2LUYA

Solution structure of the tandem zinc finger domain of fission yeast stc1
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
96
structure length
96
Chain Sequence
MGKNDNDALIMCMRCRKVKGIDSYSKTQWSKTFTFVRGRTVSVSDPKVICRTCQPKQHDSIWCTACQQTKGINEFSKAQRHVLDPRCQICVHSQRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Meiotic chromosome segregation protein P8B7.28c
publication title Structural analysis of Stc1 provides insights into the coupling of RNAi and chromatin modification.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 6
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12898 Stc1 Stc1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.210 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2luyA01
3.30.60.210 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2luyA02
2LUYA
chains in the Genus database with same CATH superfamily
2CWHA 1SGDI 1IY5A 2J9RA 1S20A 1M8CA 2QPOA 2RIJA 1R0RI 1PTRA 1NXUA 2NU2I 1TBRR 1OYVI 1PPFI 3TOBA 5J8CA 1FYBA 2ELIA 1KMAA 1TUSA 2GKVA 1SGEI 4AMLA 1XX6A 2ROWA 1CT0I 2WGCA 1X74A 1Z7KB 1W3SA 2L8EA 1P9GA 3UGDA 7WGAA 1CSOI 5FUVA 1X4SA 1MJ9A 1FARA 2QQDA 9WGAA 5FUYA 2V1CC 1TOTA 1XBTA 1CT4I 1OMUA 5E3RA 2N17A 3FSYA 2N1AB 2WCYA 2Y0MA 4UXIA 1OVOA 1VDDA 1R79A 4A24A 3VE5A 1UVFA 2GKRI 2XRCA 4UXJA 4B6DA 4E1PA 1SGYI 1HDLA 2SGDI 3UGIA 1W4RA 2ARPF 1ULKA 3B4VC 1CHOI 2ORWA 2OU2A 3CXLA 3TO6A 5CCMA 2QQCA 1YTPA 4OVOA 1FAQA 2KMOA 5DAEA 2OZUA 1LR7A 2A20A 3UEYA 1Z2IA 2GIVA 3R5AA 2GVIA 2OVOA 5JHWC 1PJUA 2JYYA 2P6AC 3OXLA 2SGEI 3QAHA 4JCVE 1MT1A 4SGBI 2X52A 2JW6A 3QTLD 1IW4A 1TBQR 5E3QA 3R5DA 3TO7A 2F3CI 4MPIA 5EX0A 2YQPA 2E73A 2N52A 1SGPI 2ENZA 2NU3I 3BJIA 2SGQI 2GKTI 5EX3A 1P9ZA 1ULNA 2N71A 1K7UA 2SGFI 3RU0A 1H0ZA 2K9HA 1CE3A 2BUSA 1KBFA 2DKVA 1BMOA 1MJAA 3KY9A 3D00A 3OL0A 1LR8A 1K7TA 1NUBA 2KMQA 1WGTA 3FC3A 3VDUA 4UXHA 1ULMA 3TJQA 4GI3C 1TURA 2NU1I 2ERWA 4L9MA 5FUWA 3OXGA 1V1HA 2CJSC 3UFFA 1SGRI 3UEJA 1N13A 1WTJA 1UVGA 3HH2C 5FUXA 2QQEA 1CT2I 2KMRA 1DS2I 2DB6A 1WGCA 1TIHA 2ORVA 4E1RA 4DNCA 2E5RA 3OXFA 1V1IA 5CCLA 1Q9BA 2V1CA 2UZ3A 1DS3I 2VRWB 2FNFX 2UVOA 3GOXA 1Y8FA 2JXDA 1K7VA 2M5XA 3PDNA 1TBNA 1RFHA 2QQ0A 3QWPA 2X3TA 1Y1CA 1UHAA 2PQ8A 3R5BA 1WKXA 3UGLA 2J87A 1BUSA 1SGQI 2DIPA 1CGII 3MEKA 2W0TA 1M8BA 1UUCA 1OMTA 2CWGA 5HQ8A 3SGQI 1IY6A 3FSXA 4WP4A 1TGSI 2KMPA 4FKDA 1AN1I 3OVOA 3R5CA 5HI7A 2NU0I 1U5KA 4HGUA 2OD1A 2B8TA 3TOAA 1HJAI 1FY7A 2JZMA 1SGNI 1HPTA 3SEKC 2V53A 2ODDA 1PTQA 3E2IA 1PCEA 1CGJI 2L7XA 2RC4A 1KBEA 2LUYA 3E59A 3VDPA 2KCXA 2YUUA 1LR9A 1YU6C 2CWFA 2LEOA 2NU4I 3UOEA 2JA1A 2LB7A 5E3PA 2SGPI 2WVJA 2B0UC 2ENNA 1MJBA 1XA6A 1HEVA 3SGBI 3TO9A 1Y1BA 1TBOA 5J8FA
chains in the Genus database with same CATH topology
1SGDI 1IY5A 2J9RA 2QPOA 1M8CA 1R0RI 1PTRA 1FYBA 2NU2I 1TBRR 1OYVI 1PPFI 2ELIA 1KMAA 1TUSA 2GKVA 1SGEI 1XX6A 2ROWA 1CT0I 1X74A 1Z7KB 1W3SA 2L8EA 3UGDA 1CSOI 5FUVA 1X4SA 2QQDA 1FARA 5FUYA 2V1CC 1TOTA 1XBTA 1CT4I 1OMUA 2N17A 2N1AB 2WCYA 4UXIA 1OVOA 1VDDA 1R79A 4A24A 3VE5A 1UVFA 2GKRI 2XRCA 4UXJA 4B6DA 4E1PA 1SGYI 1HDLA 2SGDI 3UGIA 1W4RA 2ARPF 3B4VC 1CHOI 2ORWA 3CXLA 5CCMA 2QQCA 1YTPA 4OVOA 1FAQA 2KMOA 5DAEA 1LR7A 2A20A 3UEYA 2GVIA 2OVOA 5JHWC 1PJUA 2JYYA 2P6AC 3OXLA 2SGEI 4JCVE 1MT1A 4SGBI 2JW6A 3QTLD 1IW4A 1TBQR 2F3CI 5EX0A 2YQPA 2E73A 2N52A 1SGPI 2ENZA 2NU3I 3BJIA 2SGQI 2GKTI 5EX3A 2N71A 1H0ZA 2SGFI 3RU0A 1KBFA 2K9HA 1CE3A 2BUSA 1BMOA 3KY9A 3D00A 3OL0A 1LR8A 1NUBA 2KMQA 3FC3A 3VDUA 4UXHA 3TJQA 4GI3C 1TURA 2NU1I 2ERWA 4L9MA 5FUWA 3OXGA 1V1HA 2CJSC 3UFFA 1SGRI 3UEJA 1N13A 3HH2C 1UVGA 5FUXA 2QQEA 1CT2I 2KMRA 1DS2I 2DB6A 4E1RA 1TIHA 2ORVA 2E5RA 3OXFA 1V1IA 5CCLA 2V1CA 2VRWB 2UZ3A 1DS3I 2FNFX 3GOXA 1Y8FA 2JXDA 2M5XA 3PDNA 1TBNA 1RFHA 2QQ0A 3QWPA 1Y1CA 3UGLA 2J87A 1BUSA 1SGQI 2DIPA 1CGII 3MEKA 2W0TA 1M8BA 1UUCA 1OMTA 5HQ8A 1IY6A 3SGQI 1TGSI 2KMPA 4FKDA 1AN1I 3OVOA 5HI7A 2NU0I 1U5KA 4HGUA 2OD1A 2B8TA 1HJAI 2JZMA 1SGNI 1HPTA 3SEKC 2V53A 2ODDA 1PTQA 3E2IA 1PCEA 1CGJI 2L7XA 3E59A 1KBEA 2LUYA 3VDPA 2KCXA 2YUUA 1LR9A 1YU6C 2LEOA 2NU4I 2JA1A 2SGPI 2WVJA 2B0UC 2ENNA 1XA6A 3SGBI 1Y1BA 1TBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUY A; 
#chains in the Genus database with same CATH topology
 2CWH A;  1SGD I;  1IY5 A;  2J9R A;  1S20 A;  1M8C A;  2QPO A;  2RIJ A;  1R0R I;  1PTR A;  1NXU A;  2NU2 I;  1TBR R;  1OYV I;  1PPF I;  3TOB A;  5J8C A;  1FYB A;  2ELI A;  1KMA A;  1TUS A;  2GKV A;  1SGE I;  4AML A;  1XX6 A;  2ROW A;  1CT0 I;  2WGC A;  1X74 A;  1Z7K B;  1W3S A;  2L8E A;  1P9G A;  3UGD A;  7WGA A;  1CSO I;  5FUV A;  1X4S A;  1MJ9 A;  1FAR A;  2QQD A;  9WGA A;  5FUY A;  2V1C C;  1TOT A;  1XBT A;  1CT4 I;  1OMU A;  5E3R A;  2N17 A;  3FSY A;  2N1A B;  2WCY A;  2Y0M A;  4UXI A;  1OVO A;  1VDD A;  1R79 A;  4A24 A;  3VE5 A;  1UVF A;  2GKR I;  2XRC A;  4UXJ A;  4B6D A;  4E1P A;  1SGY I;  1HDL A;  2SGD I;  3UGI A;  1W4R A;  2ARP F;  1ULK A;  3B4V C;  1CHO I;  2ORW A;  2OU2 A;  3CXL A;  3TO6 A;  5CCM A;  2QQC A;  1YTP A;  4OVO A;  1FAQ A;  2KMO A;  5DAE A;  2OZU A;  1LR7 A;  2A20 A;  3UEY A;  1Z2I A;  2GIV A;  3R5A A;  2GVI A;  2OVO A;  5JHW C;  1PJU A;  2JYY A;  2P6A C;  3OXL A;  2SGE I;  3QAH A;  4JCV E;  1MT1 A;  4SGB I;  2X52 A;  2JW6 A;  3QTL D;  1IW4 A;  1TBQ R;  5E3Q A;  3R5D A;  3TO7 A;  2F3C I;  4MPI A;  5EX0 A;  2YQP A;  2E73 A;  2N52 A;  1SGP I;  2ENZ A;  2NU3 I;  3BJI A;  2SGQ I;  2GKT I;  5EX3 A;  1P9Z A;  1ULN A;  2N71 A;  1K7U A;  2SGF I;  3RU0 A;  1H0Z A;  2K9H A;  1CE3 A;  2BUS A;  1KBF A;  2DKV A;  1BMO A;  1MJA A;  3KY9 A;  3D00 A;  3OL0 A;  1LR8 A;  1K7T A;  1NUB A;  2KMQ A;  1WGT A;  3FC3 A;  3VDU A;  4UXH A;  1ULM A;  3TJQ A;  4GI3 C;  1TUR A;  2NU1 I;  2ERW A;  4L9M A;  5FUW A;  3OXG A;  1V1H A;  2CJS C;  3UFF A;  1SGR I;  3UEJ A;  1N13 A;  1WTJ A;  1UVG A;  3HH2 C;  5FUX A;  2QQE A;  1CT2 I;  2KMR A;  1DS2 I;  2DB6 A;  1WGC A;  1TIH A;  2ORV A;  4E1R A;  4DNC A;  2E5R A;  3OXF A;  1V1I A;  5CCL A;  1Q9B A;  2V1C A;  2UZ3 A;  1DS3 I;  2VRW B;  2FNF X;  2UVO A;  3GOX A;  1Y8F A;  2JXD A;  1K7V A;  2M5X A;  3PDN A;  1TBN A;  1RFH A;  2QQ0 A;  3QWP A;  2X3T A;  1Y1C A;  1UHA A;  2PQ8 A;  3R5B A;  1WKX A;  3UGL A;  2J87 A;  1BUS A;  1SGQ I;  2DIP A;  1CGI I;  3MEK A;  2W0T A;  1M8B A;  1UUC A;  1OMT A;  2CWG A;  5HQ8 A;  3SGQ I;  1IY6 A;  3FSX A;  4WP4 A;  1TGS I;  2KMP A;  4FKD A;  1AN1 I;  3OVO A;  3R5C A;  5HI7 A;  2NU0 I;  1U5K A;  4HGU A;  2OD1 A;  2B8T A;  3TOA A;  1HJA I;  1FY7 A;  2JZM A;  1SGN I;  1HPT A;  3SEK C;  2V53 A;  2ODD A;  1PTQ A;  3E2I A;  1PCE A;  1CGJ I;  2L7X A;  2RC4 A;  1KBE A;  2LUY A;  3E59 A;  3VDP A;  2KCX A;  2YUU A;  1LR9 A;  1YU6 C;  2CWF A;  2LEO A;  2NU4 I;  3UOE A;  2JA1 A;  2LB7 A;  5E3P A;  2SGP I;  2WVJ A;  2B0U C;  2ENN A;  1MJB A;  1XA6 A;  1HEV A;  3SGB I;  3TO9 A;  1Y1B A;  1TBO A;  5J8F A; 
#chains in the Genus database with same CATH homology
 1SGD I;  1IY5 A;  2J9R A;  2QPO A;  1M8C A;  1R0R I;  1PTR A;  1FYB A;  2NU2 I;  1TBR R;  1OYV I;  1PPF I;  2ELI A;  1KMA A;  1TUS A;  2GKV A;  1SGE I;  1XX6 A;  2ROW A;  1CT0 I;  1X74 A;  1Z7K B;  1W3S A;  2L8E A;  3UGD A;  1CSO I;  5FUV A;  1X4S A;  2QQD A;  1FAR A;  5FUY A;  2V1C C;  1TOT A;  1XBT A;  1CT4 I;  1OMU A;  2N17 A;  2N1A B;  2WCY A;  4UXI A;  1OVO A;  1VDD A;  1R79 A;  4A24 A;  3VE5 A;  1UVF A;  2GKR I;  2XRC A;  4UXJ A;  4B6D A;  4E1P A;  1SGY I;  1HDL A;  2SGD I;  3UGI A;  1W4R A;  2ARP F;  3B4V C;  1CHO I;  2ORW A;  3CXL A;  5CCM A;  2QQC A;  1YTP A;  4OVO A;  1FAQ A;  2KMO A;  5DAE A;  1LR7 A;  2A20 A;  3UEY A;  2GVI A;  2OVO A;  5JHW C;  1PJU A;  2JYY A;  2P6A C;  3OXL A;  2SGE I;  4JCV E;  1MT1 A;  4SGB I;  2JW6 A;  3QTL D;  1IW4 A;  1TBQ R;  2F3C I;  5EX0 A;  2YQP A;  2E73 A;  2N52 A;  1SGP I;  2ENZ A;  2NU3 I;  3BJI A;  2SGQ I;  2GKT I;  5EX3 A;  2N71 A;  1H0Z A;  2SGF I;  3RU0 A;  1KBF A;  2K9H A;  1CE3 A;  2BUS A;  1BMO A;  3KY9 A;  3D00 A;  3OL0 A;  1LR8 A;  1NUB A;  2KMQ A;  3FC3 A;  3VDU A;  4UXH A;  3TJQ A;  4GI3 C;  1TUR A;  2NU1 I;  2ERW A;  4L9M A;  5FUW A;  3OXG A;  1V1H A;  2CJS C;  3UFF A;  1SGR I;  3UEJ A;  1N13 A;  3HH2 C;  1UVG A;  5FUX A;  2QQE A;  1CT2 I;  2KMR A;  1DS2 I;  2DB6 A;  4E1R A;  1TIH A;  2ORV A;  2E5R A;  3OXF A;  1V1I A;  5CCL A;  2V1C A;  2VRW B;  2UZ3 A;  1DS3 I;  2FNF X;  3GOX A;  1Y8F A;  2JXD A;  2M5X A;  3PDN A;  1TBN A;  1RFH A;  2QQ0 A;  3QWP A;  1Y1C A;  3UGL A;  2J87 A;  1BUS A;  1SGQ I;  2DIP A;  1CGI I;  3MEK A;  2W0T A;  1M8B A;  1UUC A;  1OMT A;  5HQ8 A;  1IY6 A;  3SGQ I;  1TGS I;  2KMP A;  4FKD A;  1AN1 I;  3OVO A;  5HI7 A;  2NU0 I;  1U5K A;  4HGU A;  2OD1 A;  2B8T A;  1HJA I;  2JZM A;  1SGN I;  1HPT A;  3SEK C;  2V53 A;  2ODD A;  1PTQ A;  3E2I A;  1PCE A;  1CGJ I;  2L7X A;  3E59 A;  1KBE A;  2LUY A;  3VDP A;  2KCX A;  2YUU A;  1LR9 A;  1YU6 C;  2LEO A;  2NU4 I;  2JA1 A;  2SGP I;  2WVJ A;  2B0U C;  2ENN A;  1XA6 A;  3SGB I;  1Y1B A;  1TBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...