2BUSA

Solution conformation of proteinase inhibitor iia from bull seminal plasma by 1h nuclear magnetic resonance and distance geometry
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
57
structure length
57
Chain Sequence
b'EGAQVDCAEFKDPKVYCTRESNPHCGSNGETYGNKCAFCKAVMKSGGKINLKHRGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE INHIBITOR IIA
publication title Solution conformation of proteinase inhibitor IIA from bull seminal plasma by 1H nuclear magnetic resonance and distance geometry.
pubmed doi rcsb
source organism Bos taurus
molecule tags Proteinase inhibitor
total genus 7
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1990-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2busA00
2P6AC 1TURA 1CE3A 1LR9A 1CHOI 2LEOA 5JHWC 1SGDI 2ARPF 2JZMA 2NU3I 2WCYA 2BUSA 1Y1CA 1H0ZA 1Y1BA 2V53A 4HGUA 2F3CI 5DAEA 1Z7KB 3QTLD 4GI3C 1SGEI 1TIHA 2N71A 1N13A 1SGYI 2KMPA 2KMOA 2SGPI 2NU0I 1BMOA 1MT1A 2SGEI 1TUSA 1PCEA 1HJAI 1CGII 1PJUA 1M8CA 1SGQI 2GKTI 1FYBA 1CSOI 2XRCA 1HPTA 1CGJI 1CT0I 1SGNI 1IY5A 2NU1I 2B0UC 1R0RI 2NU2I 1CT2I 1TBRR 1YU6C 3OVOA 2SGQI 3SEKC 3SGQI 1IW4A 1LR7A 2QQCA 1OMTA 1CT4I 3SGBI 2N52A 3HH2C 1TBQR 2QQDA 3B4VC 2SGDI 1PPFI 1DS3I 1IY6A 1OMUA 2KMQA 1SGRI 3TJQA 1SGPI 1OYVI 1TGSI 2N17A 1OVOA 2NU4I 1HDLA 1BUSA 2KMRA 2JYYA 2SGFI 1YTPA 2KCXA 1AN1I 1KMAA 2JXDA 1UVGA 2GKRI 2ERWA 2M5XA 4OVOA 1UVFA 2GKVA 2OVOA 1LR8A 4SGBI 1NUBA 1M8BA 1DS2I 1UUCA
chains in the Genus database with same CATH superfamily
2P6AC 1TURA 2VRWB 1CE3A 1LR9A 1W3SA 1CHOI 2LEOA 5E3PA 3UGLA 5JHWC 1SGDI 2ARPF 2LUYA 4FKDA 2JZMA 5HI7A 3QAHA 2NU3I 2WCYA 3E59A 5EX0A 2JA1A 2BUSA 3QWPA 1Y1CA 1K7TA 1Q9BA 1VDDA 2X3TA 1Y1BA 2V53A 5FUVA 1H0ZA 2YQPA 1U5KA 2F3CI 4HGUA 5DAEA 1Z7KB 3QTLD 4GI3C 1SGEI 1TIHA 4JCVE 2N71A 1N13A 1NXUA 3GOXA 1SGYI 3UFFA 1WGCA 3E2IA 2KMPA 2KMOA 2SGPI 3TO7A 2NU0I 1BMOA 5EX3A 3TOBA 1MT1A 2UZ3A 2SGEI 2OD1A 2QQ0A 2WGCA 5J8FA 1TUSA 4WP4A 1PCEA 1HJAI 1CGII 1PTQA 3BJIA 1PJUA 3PDNA 1M8CA 2OU2A 1SGQI 3UOEA 2GKTI 2ENNA 2PQ8A 2WVJA 5CCMA 2DB6A 1FYBA 1CSOI 1TOTA 2XRCA 3D00A 3OXLA 2ELIA 4B6DA 2RC4A 1HPTA 1MJAA 4DNCA 1CGJI 1CT0I 1TBOA 1UHAA 1X74A 7WGAA 1SGNI 3VE5A 2QQEA 1V1HA 1IY5A 2NU1I 2DKVA 2OZUA 1WKXA 1MJBA 2QPOA 2A20A 2YUUA 2JW6A 2B0UC 3KY9A 1XBTA 2V1CC 2CWGA 1R0RI 2NU2I 1CT2I 1FY7A 1TBRR 1YU6C 2SGQI 3OVOA 5FUXA 3SEKC 3SGQI 1KBFA 3OL0A 5FUYA 3TOAA 1XA6A 1Z2IA 1IW4A 1LR7A 2QQCA 5E3QA 1OMTA 1CT4I 2N1AB 2ENZA 4UXIA 3VDUA 3SGBI 1TBNA 5J8CA 2N52A 3HH2C 1TBQR 2QQDA 3B4VC 1R79A 2Y0MA 2SGDI 1ULMA 5FUWA 1PPFI 4UXHA 2ORWA 3R5CA 1P9GA 1DS3I 1K7UA 3OXGA 1IY6A 3VDPA 1OMUA 2CWFA 4E1RA 9WGAA 1X4SA 1ULNA 3TO6A 2KMQA 5HQ8A 1SGRI 4L9MA 1SGPI 3TJQA 3UEJA 5CCLA 1KBEA 3CXLA 1OYVI 1K7VA 4AMLA 3R5AA 1TGSI 1S20A 2L8EA 1ULKA 2X52A 2N17A 3R5DA 1OVOA 2J87A 2LB7A 2V1CA 1WGTA 3R5BA 2J9RA 2E73A 2FNFX 3OXFA 2NU4I 4MPIA 4UXJA 1HDLA 1BUSA 1XX6A 1PTRA 2GVIA 2KMRA 2W0TA 4A24A 1W4RA 2E5RA 3UEYA 2DIPA 2JYYA 2SGFI 1YTPA 2KCXA 1AN1I 2ORVA 1KMAA 2JXDA 2K9HA 1UVGA 2GKRI 2RIJA 2CWHA 3MEKA 1HEVA 2L7XA 2UVOA 1MJ9A 2ERWA 1FAQA 2ODDA 3RU0A 1FARA 2CJSC 3FC3A 2M5XA 3TO9A 3UGIA 4OVOA 2GIVA 4E1PA 2ROWA 1UVFA 2GKVA 2OVOA 1WTJA 1LR8A 1P9ZA 1RFHA 2B8TA 4SGBI 3UGDA 3FSXA 1NUBA 3FSYA 1V1IA 1Y8FA 1M8BA 1DS2I 1UUCA 5E3RA
chains in the Genus database with same CATH topology
2P6AC 1TURA 2VRWB 1CE3A 1LR9A 1W3SA 1CHOI 2LEOA 3UGLA 5JHWC 1SGDI 2ARPF 2LUYA 4FKDA 2JZMA 5HI7A 5EX0A 2NU3I 2WCYA 3E59A 2JA1A 2BUSA 3QWPA 1Y1CA 5FUVA 1VDDA 1H0ZA 1Y1BA 2V53A 2YQPA 1U5KA 2F3CI 4HGUA 5DAEA 1Z7KB 3QTLD 4GI3C 1SGEI 1TIHA 4JCVE 2N71A 1N13A 3GOXA 1SGYI 3UFFA 3E2IA 2KMPA 2KMOA 2SGPI 2NU0I 1BMOA 5EX3A 1MT1A 2UZ3A 2SGEI 2OD1A 2QQ0A 1TUSA 1PCEA 1HJAI 1CGII 1PTQA 3BJIA 1PJUA 3PDNA 1M8CA 1SGQI 2GKTI 2ENNA 2WVJA 5CCMA 2DB6A 1FYBA 1CSOI 1TOTA 2XRCA 3D00A 3OXLA 2ELIA 4B6DA 1HPTA 1CGJI 1CT0I 1TBOA 1X74A 1SGNI 3VE5A 2QQEA 1V1HA 1IY5A 2NU1I 2YUUA 2QPOA 2A20A 2JW6A 2B0UC 3KY9A 1XBTA 2V1CC 5FUXA 1R0RI 2NU2I 1CT2I 1TBRR 1YU6C 3OVOA 2SGQI 3SEKC 3SGQI 1IW4A 1KBFA 3OL0A 5FUYA 1XA6A 1LR7A 2QQCA 1OMTA 1CT4I 2N1AB 2ENZA 4UXIA 3VDUA 3SGBI 1TBNA 2N52A 3HH2C 1TBQR 2QQDA 3B4VC 1R79A 2SGDI 5FUWA 1PPFI 4UXHA 2ORWA 3OXGA 1DS3I 1IY6A 3VDPA 1OMUA 4E1RA 1X4SA 2KMQA 5HQ8A 1SGRI 4L9MA 1SGPI 3TJQA 3UEJA 5CCLA 1KBEA 3CXLA 1OYVI 1TGSI 2L8EA 2N17A 1OVOA 2J87A 2V1CA 2J9RA 2E73A 2FNFX 3OXFA 2NU4I 4UXJA 1HDLA 1BUSA 1XX6A 1PTRA 2GVIA 2KMRA 2W0TA 4A24A 1W4RA 2E5RA 3UEYA 2DIPA 2JYYA 2SGFI 1YTPA 2KCXA 1AN1I 2ORVA 1KMAA 2JXDA 2K9HA 1UVGA 2GKRI 3MEKA 2L7XA 2ERWA 1FAQA 2ODDA 3RU0A 1FARA 2CJSC 3FC3A 2M5XA 3UGIA 4OVOA 4E1PA 2ROWA 1UVFA 2GKVA 2OVOA 1LR8A 1RFHA 2B8TA 4SGBI 3UGDA 1NUBA 1V1IA 1Y8FA 1M8BA 1DS2I 1UUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6A C;  1TUR A;  1CE3 A;  1LR9 A;  1CHO I;  2LEO A;  5JHW C;  1SGD I;  2ARP F;  2JZM A;  2NU3 I;  2WCY A;  2BUS A;  1Y1C A;  1H0Z A;  1Y1B A;  2V53 A;  4HGU A;  2F3C I;  5DAE A;  1Z7K B;  3QTL D;  4GI3 C;  1SGE I;  1TIH A;  2N71 A;  1N13 A;  1SGY I;  2KMP A;  2KMO A;  2SGP I;  2NU0 I;  1BMO A;  1MT1 A;  2SGE I;  1TUS A;  1PCE A;  1HJA I;  1CGI I;  1PJU A;  1M8C A;  1SGQ I;  2GKT I;  1FYB A;  1CSO I;  2XRC A;  1HPT A;  1CGJ I;  1CT0 I;  1SGN I;  1IY5 A;  2NU1 I;  2B0U C;  1R0R I;  2NU2 I;  1CT2 I;  1TBR R;  1YU6 C;  3OVO A;  2SGQ I;  3SEK C;  3SGQ I;  1IW4 A;  1LR7 A;  2QQC A;  1OMT A;  1CT4 I;  3SGB I;  2N52 A;  3HH2 C;  1TBQ R;  2QQD A;  3B4V C;  2SGD I;  1PPF I;  1DS3 I;  1IY6 A;  1OMU A;  2KMQ A;  1SGR I;  3TJQ A;  1SGP I;  1OYV I;  1TGS I;  2N17 A;  1OVO A;  2NU4 I;  1HDL A;  1BUS A;  2KMR A;  2JYY A;  2SGF I;  1YTP A;  2KCX A;  1AN1 I;  1KMA A;  2JXD A;  1UVG A;  2GKR I;  2ERW A;  2M5X A;  4OVO A;  1UVF A;  2GKV A;  2OVO A;  1LR8 A;  4SGB I;  1NUB A;  1M8B A;  1DS2 I;  1UUC A; 
#chains in the Genus database with same CATH topology
 2P6A C;  1TUR A;  2VRW B;  1CE3 A;  1LR9 A;  1W3S A;  1CHO I;  2LEO A;  5E3P A;  3UGL A;  5JHW C;  1SGD I;  2ARP F;  2LUY A;  4FKD A;  2JZM A;  5HI7 A;  3QAH A;  2NU3 I;  2WCY A;  3E59 A;  5EX0 A;  2JA1 A;  2BUS A;  3QWP A;  1Y1C A;  1K7T A;  1Q9B A;  1VDD A;  2X3T A;  1Y1B A;  2V53 A;  5FUV A;  1H0Z A;  2YQP A;  1U5K A;  2F3C I;  4HGU A;  5DAE A;  1Z7K B;  3QTL D;  4GI3 C;  1SGE I;  1TIH A;  4JCV E;  2N71 A;  1N13 A;  1NXU A;  3GOX A;  1SGY I;  3UFF A;  1WGC A;  3E2I A;  2KMP A;  2KMO A;  2SGP I;  3TO7 A;  2NU0 I;  1BMO A;  5EX3 A;  3TOB A;  1MT1 A;  2UZ3 A;  2SGE I;  2OD1 A;  2QQ0 A;  2WGC A;  5J8F A;  1TUS A;  4WP4 A;  1PCE A;  1HJA I;  1CGI I;  1PTQ A;  3BJI A;  1PJU A;  3PDN A;  1M8C A;  2OU2 A;  1SGQ I;  3UOE A;  2GKT I;  2ENN A;  2PQ8 A;  2WVJ A;  5CCM A;  2DB6 A;  1FYB A;  1CSO I;  1TOT A;  2XRC A;  3D00 A;  3OXL A;  2ELI A;  4B6D A;  2RC4 A;  1HPT A;  1MJA A;  4DNC A;  1CGJ I;  1CT0 I;  1TBO A;  1UHA A;  1X74 A;  7WGA A;  1SGN I;  3VE5 A;  2QQE A;  1V1H A;  1IY5 A;  2NU1 I;  2DKV A;  2OZU A;  1WKX A;  1MJB A;  2QPO A;  2A20 A;  2YUU A;  2JW6 A;  2B0U C;  3KY9 A;  1XBT A;  2V1C C;  2CWG A;  1R0R I;  2NU2 I;  1CT2 I;  1FY7 A;  1TBR R;  1YU6 C;  2SGQ I;  3OVO A;  5FUX A;  3SEK C;  3SGQ I;  1KBF A;  3OL0 A;  5FUY A;  3TOA A;  1XA6 A;  1Z2I A;  1IW4 A;  1LR7 A;  2QQC A;  5E3Q A;  1OMT A;  1CT4 I;  2N1A B;  2ENZ A;  4UXI A;  3VDU A;  3SGB I;  1TBN A;  5J8C A;  2N52 A;  3HH2 C;  1TBQ R;  2QQD A;  3B4V C;  1R79 A;  2Y0M A;  2SGD I;  1ULM A;  5FUW A;  1PPF I;  4UXH A;  2ORW A;  3R5C A;  1P9G A;  1DS3 I;  1K7U A;  3OXG A;  1IY6 A;  3VDP A;  1OMU A;  2CWF A;  4E1R A;  9WGA A;  1X4S A;  1ULN A;  3TO6 A;  2KMQ A;  5HQ8 A;  1SGR I;  4L9M A;  1SGP I;  3TJQ A;  3UEJ A;  5CCL A;  1KBE A;  3CXL A;  1OYV I;  1K7V A;  4AML A;  3R5A A;  1TGS I;  1S20 A;  2L8E A;  1ULK A;  2X52 A;  2N17 A;  3R5D A;  1OVO A;  2J87 A;  2LB7 A;  2V1C A;  1WGT A;  3R5B A;  2J9R A;  2E73 A;  2FNF X;  3OXF A;  2NU4 I;  4MPI A;  4UXJ A;  1HDL A;  1BUS A;  1XX6 A;  1PTR A;  2GVI A;  2KMR A;  2W0T A;  4A24 A;  1W4R A;  2E5R A;  3UEY A;  2DIP A;  2JYY A;  2SGF I;  1YTP A;  2KCX A;  1AN1 I;  2ORV A;  1KMA A;  2JXD A;  2K9H A;  1UVG A;  2GKR I;  2RIJ A;  2CWH A;  3MEK A;  1HEV A;  2L7X A;  2UVO A;  1MJ9 A;  2ERW A;  1FAQ A;  2ODD A;  3RU0 A;  1FAR A;  2CJS C;  3FC3 A;  2M5X A;  3TO9 A;  3UGI A;  4OVO A;  2GIV A;  4E1P A;  2ROW A;  1UVF A;  2GKV A;  2OVO A;  1WTJ A;  1LR8 A;  1P9Z A;  1RFH A;  2B8T A;  4SGB I;  3UGD A;  3FSX A;  1NUB A;  3FSY A;  1V1I A;  1Y8F A;  1M8B A;  1DS2 I;  1UUC A;  5E3R A; 
#chains in the Genus database with same CATH homology
 2P6A C;  1TUR A;  2VRW B;  1CE3 A;  1LR9 A;  1W3S A;  1CHO I;  2LEO A;  3UGL A;  5JHW C;  1SGD I;  2ARP F;  2LUY A;  4FKD A;  2JZM A;  5HI7 A;  5EX0 A;  2NU3 I;  2WCY A;  3E59 A;  2JA1 A;  2BUS A;  3QWP A;  1Y1C A;  5FUV A;  1VDD A;  1H0Z A;  1Y1B A;  2V53 A;  2YQP A;  1U5K A;  2F3C I;  4HGU A;  5DAE A;  1Z7K B;  3QTL D;  4GI3 C;  1SGE I;  1TIH A;  4JCV E;  2N71 A;  1N13 A;  3GOX A;  1SGY I;  3UFF A;  3E2I A;  2KMP A;  2KMO A;  2SGP I;  2NU0 I;  1BMO A;  5EX3 A;  1MT1 A;  2UZ3 A;  2SGE I;  2OD1 A;  2QQ0 A;  1TUS A;  1PCE A;  1HJA I;  1CGI I;  1PTQ A;  3BJI A;  1PJU A;  3PDN A;  1M8C A;  1SGQ I;  2GKT I;  2ENN A;  2WVJ A;  5CCM A;  2DB6 A;  1FYB A;  1CSO I;  1TOT A;  2XRC A;  3D00 A;  3OXL A;  2ELI A;  4B6D A;  1HPT A;  1CGJ I;  1CT0 I;  1TBO A;  1X74 A;  1SGN I;  3VE5 A;  2QQE A;  1V1H A;  1IY5 A;  2NU1 I;  2YUU A;  2QPO A;  2A20 A;  2JW6 A;  2B0U C;  3KY9 A;  1XBT A;  2V1C C;  5FUX A;  1R0R I;  2NU2 I;  1CT2 I;  1TBR R;  1YU6 C;  3OVO A;  2SGQ I;  3SEK C;  3SGQ I;  1IW4 A;  1KBF A;  3OL0 A;  5FUY A;  1XA6 A;  1LR7 A;  2QQC A;  1OMT A;  1CT4 I;  2N1A B;  2ENZ A;  4UXI A;  3VDU A;  3SGB I;  1TBN A;  2N52 A;  3HH2 C;  1TBQ R;  2QQD A;  3B4V C;  1R79 A;  2SGD I;  5FUW A;  1PPF I;  4UXH A;  2ORW A;  3OXG A;  1DS3 I;  1IY6 A;  3VDP A;  1OMU A;  4E1R A;  1X4S A;  2KMQ A;  5HQ8 A;  1SGR I;  4L9M A;  1SGP I;  3TJQ A;  3UEJ A;  5CCL A;  1KBE A;  3CXL A;  1OYV I;  1TGS I;  2L8E A;  2N17 A;  1OVO A;  2J87 A;  2V1C A;  2J9R A;  2E73 A;  2FNF X;  3OXF A;  2NU4 I;  4UXJ A;  1HDL A;  1BUS A;  1XX6 A;  1PTR A;  2GVI A;  2KMR A;  2W0T A;  4A24 A;  1W4R A;  2E5R A;  3UEY A;  2DIP A;  2JYY A;  2SGF I;  1YTP A;  2KCX A;  1AN1 I;  2ORV A;  1KMA A;  2JXD A;  2K9H A;  1UVG A;  2GKR I;  3MEK A;  2L7X A;  2ERW A;  1FAQ A;  2ODD A;  3RU0 A;  1FAR A;  2CJS C;  3FC3 A;  2M5X A;  3UGI A;  4OVO A;  4E1P A;  2ROW A;  1UVF A;  2GKV A;  2OVO A;  1LR8 A;  1RFH A;  2B8T A;  4SGB I;  3UGD A;  1NUB A;  1V1I A;  1Y8F A;  1M8B A;  1DS2 I;  1UUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...