2LUYA

Solution structure of the tandem zinc finger domain of fission yeast stc1
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
96
structure length
96
Chain Sequence
MGKNDNDALIMCMRCRKVKGIDSYSKTQWSKTFTFVRGRTVSVSDPKVICRTCQPKQHDSIWCTACQQTKGINEFSKAQRHVLDPRCQICVHSQRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Meiotic chromosome segregation protein P8B7.28c
publication title Structural analysis of Stc1 provides insights into the coupling of RNAi and chromatin modification.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 6
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12898 Stc1 Stc1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.210 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2luyA01
3.30.60.210 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2luyA02
2LUYA
chains in the Genus database with same CATH superfamily
1PJUA 3SGQI 2DIPA 1VDDA 1CT4I 1SGNI 1ULMA 2Y0MA 1LR9A 1YU6C 1KMAA 2E5RA 2OU2A 1TBQR 2B0UC 2ELIA 3VE5A 1CGII 2UZ3A 1HDLA 1WGTA 1LR8A 1LR7A 1DS3I 1PCEA 2K9HA 2QQCA 3D00A 2B8TA 1ULNA 3OVOA 5EX3A 3UGDA 5FUVA 2KMRA 7WGAA 2CWGA 2V1CC 1Q9BA 2L8EA 2NU0I 2N52A 2UVOA 5J8CA 3OXFA 1WTJA 2ORWA 3KY9A 3SGBI 1SGRI 1M8BA 3UEYA 1OMTA 1S20A 3TO6A 2ENNA 2KMPA 5J8FA 1KBFA 2W0TA 5E3RA 1CE3A 3OXGA 1IW4A 1SGPI 1CT0I 2LUYA 2JXDA 2N1AB 2ENZA 5HI7A 3TO7A 2SGQI 3UGLA 2F3CI 5HQ8A 2GKVA 1R79A 2QQEA 2X3TA 1FARA 1MT1A 4JCVE 3VDPA 2LB7A 2NU4I 4UXHA 3TOBA 4HGUA 2WGCA 2DKVA 4A24A 1XA6A 2A20A 3R5DA 1RFHA 2NU3I 4MPIA 1BMOA 1OVOA 1FAQA 3TJQA 2QQ0A 2SGDI 1CGJI 2QPOA 1X74A 1NUBA 1CSOI 2RC4A 2N71A 2CWFA 1Z7KB 2GIVA 1UVFA 5E3QA 2LEOA 1TBNA 1Z2IA 4E1PA 4DNCA 2PQ8A 2SGPI 5CCLA 1Y1CA 1PPFI 2OZUA 2QQDA 1TBRR 3UGIA 1K7TA 2OVOA 1Y1BA 2VRWB 4FKDA 1OMUA 2ERWA 3TOAA 1SGQI 1V1HA 1SGEI 2M5XA 1XBTA 4E1RA 1CHOI 1P9ZA 3UFFA 2V53A 2SGFI 3E59A 1K7VA 2KMOA 1UHAA 3R5BA 3FSXA 2JA1A 1TGSI 4L9MA 3TO9A 1KBEA 2ROWA 2E73A 2JYYA 3OXLA 5JHWC 2GKTI 3BJIA 1YTPA 2P6AC 3MEKA 1TUSA 1W3SA 2YQPA 2CWHA 3HH2C 4GI3C 4UXJA 1WGCA 2WVJA 5FUWA 1X4SA 2RIJA 2JW6A 1IY5A 5FUYA 2X52A 2OD1A 1ULKA 1WKXA 2CJSC 1IY6A 1UUCA 1Y8FA 1HJAI 2GVIA 3E2IA 4WP4A 2ODDA 3SEKC 5CCMA 1TIHA 2NU1I 3UEJA 2L7XA 1HPTA 3PDNA 5E3PA 1H0ZA 5EX0A 1W4RA 2JZMA 1XX6A 3FC3A 1DS2I 1R0RI 1TOTA 1NXUA 2GKRI 2J87A 3FSYA 4UXIA 2NU2I 1MJ9A 2DB6A 3CXLA 2ORVA 2WCYA 5DAEA 9WGAA 3VDUA 2SGEI 3QTLD 1MJBA 1UVGA 2FNFX 2KMQA 1P9GA 1CT2I 1AN1I 2XRCA 2V1CA 3OL0A 1OYVI 1N13A 1PTQA 1BUSA 1HEVA 3GOXA 1SGYI 2BUSA 1FY7A 1PTRA 3B4VC 3R5AA 1U5KA 1TBOA 3QAHA 5FUXA 1M8CA 4AMLA 3R5CA 1K7UA 1MJAA 1SGDI 3QWPA 2J9RA 4OVOA 3UOEA 2YUUA 4B6DA 1FYBA 3RU0A 1TURA 1V1IA 2ARPF 2KCXA 2N17A 4SGBI
chains in the Genus database with same CATH topology
1PJUA 3SGQI 2DIPA 1VDDA 1CT4I 1SGNI 1LR9A 1YU6C 2E5RA 1TBQR 2B0UC 2ELIA 3VE5A 1CGII 2UZ3A 1HDLA 2K9HA 1LR8A 1LR7A 1DS3I 1PCEA 2QQCA 3UGDA 3D00A 2B8TA 1KMAA 3OVOA 5EX3A 5FUVA 2KMRA 2V1CC 2L8EA 2NU0I 2N52A 3OXFA 2ORWA 3KY9A 3SGBI 1SGRI 1M8BA 3UEYA 1OMTA 2ENNA 2KMPA 1KBFA 2W0TA 1CE3A 3OXGA 1IW4A 1SGPI 1CT0I 2LUYA 2JXDA 2N1AB 2ENZA 5HI7A 3UGLA 2SGQI 5HQ8A 2F3CI 2GKVA 1R79A 2QQEA 1FARA 1MT1A 4JCVE 3VDPA 2NU4I 4UXHA 4HGUA 4A24A 1XA6A 2A20A 1RFHA 2NU3I 1BMOA 1OVOA 1FAQA 3TJQA 2QQ0A 2SGDI 1CGJI 2QPOA 1X74A 1NUBA 1CSOI 2N71A 1Z7KB 1UVFA 2LEOA 1TBNA 4E1PA 2SGPI 5CCLA 1Y1CA 1PPFI 2QQDA 1TBRR 3UGIA 2OVOA 1Y1BA 2VRWB 4FKDA 1OMUA 2ERWA 1SGQI 1V1HA 1SGEI 2M5XA 1XBTA 4E1RA 1CHOI 3UFFA 2V53A 2SGFI 3E59A 2KMOA 2JA1A 1TGSI 4L9MA 1KBEA 2ROWA 2E73A 2JYYA 3OXLA 5JHWC 2GKTI 3BJIA 1YTPA 2P6AC 3MEKA 1TUSA 1W3SA 2YQPA 3HH2C 4GI3C 4UXJA 2WVJA 5FUWA 1X4SA 1IY5A 2JW6A 5FUYA 2OD1A 2CJSC 1IY6A 1UUCA 1Y8FA 1HJAI 2GVIA 3E2IA 2ODDA 3SEKC 5CCMA 1TIHA 2NU1I 3UEJA 2L7XA 1HPTA 3PDNA 1H0ZA 5EX0A 1W4RA 2JZMA 1XX6A 3FC3A 1DS2I 1R0RI 1TOTA 2GKRI 2J87A 4UXIA 2NU2I 2DB6A 3CXLA 2ORVA 2WCYA 5DAEA 3VDUA 2SGEI 3QTLD 1UVGA 2FNFX 2XRCA 2KMQA 1CT2I 1AN1I 2V1CA 3OL0A 1OYVI 1N13A 1PTQA 1BUSA 3GOXA 1SGYI 2BUSA 1PTRA 3B4VC 1U5KA 1TBOA 5FUXA 1M8CA 1SGDI 3QWPA 4OVOA 2J9RA 4B6DA 1FYBA 2YUUA 3RU0A 1TURA 1V1IA 2ARPF 2KCXA 2N17A 4SGBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUY A; 
#chains in the Genus database with same CATH topology
 1PJU A;  3SGQ I;  2DIP A;  1VDD A;  1CT4 I;  1SGN I;  1ULM A;  2Y0M A;  1LR9 A;  1YU6 C;  1KMA A;  2E5R A;  2OU2 A;  1TBQ R;  2B0U C;  2ELI A;  3VE5 A;  1CGI I;  2UZ3 A;  1HDL A;  1WGT A;  1LR8 A;  1LR7 A;  1DS3 I;  1PCE A;  2K9H A;  2QQC A;  3D00 A;  2B8T A;  1ULN A;  3OVO A;  5EX3 A;  3UGD A;  5FUV A;  2KMR A;  7WGA A;  2CWG A;  2V1C C;  1Q9B A;  2L8E A;  2NU0 I;  2N52 A;  2UVO A;  5J8C A;  3OXF A;  1WTJ A;  2ORW A;  3KY9 A;  3SGB I;  1SGR I;  1M8B A;  3UEY A;  1OMT A;  1S20 A;  3TO6 A;  2ENN A;  2KMP A;  5J8F A;  1KBF A;  2W0T A;  5E3R A;  1CE3 A;  3OXG A;  1IW4 A;  1SGP I;  1CT0 I;  2LUY A;  2JXD A;  2N1A B;  2ENZ A;  5HI7 A;  3TO7 A;  2SGQ I;  3UGL A;  2F3C I;  5HQ8 A;  2GKV A;  1R79 A;  2QQE A;  2X3T A;  1FAR A;  1MT1 A;  4JCV E;  3VDP A;  2LB7 A;  2NU4 I;  4UXH A;  3TOB A;  4HGU A;  2WGC A;  2DKV A;  4A24 A;  1XA6 A;  2A20 A;  3R5D A;  1RFH A;  2NU3 I;  4MPI A;  1BMO A;  1OVO A;  1FAQ A;  3TJQ A;  2QQ0 A;  2SGD I;  1CGJ I;  2QPO A;  1X74 A;  1NUB A;  1CSO I;  2RC4 A;  2N71 A;  2CWF A;  1Z7K B;  2GIV A;  1UVF A;  5E3Q A;  2LEO A;  1TBN A;  1Z2I A;  4E1P A;  4DNC A;  2PQ8 A;  2SGP I;  5CCL A;  1Y1C A;  1PPF I;  2OZU A;  2QQD A;  1TBR R;  3UGI A;  1K7T A;  2OVO A;  1Y1B A;  2VRW B;  4FKD A;  1OMU A;  2ERW A;  3TOA A;  1SGQ I;  1V1H A;  1SGE I;  2M5X A;  1XBT A;  4E1R A;  1CHO I;  1P9Z A;  3UFF A;  2V53 A;  2SGF I;  3E59 A;  1K7V A;  2KMO A;  1UHA A;  3R5B A;  3FSX A;  2JA1 A;  1TGS I;  4L9M A;  3TO9 A;  1KBE A;  2ROW A;  2E73 A;  2JYY A;  3OXL A;  5JHW C;  2GKT I;  3BJI A;  1YTP A;  2P6A C;  3MEK A;  1TUS A;  1W3S A;  2YQP A;  2CWH A;  3HH2 C;  4GI3 C;  4UXJ A;  1WGC A;  2WVJ A;  5FUW A;  1X4S A;  2RIJ A;  2JW6 A;  1IY5 A;  5FUY A;  2X52 A;  2OD1 A;  1ULK A;  1WKX A;  2CJS C;  1IY6 A;  1UUC A;  1Y8F A;  1HJA I;  2GVI A;  3E2I A;  4WP4 A;  2ODD A;  3SEK C;  5CCM A;  1TIH A;  2NU1 I;  3UEJ A;  2L7X A;  1HPT A;  3PDN A;  5E3P A;  1H0Z A;  5EX0 A;  1W4R A;  2JZM A;  1XX6 A;  3FC3 A;  1DS2 I;  1R0R I;  1TOT A;  1NXU A;  2GKR I;  2J87 A;  3FSY A;  4UXI A;  2NU2 I;  1MJ9 A;  2DB6 A;  3CXL A;  2ORV A;  2WCY A;  5DAE A;  9WGA A;  3VDU A;  2SGE I;  3QTL D;  1MJB A;  1UVG A;  2FNF X;  2KMQ A;  1P9G A;  1CT2 I;  1AN1 I;  2XRC A;  2V1C A;  3OL0 A;  1OYV I;  1N13 A;  1PTQ A;  1BUS A;  1HEV A;  3GOX A;  1SGY I;  2BUS A;  1FY7 A;  1PTR A;  3B4V C;  3R5A A;  1U5K A;  1TBO A;  3QAH A;  5FUX A;  1M8C A;  4AML A;  3R5C A;  1K7U A;  1MJA A;  1SGD I;  3QWP A;  2J9R A;  4OVO A;  3UOE A;  2YUU A;  4B6D A;  1FYB A;  3RU0 A;  1TUR A;  1V1I A;  2ARP F;  2KCX A;  2N17 A;  4SGB I; 
#chains in the Genus database with same CATH homology
 1PJU A;  3SGQ I;  2DIP A;  1VDD A;  1CT4 I;  1SGN I;  1LR9 A;  1YU6 C;  2E5R A;  1TBQ R;  2B0U C;  2ELI A;  3VE5 A;  1CGI I;  2UZ3 A;  1HDL A;  2K9H A;  1LR8 A;  1LR7 A;  1DS3 I;  1PCE A;  2QQC A;  3UGD A;  3D00 A;  2B8T A;  1KMA A;  3OVO A;  5EX3 A;  5FUV A;  2KMR A;  2V1C C;  2L8E A;  2NU0 I;  2N52 A;  3OXF A;  2ORW A;  3KY9 A;  3SGB I;  1SGR I;  1M8B A;  3UEY A;  1OMT A;  2ENN A;  2KMP A;  1KBF A;  2W0T A;  1CE3 A;  3OXG A;  1IW4 A;  1SGP I;  1CT0 I;  2LUY A;  2JXD A;  2N1A B;  2ENZ A;  5HI7 A;  3UGL A;  2SGQ I;  5HQ8 A;  2F3C I;  2GKV A;  1R79 A;  2QQE A;  1FAR A;  1MT1 A;  4JCV E;  3VDP A;  2NU4 I;  4UXH A;  4HGU A;  4A24 A;  1XA6 A;  2A20 A;  1RFH A;  2NU3 I;  1BMO A;  1OVO A;  1FAQ A;  3TJQ A;  2QQ0 A;  2SGD I;  1CGJ I;  2QPO A;  1X74 A;  1NUB A;  1CSO I;  2N71 A;  1Z7K B;  1UVF A;  2LEO A;  1TBN A;  4E1P A;  2SGP I;  5CCL A;  1Y1C A;  1PPF I;  2QQD A;  1TBR R;  3UGI A;  2OVO A;  1Y1B A;  2VRW B;  4FKD A;  1OMU A;  2ERW A;  1SGQ I;  1V1H A;  1SGE I;  2M5X A;  1XBT A;  4E1R A;  1CHO I;  3UFF A;  2V53 A;  2SGF I;  3E59 A;  2KMO A;  2JA1 A;  1TGS I;  4L9M A;  1KBE A;  2ROW A;  2E73 A;  2JYY A;  3OXL A;  5JHW C;  2GKT I;  3BJI A;  1YTP A;  2P6A C;  3MEK A;  1TUS A;  1W3S A;  2YQP A;  3HH2 C;  4GI3 C;  4UXJ A;  2WVJ A;  5FUW A;  1X4S A;  1IY5 A;  2JW6 A;  5FUY A;  2OD1 A;  2CJS C;  1IY6 A;  1UUC A;  1Y8F A;  1HJA I;  2GVI A;  3E2I A;  2ODD A;  3SEK C;  5CCM A;  1TIH A;  2NU1 I;  3UEJ A;  2L7X A;  1HPT A;  3PDN A;  1H0Z A;  5EX0 A;  1W4R A;  2JZM A;  1XX6 A;  3FC3 A;  1DS2 I;  1R0R I;  1TOT A;  2GKR I;  2J87 A;  4UXI A;  2NU2 I;  2DB6 A;  3CXL A;  2ORV A;  2WCY A;  5DAE A;  3VDU A;  2SGE I;  3QTL D;  1UVG A;  2FNF X;  2XRC A;  2KMQ A;  1CT2 I;  1AN1 I;  2V1C A;  3OL0 A;  1OYV I;  1N13 A;  1PTQ A;  1BUS A;  3GOX A;  1SGY I;  2BUS A;  1PTR A;  3B4V C;  1U5K A;  1TBO A;  5FUX A;  1M8C A;  1SGD I;  3QWP A;  4OVO A;  2J9R A;  4B6D A;  1FYB A;  2YUU A;  3RU0 A;  1TUR A;  1V1I A;  2ARP F;  2KCX A;  2N17 A;  4SGB I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...