2LUYA

Solution structure of the tandem zinc finger domain of fission yeast stc1
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
96
structure length
96
Chain Sequence
MGKNDNDALIMCMRCRKVKGIDSYSKTQWSKTFTFVRGRTVSVSDPKVICRTCQPKQHDSIWCTACQQTKGINEFSKAQRHVLDPRCQICVHSQRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Meiotic chromosome segregation protein P8B7.28c
publication title Structural analysis of Stc1 provides insights into the coupling of RNAi and chromatin modification.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 6
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12898 Stc1 Stc1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.210 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2luyA01
3.30.60.210 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2luyA02
2LUYA
chains in the Genus database with same CATH superfamily
1UHAA 2JA1A 2VRWB 2X52A 4E1RA 1R0RI 5J8FA 1CSOI 2N1AB 2JW6A 1YTPA 1W4RA 1OMUA 2NU0I 1LR9A 4GI3C 1R79A 1HDLA 1HPTA 3R5BA 1TURA 2E73A 1CT4I 2LB7A 4SGBI 2ENZA 2DKVA 1SGDI 1PJUA 3OXFA 3D00A 3SGQI 4B6DA 1DS3I 7WGAA 3CXLA 1PTQA 1IW4A 2QPOA 4AMLA 2P6AC 2YUUA 5FUYA 3VE5A 1TUSA 2QQDA 2GVIA 1KMAA 5JHWC 5DAEA 2SGDI 1PPFI 1WGCA 3TOAA 2KMOA 2YQPA 1BUSA 2FNFX 2V1CA 1OYVI 1W3SA 1FYBA 1ULMA 2KMPA 3OVOA 2A20A 1Z2IA 1Y1BA 2CWFA 2WGCA 3OXGA 2XRCA 1CGJI 1ULNA 2ENNA 2ERWA 3UGIA 1NXUA 3E59A 2L8EA 1K7TA 1U5KA 2KCXA 2JXDA 1CT2I 1DS2I 1TBRR 1IY5A 3R5DA 5FUWA 2F3CI 1S20A 2NU2I 1SGEI 3TO7A 2GIVA 2BUSA 2WCYA 2DIPA 1CT0I 2GKRI 2QQEA 3FSYA 3BJIA 1FARA 1M8BA 3PDNA 4UXJA 5CCLA 4JCVE 2OU2A 2UVOA 2QQCA 5E3RA 5E3QA 3VDPA 4DNCA 2LUYA 1KBFA 1MJ9A 1NUBA 1AN1I 2OZUA 1K7VA 1HEVA 3R5AA 1SGYI 4MPIA 3TO6A 1TIHA 4OVOA 3TO9A 1PCEA 1M8CA 3MEKA 2K9HA 3SEKC 2SGEI 1WGTA 1X4SA 1SGPI 1N13A 1Y1CA 5FUVA 3VDUA 1UVGA 2J87A 1TBQR 3SGBI 2RIJA 4FKDA 2Y0MA 2LEOA 1K7UA 2RC4A 2ROWA 2B0UC 1SGNI 1TGSI 1WTJA 1MJAA 2SGQI 1YU6C 2V53A 4UXHA 9WGAA 3GOXA 1RFHA 5E3PA 2ARPF 1OMTA 1Z7KB 2WVJA 2J9RA 1V1IA 4L9MA 3E2IA 2CJSC 1TBOA 2OD1A 3UFFA 3QWPA 1UVFA 3QAHA 1HJAI 2CWHA 2OVOA 5CCMA 2GKTI 2N17A 2KMQA 2NU3I 1XX6A 3TOBA 2JZMA 1P9ZA 2ODDA 1TOTA 2DB6A 3UGLA 2GKVA 3UEJA 2M5XA 1V1HA 1TBNA 2SGFI 3UOEA 1IY6A 2E5RA 3RU0A 4E1PA 1BMOA 1VDDA 3HH2C 2NU4I 3UGDA 2V1CC 1ULKA 1CGII 2N71A 3OL0A 2W0TA 1Q9BA 2NU1I 4UXIA 5FUXA 1H0ZA 5EX0A 3R5CA 2L7XA 1MT1A 1X74A 3OXLA 5HQ8A 2KMRA 5HI7A 1XBTA 2PQ8A 2N52A 1OVOA 1FY7A 2QQ0A 2SGPI 1LR7A 3UEYA 1P9GA 2ORWA 2X3TA 3FC3A 2CWGA 1SGRI 3KY9A 1Y8FA 2JYYA 1CE3A 2ELIA 4WP4A 1PTRA 3B4VC 3FSXA 1UUCA 1LR8A 1XA6A 1WKXA 3TJQA 4A24A 2UZ3A 4HGUA 5EX3A 1MJBA 1SGQI 2B8TA 1FAQA 1KBEA 3QTLD 1CHOI 5J8CA 2ORVA
chains in the Genus database with same CATH topology
2JA1A 2VRWB 4E1RA 1R0RI 1CSOI 2N1AB 2JW6A 1YTPA 1W4RA 1OMUA 2NU0I 1LR9A 4GI3C 1R79A 1HDLA 1HPTA 1TURA 2E73A 1CT4I 4SGBI 2ENZA 3OXFA 1SGDI 1PJUA 3SGQI 3D00A 4B6DA 1DS3I 3CXLA 1PTQA 1IW4A 2QPOA 2P6AC 2YUUA 5FUYA 3VE5A 1TUSA 2QQDA 2GVIA 1KMAA 5JHWC 5DAEA 2SGDI 1PPFI 2KMOA 2YQPA 1BUSA 2FNFX 2V1CA 1OYVI 1W3SA 1FYBA 2KMPA 3OVOA 2A20A 1Y1BA 3OXGA 2XRCA 1CGJI 2ENNA 3UGIA 2ERWA 3E59A 2L8EA 1U5KA 2KCXA 2JXDA 1CT2I 1DS2I 1TBRR 1IY5A 5FUWA 2F3CI 2NU2I 1SGEI 2WCYA 2BUSA 2DIPA 1CT0I 2GKRI 2QQEA 3BJIA 1FARA 1M8BA 3PDNA 4UXJA 5CCLA 4JCVE 2QQCA 3VDPA 2LUYA 1KBFA 1NUBA 1AN1I 1SGYI 1TIHA 4OVOA 1PCEA 1M8CA 3MEKA 2K9HA 3SEKC 2SGEI 1X4SA 1SGPI 1N13A 1Y1CA 5FUVA 3VDUA 1UVGA 2J87A 1TBQR 3SGBI 4FKDA 2LEOA 2ROWA 2B0UC 1SGNI 1TGSI 2SGQI 1YU6C 2V53A 4UXHA 3GOXA 1RFHA 2ARPF 1OMTA 1Z7KB 2WVJA 2J9RA 1V1IA 4L9MA 3E2IA 2CJSC 1TBOA 2OD1A 3UFFA 3QWPA 1UVFA 1HJAI 5CCMA 2OVOA 2GKTI 2N17A 2KMQA 2NU3I 1XX6A 2JZMA 2ODDA 1TOTA 2DB6A 3UGLA 2GKVA 3UEJA 2M5XA 1V1HA 1TBNA 2SGFI 1IY6A 2E5RA 3RU0A 4E1PA 1BMOA 1VDDA 3HH2C 2NU4I 3UGDA 2V1CC 1CGII 2N71A 3OL0A 2W0TA 4UXIA 2NU1I 5FUXA 1H0ZA 5EX0A 2L7XA 1MT1A 1X74A 3OXLA 5HQ8A 2KMRA 5HI7A 1XBTA 2N52A 1OVOA 2QQ0A 2SGPI 1LR7A 3UEYA 2ORWA 3FC3A 1SGRI 3KY9A 1Y8FA 2JYYA 1CE3A 2ELIA 1PTRA 3B4VC 3TJQA 1UUCA 1LR8A 1XA6A 4A24A 2UZ3A 4HGUA 5EX3A 1SGQI 2B8TA 1FAQA 1KBEA 3QTLD 1CHOI 2ORVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUY A; 
#chains in the Genus database with same CATH topology
 1UHA A;  2JA1 A;  2VRW B;  2X52 A;  4E1R A;  1R0R I;  5J8F A;  1CSO I;  2N1A B;  2JW6 A;  1YTP A;  1W4R A;  1OMU A;  2NU0 I;  1LR9 A;  4GI3 C;  1R79 A;  1HDL A;  1HPT A;  3R5B A;  1TUR A;  2E73 A;  1CT4 I;  2LB7 A;  4SGB I;  2ENZ A;  2DKV A;  1SGD I;  1PJU A;  3OXF A;  3D00 A;  3SGQ I;  4B6D A;  1DS3 I;  7WGA A;  3CXL A;  1PTQ A;  1IW4 A;  2QPO A;  4AML A;  2P6A C;  2YUU A;  5FUY A;  3VE5 A;  1TUS A;  2QQD A;  2GVI A;  1KMA A;  5JHW C;  5DAE A;  2SGD I;  1PPF I;  1WGC A;  3TOA A;  2KMO A;  2YQP A;  1BUS A;  2FNF X;  2V1C A;  1OYV I;  1W3S A;  1FYB A;  1ULM A;  2KMP A;  3OVO A;  2A20 A;  1Z2I A;  1Y1B A;  2CWF A;  2WGC A;  3OXG A;  2XRC A;  1CGJ I;  1ULN A;  2ENN A;  2ERW A;  3UGI A;  1NXU A;  3E59 A;  2L8E A;  1K7T A;  1U5K A;  2KCX A;  2JXD A;  1CT2 I;  1DS2 I;  1TBR R;  1IY5 A;  3R5D A;  5FUW A;  2F3C I;  1S20 A;  2NU2 I;  1SGE I;  3TO7 A;  2GIV A;  2BUS A;  2WCY A;  2DIP A;  1CT0 I;  2GKR I;  2QQE A;  3FSY A;  3BJI A;  1FAR A;  1M8B A;  3PDN A;  4UXJ A;  5CCL A;  4JCV E;  2OU2 A;  2UVO A;  2QQC A;  5E3R A;  5E3Q A;  3VDP A;  4DNC A;  2LUY A;  1KBF A;  1MJ9 A;  1NUB A;  1AN1 I;  2OZU A;  1K7V A;  1HEV A;  3R5A A;  1SGY I;  4MPI A;  3TO6 A;  1TIH A;  4OVO A;  3TO9 A;  1PCE A;  1M8C A;  3MEK A;  2K9H A;  3SEK C;  2SGE I;  1WGT A;  1X4S A;  1SGP I;  1N13 A;  1Y1C A;  5FUV A;  3VDU A;  1UVG A;  2J87 A;  1TBQ R;  3SGB I;  2RIJ A;  4FKD A;  2Y0M A;  2LEO A;  1K7U A;  2RC4 A;  2ROW A;  2B0U C;  1SGN I;  1TGS I;  1WTJ A;  1MJA A;  2SGQ I;  1YU6 C;  2V53 A;  4UXH A;  9WGA A;  3GOX A;  1RFH A;  5E3P A;  2ARP F;  1OMT A;  1Z7K B;  2WVJ A;  2J9R A;  1V1I A;  4L9M A;  3E2I A;  2CJS C;  1TBO A;  2OD1 A;  3UFF A;  3QWP A;  1UVF A;  3QAH A;  1HJA I;  2CWH A;  2OVO A;  5CCM A;  2GKT I;  2N17 A;  2KMQ A;  2NU3 I;  1XX6 A;  3TOB A;  2JZM A;  1P9Z A;  2ODD A;  1TOT A;  2DB6 A;  3UGL A;  2GKV A;  3UEJ A;  2M5X A;  1V1H A;  1TBN A;  2SGF I;  3UOE A;  1IY6 A;  2E5R A;  3RU0 A;  4E1P A;  1BMO A;  1VDD A;  3HH2 C;  2NU4 I;  3UGD A;  2V1C C;  1ULK A;  1CGI I;  2N71 A;  3OL0 A;  2W0T A;  1Q9B A;  2NU1 I;  4UXI A;  5FUX A;  1H0Z A;  5EX0 A;  3R5C A;  2L7X A;  1MT1 A;  1X74 A;  3OXL A;  5HQ8 A;  2KMR A;  5HI7 A;  1XBT A;  2PQ8 A;  2N52 A;  1OVO A;  1FY7 A;  2QQ0 A;  2SGP I;  1LR7 A;  3UEY A;  1P9G A;  2ORW A;  2X3T A;  3FC3 A;  2CWG A;  1SGR I;  3KY9 A;  1Y8F A;  2JYY A;  1CE3 A;  2ELI A;  4WP4 A;  1PTR A;  3B4V C;  3FSX A;  1UUC A;  1LR8 A;  1XA6 A;  1WKX A;  3TJQ A;  4A24 A;  2UZ3 A;  4HGU A;  5EX3 A;  1MJB A;  1SGQ I;  2B8T A;  1FAQ A;  1KBE A;  3QTL D;  1CHO I;  5J8C A;  2ORV A; 
#chains in the Genus database with same CATH homology
 2JA1 A;  2VRW B;  4E1R A;  1R0R I;  1CSO I;  2N1A B;  2JW6 A;  1YTP A;  1W4R A;  1OMU A;  2NU0 I;  1LR9 A;  4GI3 C;  1R79 A;  1HDL A;  1HPT A;  1TUR A;  2E73 A;  1CT4 I;  4SGB I;  2ENZ A;  3OXF A;  1SGD I;  1PJU A;  3SGQ I;  3D00 A;  4B6D A;  1DS3 I;  3CXL A;  1PTQ A;  1IW4 A;  2QPO A;  2P6A C;  2YUU A;  5FUY A;  3VE5 A;  1TUS A;  2QQD A;  2GVI A;  1KMA A;  5JHW C;  5DAE A;  2SGD I;  1PPF I;  2KMO A;  2YQP A;  1BUS A;  2FNF X;  2V1C A;  1OYV I;  1W3S A;  1FYB A;  2KMP A;  3OVO A;  2A20 A;  1Y1B A;  3OXG A;  2XRC A;  1CGJ I;  2ENN A;  3UGI A;  2ERW A;  3E59 A;  2L8E A;  1U5K A;  2KCX A;  2JXD A;  1CT2 I;  1DS2 I;  1TBR R;  1IY5 A;  5FUW A;  2F3C I;  2NU2 I;  1SGE I;  2WCY A;  2BUS A;  2DIP A;  1CT0 I;  2GKR I;  2QQE A;  3BJI A;  1FAR A;  1M8B A;  3PDN A;  4UXJ A;  5CCL A;  4JCV E;  2QQC A;  3VDP A;  2LUY A;  1KBF A;  1NUB A;  1AN1 I;  1SGY I;  1TIH A;  4OVO A;  1PCE A;  1M8C A;  3MEK A;  2K9H A;  3SEK C;  2SGE I;  1X4S A;  1SGP I;  1N13 A;  1Y1C A;  5FUV A;  3VDU A;  1UVG A;  2J87 A;  1TBQ R;  3SGB I;  4FKD A;  2LEO A;  2ROW A;  2B0U C;  1SGN I;  1TGS I;  2SGQ I;  1YU6 C;  2V53 A;  4UXH A;  3GOX A;  1RFH A;  2ARP F;  1OMT A;  1Z7K B;  2WVJ A;  2J9R A;  1V1I A;  4L9M A;  3E2I A;  2CJS C;  1TBO A;  2OD1 A;  3UFF A;  3QWP A;  1UVF A;  1HJA I;  5CCM A;  2OVO A;  2GKT I;  2N17 A;  2KMQ A;  2NU3 I;  1XX6 A;  2JZM A;  2ODD A;  1TOT A;  2DB6 A;  3UGL A;  2GKV A;  3UEJ A;  2M5X A;  1V1H A;  1TBN A;  2SGF I;  1IY6 A;  2E5R A;  3RU0 A;  4E1P A;  1BMO A;  1VDD A;  3HH2 C;  2NU4 I;  3UGD A;  2V1C C;  1CGI I;  2N71 A;  3OL0 A;  2W0T A;  4UXI A;  2NU1 I;  5FUX A;  1H0Z A;  5EX0 A;  2L7X A;  1MT1 A;  1X74 A;  3OXL A;  5HQ8 A;  2KMR A;  5HI7 A;  1XBT A;  2N52 A;  1OVO A;  2QQ0 A;  2SGP I;  1LR7 A;  3UEY A;  2ORW A;  3FC3 A;  1SGR I;  3KY9 A;  1Y8F A;  2JYY A;  1CE3 A;  2ELI A;  1PTR A;  3B4V C;  3TJQ A;  1UUC A;  1LR8 A;  1XA6 A;  4A24 A;  2UZ3 A;  4HGU A;  5EX3 A;  1SGQ I;  2B8T A;  1FAQ A;  1KBE A;  3QTL D;  1CHO I;  2ORV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...