 A;  2B8T A;  1RFH A;  2J9R A;  2ORW A;  1SGD I;  1M8B A;  4HGU A;  3SGB I;  1NUB A;  4OVO A;  1HJA I;  1SGR I;  3QTL D;  5HI7 A;  4E1R A;  3VDU A;  2ELI A;  1X74 A;  1R0R I;  1FAR A;  2WVJ A;  1TUS A;  1TIH A;  2BUS A;  3SGQ I;  4A24 A;  1CT2 I;  1CE3 A;  1DS3 I;  5EX3 A;  3CXL A;  1Y8F A;  1HDL A;  1LR9 A;  4E1P A;  2SGQ I;  2NU0 I;  1CSO I;  1PTQ A;  1HPT A;  2YQP A;  1OMU A;  2YUU A;  1UUC A;  2JW6 A;  4JCV E;  2KMR A;  5HQ8 A;  4GI3 C;  2K9H A;  2E73 A;  2JXD A;  1H0Z A;  1W4R A;  2NU4 I;  1OMT A;  1M8C A;  1DS2 I;  2ENN A;  2NU2 I;  3VDP A;  2DIP A;  2JYY A;  5FUY A;  3UGD A;  1IY5 A;  1W3S A;  2NU3 I;  1TBQ R;  2UZ3 A;  2V53 A;  3UGL A;  1FYB A;  1PPF I;  1R79 A;  1SGE I;  3UEJ A;  1PCE A;  1LR7 A;  1CHO I;  1VDD A;  2OVO A;  1V1H A;  2GKV A;  2JA1 A;  5FUW A;  5JHW C;  5FUV A;  1TBN A;  1BMO A;  2CJS C;  1KMA A;  2ODD A;  1CGI I;  3OXL A;  1BUS A;  1LR8 A;  2QQD A;  5CCL A;  1SGY I;  1CGJ I;  1MT1 A;  2VRW B;  3QWP A;  3OXG A;  3VE5 A;  4B6D A;  1Y1C A;  2V1C A;  2J87 A;  2L7X A;  2QQE A;  1V1I A;  1Y1B A;  1PTR A;  1SGN I;  2ARP F;  1OYV I;  2P6A C;  4L9M A;  2ERW A;  1SGP I;  3BJI A;  2V1C C;  1CT4 I;  4FKD A;  3UGI A;  1OVO A;  2WCY A;  5CCM A;  1IW4 A;  1N13 A;  1TOT A;  1TBR R;  2ORV A;  1SGQ I;  2DB6 A;  1XBT A;  1TBO A;  2KMQ A;  2N71 A;  2SGD I;  2LUY A;  4UXI A;  5EX0 A;  3OVO A;  1TUR A;  1YTP A;  3SEK C;  3PDN A;  1X4S A;  2SGP I;  3RU0 A;  1KBF A;  3B4V C;  3FC3 A;  1U5K A;  3HH2 C;  4UXJ A;  5FUX A;  1UVF A;  2SGF I;  3TJQ A;  2E5R A;  2ROW A;  1XA6 A;  2A20 A;  1YU6 C;  4SGB I;  2L8E A;  2JZM A;  4UXH A;  3UFF A;  5DAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...