2BUSA

Solution conformation of proteinase inhibitor iia from bull seminal plasma by 1h nuclear magnetic resonance and distance geometry
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
57
structure length
57
Chain Sequence
EGAQVDCAEFKDPKVYCTRESNPHCGSNGETYGNKCAFCKAVMKSGGKINLKHRGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proteinase inhibitor
molecule keywords PROTEINASE INHIBITOR IIA
publication title Solution conformation of proteinase inhibitor IIA from bull seminal plasma by 1H nuclear magnetic resonance and distance geometry.
pubmed doi rcsb
source organism Bos taurus
total genus 7
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1990-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2busA00
1CSOI 1CGJI 1CE3A 1KMAA 1H0ZA 1OMUA 2KCXA 1Y1CA 1TBQR 1TIHA 1FYBA 1SGPI 1LR7A 1LR8A 1TURA 2ARPF 3HH2C 1OVOA 1DS3I 1SGNI 1OMTA 2N52A 2BUSA 4HGUA 3TJQA 1UVFA 2GKRI 2KMRA 3OVOA 1BMOA 5DAEA 1CHOI 1N13A 1LR9A 2KMPA 1HDLA 1UUCA 2NU2I 2NU4I 2P6AC 3SEKC 2KMOA 1SGYI 1DS2I 1MT1A 2SGDI 2M5XA 1UVGA 2ERWA 1YU6C 2GKVA 2NU1I 1R0RI 2B0UC 1CT4I 2JXDA 2NU0I 1NUBA 1BUSA 2SGPI 2QQCA 1IY6A 1IY5A 1PCEA 2SGQI 2JZMA 1TGSI 2NU3I 1PPFI 2N71A 4GI3C 1SGRI 1YTPA 1TUSA 1CGII 1M8CA 1CT0I 1Y1BA 1Z7KB 2JYYA 2LEOA 2OVOA 1HJAI 1TBRR 3SGQI 1OYVI 4OVOA 2WCYA 4SGBI 1IW4A 2GKTI 1CT2I 1SGQI 1AN1I 2V53A 3B4VC 5JHWC 1SGDI 2SGFI 2KMQA 2QQDA 1SGEI 2F3CI 2XRCA 1HPTA 3QTLD 3SGBI 2N17A 2SGEI 1M8BA 1PJUA
chains in the Genus database with same CATH superfamily
2GVIA 2RC4A 1FY7A 1CSOI 2OD1A 1P9GA 5J8FA 1CGJI 1CE3A 1WTJA 3QWPA 1VDDA 1KMAA 1S20A 5E3QA 1OMUA 1H0ZA 2KCXA 1WGCA 4DNCA 5CCLA 2JA1A 2ODDA 1Y1CA 1Q9BA 1TBQR 5E3PA 1K7VA 1TIHA 1NXUA 1FYBA 3FSXA 2W0TA 1R79A 3E59A 4FKDA 3R5CA 5FUWA 1SGPI 3OXLA 1U5KA 5CCMA 2L7XA 3R5DA 2ORWA 1LR7A 1TBNA 1WGTA 2N1AB 1MJAA 1LR8A 1TURA 2ARPF 3OXFA 3HH2C 2X52A 1OVOA 1DS3I 4A24A 1PTQA 2ROWA 1SGNI 1RFHA 1V1IA 3UOEA 5FUYA 2DIPA 2CWGA 1OMTA 1Z2IA 2N52A 3TO6A 2BUSA 4HGUA 3TJQA 1UVFA 2GKRI 2B8TA 2A20A 1P9ZA 1BMOA 2KMRA 3D00A 3OVOA 3TO9A 1MJBA 5DAEA 1CHOI 1N13A 1LR9A 2KMPA 3CXLA 4UXJA 3UEYA 3KY9A 3GOXA 3E2IA 2OU2A 1HDLA 1XX6A 3BJIA 1UUCA 2GIVA 2NU2I 2NU4I 1TBOA 2P6AC 3PDNA 3UGLA 1XBTA 2UZ3A 3SEKC 4L9MA 2KMOA 3R5BA 1SGYI 1DS2I 1MT1A 2SGDI 2M5XA 3FC3A 3TOAA 3OL0A 1UVGA 2QPOA 3UFFA 2ERWA 1YU6C 2WVJA 3UEJA 2GKVA 7WGAA 1PTRA 2NU1I 2V1CA 5J8CA 4UXHA 1R0RI 2B0UC 1CT4I 2ENNA 2FNFX 2RIJA 2JXDA 2NU0I 3VDPA 1NUBA 1BUSA 2SGPI 2QQCA 1IY6A 2ORVA 1WKXA 3OXGA 3VE5A 3UGIA 1IY5A 1PCEA 2SGQI 2JZMA 2OZUA 1TGSI 1K7UA 2NU3I 1ULNA 2LB7A 2YUUA 5HQ8A 2V1CC 3TO7A 2J87A 2JW6A 1PPFI 4B6DA 1ULMA 2N71A 5FUXA 4GI3C 1SGRI 4JCVE 1YTPA 5FUVA 1UHAA 3TOBA 1KBFA 1TUSA 1FAQA 1CGII 5HI7A 5EX0A 1M8CA 4UXIA 4E1RA 1CT0I 1Y1BA 3RU0A 1MJ9A 1Z7KB 2CWHA 1Y8FA 2LUYA 5E3RA 3UGDA 1X4SA 1KBEA 2CJSC 2JYYA 2LEOA 1K7TA 2OVOA 2YQPA 1HJAI 1TBRR 1XA6A 1V1HA 2Y0MA 2UVOA 9WGAA 3SGQI 3VDUA 1OYVI 4OVOA 1FARA 2WCYA 3QAHA 3R5AA 4SGBI 2QQEA 2WGCA 2VRWB 1IW4A 2QQ0A 2GKTI 2X3TA 1CT2I 2ENZA 1X74A 1SGQI 1AN1I 3MEKA 2DB6A 3FSYA 2ELIA 1ULKA 2L8EA 2V53A 3B4VC 4WP4A 2K9HA 1HEVA 2E5RA 1TOTA 5JHWC 1W4RA 1W3SA 1SGDI 2SGFI 2KMQA 2QQDA 1SGEI 2F3CI 2CWFA 2J9RA 2XRCA 1HPTA 2E73A 3QTLD 2PQ8A 5EX3A 4MPIA 3SGBI 2N17A 2SGEI 1M8BA 4E1PA 2DKVA 4AMLA 1PJUA
chains in the Genus database with same CATH topology
2GVIA 2OD1A 1CSOI 1CGJI 1CE3A 3QWPA 1VDDA 1KMAA 1H0ZA 1OMUA 2KCXA 5CCLA 2JA1A 2ODDA 1Y1CA 1TBQR 1TIHA 1FYBA 2W0TA 1R79A 3E59A 4FKDA 5FUWA 1SGPI 3OXLA 1U5KA 5CCMA 2L7XA 2ORWA 1LR7A 1TBNA 2N1AB 3OXFA 1LR8A 1TURA 2ARPF 3HH2C 4A24A 1OVOA 1DS3I 1PTQA 2ROWA 1SGNI 1RFHA 1V1IA 5FUYA 2DIPA 1OMTA 2N52A 2BUSA 4HGUA 3TJQA 1UVFA 2GKRI 2B8TA 2A20A 2KMRA 1BMOA 3OVOA 3D00A 5DAEA 1CHOI 1N13A 1LR9A 2KMPA 3CXLA 4UXJA 3UEYA 3KY9A 3GOXA 3E2IA 1HDLA 1XX6A 3BJIA 1UUCA 2NU2I 2NU4I 1TBOA 2P6AC 3PDNA 3UGLA 1XBTA 2UZ3A 3SEKC 4L9MA 2KMOA 1SGYI 1DS2I 1MT1A 2SGDI 2M5XA 3FC3A 3OL0A 1UVGA 2QPOA 3UFFA 2ERWA 1YU6C 2WVJA 3UEJA 2GKVA 1PTRA 2NU1I 2V1CA 4UXHA 1R0RI 2B0UC 1CT4I 2ENNA 2FNFX 2JXDA 2NU0I 3VDPA 1NUBA 1BUSA 2SGPI 2QQCA 1IY6A 2ORVA 3OXGA 3VE5A 3UGIA 1IY5A 1PCEA 2SGQI 2JZMA 1TGSI 2NU3I 2YUUA 5HQ8A 2V1CC 2J87A 2JW6A 1PPFI 4B6DA 2N71A 5FUXA 4GI3C 1SGRI 4JCVE 1YTPA 5FUVA 1KBFA 1TUSA 1FAQA 1CGII 5HI7A 5EX0A 1M8CA 4UXIA 4E1RA 1CT0I 1Y1BA 3RU0A 1Z7KB 2LUYA 1Y8FA 3UGDA 1X4SA 1KBEA 2CJSC 2JYYA 2LEOA 2OVOA 2YQPA 1HJAI 1TBRR 1XA6A 1V1HA 3SGQI 3VDUA 1OYVI 4OVOA 1FARA 2WCYA 4SGBI 2QQEA 2VRWB 1IW4A 2QQ0A 2GKTI 1CT2I 2ENZA 1X74A 1SGQI 1AN1I 3MEKA 2DB6A 2ELIA 2V53A 2L8EA 3B4VC 2K9HA 2E5RA 1TOTA 5JHWC 1W4RA 1W3SA 1SGDI 2SGFI 2KMQA 2QQDA 1SGEI 2F3CI 2XRCA 2J9RA 1HPTA 2E73A 3QTLD 5EX3A 3SGBI 2N17A 2SGEI 1M8BA 4E1PA 1PJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSO I;  1CGJ I;  1CE3 A;  1KMA A;  1H0Z A;  1OMU A;  2KCX A;  1Y1C A;  1TBQ R;  1TIH A;  1FYB A;  1SGP I;  1LR7 A;  1LR8 A;  1TUR A;  2ARP F;  3HH2 C;  1OVO A;  1DS3 I;  1SGN I;  1OMT A;  2N52 A;  2BUS A;  4HGU A;  3TJQ A;  1UVF A;  2GKR I;  2KMR A;  3OVO A;  1BMO A;  5DAE A;  1CHO I;  1N13 A;  1LR9 A;  2KMP A;  1HDL A;  1UUC A;  2NU2 I;  2NU4 I;  2P6A C;  3SEK C;  2KMO A;  1SGY I;  1DS2 I;  1MT1 A;  2SGD I;  2M5X A;  1UVG A;  2ERW A;  1YU6 C;  2GKV A;  2NU1 I;  1R0R I;  2B0U C;  1CT4 I;  2JXD A;  2NU0 I;  1NUB A;  1BUS A;  2SGP I;  2QQC A;  1IY6 A;  1IY5 A;  1PCE A;  2SGQ I;  2JZM A;  1TGS I;  2NU3 I;  1PPF I;  2N71 A;  4GI3 C;  1SGR I;  1YTP A;  1TUS A;  1CGI I;  1M8C A;  1CT0 I;  1Y1B A;  1Z7K B;  2JYY A;  2LEO A;  2OVO A;  1HJA I;  1TBR R;  3SGQ I;  1OYV I;  4OVO A;  2WCY A;  4SGB I;  1IW4 A;  2GKT I;  1CT2 I;  1SGQ I;  1AN1 I;  2V53 A;  3B4V C;  5JHW C;  1SGD I;  2SGF I;  2KMQ A;  2QQD A;  1SGE I;  2F3C I;  2XRC A;  1HPT A;  3QTL D;  3SGB I;  2N17 A;  2SGE I;  1M8B A;  1PJU A; 
#chains in the Genus database with same CATH topology
 2GVI A;  2RC4 A;  1FY7 A;  1CSO I;  2OD1 A;  1P9G A;  5J8F A;  1CGJ I;  1CE3 A;  1WTJ A;  3QWP A;  1VDD A;  1KMA A;  1S20 A;  5E3Q A;  1OMU A;  1H0Z A;  2KCX A;  1WGC A;  4DNC A;  5CCL A;  2JA1 A;  2ODD A;  1Y1C A;  1Q9B A;  1TBQ R;  5E3P A;  1K7V A;  1TIH A;  1NXU A;  1FYB A;  3FSX A;  2W0T A;  1R79 A;  3E59 A;  4FKD A;  3R5C A;  5FUW A;  1SGP I;  3OXL A;  1U5K A;  5CCM A;  2L7X A;  3R5D A;  2ORW A;  1LR7 A;  1TBN A;  1WGT A;  2N1A B;  1MJA A;  1LR8 A;  1TUR A;  2ARP F;  3OXF A;  3HH2 C;  2X52 A;  1OVO A;  1DS3 I;  4A24 A;  1PTQ A;  2ROW A;  1SGN I;  1RFH A;  1V1I A;  3UOE A;  5FUY A;  2DIP A;  2CWG A;  1OMT A;  1Z2I A;  2N52 A;  3TO6 A;  2BUS A;  4HGU A;  3TJQ A;  1UVF A;  2GKR I;  2B8T A;  2A20 A;  1P9Z A;  1BMO A;  2KMR A;  3D00 A;  3OVO A;  3TO9 A;  1MJB A;  5DAE A;  1CHO I;  1N13 A;  1LR9 A;  2KMP A;  3CXL A;  4UXJ A;  3UEY A;  3KY9 A;  3GOX A;  3E2I A;  2OU2 A;  1HDL A;  1XX6 A;  3BJI A;  1UUC A;  2GIV A;  2NU2 I;  2NU4 I;  1TBO A;  2P6A C;  3PDN A;  3UGL A;  1XBT A;  2UZ3 A;  3SEK C;  4L9M A;  2KMO A;  3R5B A;  1SGY I;  1DS2 I;  1MT1 A;  2SGD I;  2M5X A;  3FC3 A;  3TOA A;  3OL0 A;  1UVG A;  2QPO A;  3UFF A;  2ERW A;  1YU6 C;  2WVJ A;  3UEJ A;  2GKV A;  7WGA A;  1PTR A;  2NU1 I;  2V1C A;  5J8C A;  4UXH A;  1R0R I;  2B0U C;  1CT4 I;  2ENN A;  2FNF X;  2RIJ A;  2JXD A;  2NU0 I;  3VDP A;  1NUB A;  1BUS A;  2SGP I;  2QQC A;  1IY6 A;  2ORV A;  1WKX A;  3OXG A;  3VE5 A;  3UGI A;  1IY5 A;  1PCE A;  2SGQ I;  2JZM A;  2OZU A;  1TGS I;  1K7U A;  2NU3 I;  1ULN A;  2LB7 A;  2YUU A;  5HQ8 A;  2V1C C;  3TO7 A;  2J87 A;  2JW6 A;  1PPF I;  4B6D A;  1ULM A;  2N71 A;  5FUX A;  4GI3 C;  1SGR I;  4JCV E;  1YTP A;  5FUV A;  1UHA A;  3TOB A;  1KBF A;  1TUS A;  1FAQ A;  1CGI I;  5HI7 A;  5EX0 A;  1M8C A;  4UXI A;  4E1R A;  1CT0 I;  1Y1B A;  3RU0 A;  1MJ9 A;  1Z7K B;  2CWH A;  1Y8F A;  2LUY A;  5E3R A;  3UGD A;  1X4S A;  1KBE A;  2CJS C;  2JYY A;  2LEO A;  1K7T A;  2OVO A;  2YQP A;  1HJA I;  1TBR R;  1XA6 A;  1V1H A;  2Y0M A;  2UVO A;  9WGA A;  3SGQ I;  3VDU A;  1OYV I;  4OVO A;  1FAR A;  2WCY A;  3QAH A;  3R5A A;  4SGB I;  2QQE A;  2WGC A;  2VRW B;  1IW4 A;  2QQ0 A;  2GKT I;  2X3T A;  1CT2 I;  2ENZ A;  1X74 A;  1SGQ I;  1AN1 I;  3MEK A;  2DB6 A;  3FSY A;  2ELI A;  1ULK A;  2L8E A;  2V53 A;  3B4V C;  4WP4 A;  2K9H A;  1HEV A;  2E5R A;  1TOT A;  5JHW C;  1W4R A;  1W3S A;  1SGD I;  2SGF I;  2KMQ A;  2QQD A;  1SGE I;  2F3C I;  2CWF A;  2J9R A;  2XRC A;  1HPT A;  2E73 A;  3QTL D;  2PQ8 A;  5EX3 A;  4MPI A;  3SGB I;  2N17 A;  2SGE I;  1M8B A;  4E1P A;  2DKV A;  4AML A;  1PJU A; 
#chains in the Genus database with same CATH homology
 2GVI A;  2OD1 A;  1CSO I;  1CGJ I;  1CE3 A;  3QWP A;  1VDD A;  1KMA A;  1H0Z A;  1OMU A;  2KCX A;  5CCL A;  2JA1 A;  2ODD A;  1Y1C A;  1TBQ R;  1TIH A;  1FYB A;  2W0T A;  1R79 A;  3E59 A;  4FKD A;  5FUW A;  1SGP I;  3OXL A;  1U5K A;  5CCM A;  2L7X A;  2ORW A;  1LR7 A;  1TBN A;  2N1A B;  3OXF A;  1LR8 A;  1TUR A;  2ARP F;  3HH2 C;  4A24 A;  1OVO A;  1DS3 I;  1PTQ A;  2ROW A;  1SGN I;  1RFH A;  1V1I A;  5FUY A;  2DIP A;  1OMT A;  2N52 A;  2BUS A;  4HGU A;  3TJQ A;  1UVF A;  2GKR I;  2B8T A;  2A20 A;  2KMR A;  1BMO A;  3OVO A;  3D00 A;  5DAE A;  1CHO I;  1N13 A;  1LR9 A;  2KMP A;  3CXL A;  4UXJ A;  3UEY A;  3KY9 A;  3GOX A;  3E2I A;  1HDL A;  1XX6 A;  3BJI A;  1UUC A;  2NU2 I;  2NU4 I;  1TBO A;  2P6A C;  3PDN A;  3UGL A;  1XBT A;  2UZ3 A;  3SEK C;  4L9M A;  2KMO A;  1SGY I;  1DS2 I;  1MT1 A;  2SGD I;  2M5X A;  3FC3 A;  3OL0 A;  1UVG A;  2QPO A;  3UFF A;  2ERW A;  1YU6 C;  2WVJ A;  3UEJ A;  2GKV A;  1PTR A;  2NU1 I;  2V1C A;  4UXH A;  1R0R I;  2B0U C;  1CT4 I;  2ENN A;  2FNF X;  2JXD A;  2NU0 I;  3VDP A;  1NUB A;  1BUS A;  2SGP I;  2QQC A;  1IY6 A;  2ORV A;  3OXG A;  3VE5 A;  3UGI A;  1IY5 A;  1PCE A;  2SGQ I;  2JZM A;  1TGS I;  2NU3 I;  2YUU A;  5HQ8 A;  2V1C C;  2J87 A;  2JW6 A;  1PPF I;  4B6D A;  2N71 A;  5FUX A;  4GI3 C;  1SGR I;  4JCV E;  1YTP A;  5FUV A;  1KBF A;  1TUS A;  1FAQ A;  1CGI I;  5HI7 A;  5EX0 A;  1M8C A;  4UXI A;  4E1R A;  1CT0 I;  1Y1B A;  3RU0 A;  1Z7K B;  2LUY A;  1Y8F A;  3UGD A;  1X4S A;  1KBE A;  2CJS C;  2JYY A;  2LEO A;  2OVO A;  2YQP A;  1HJA I;  1TBR R;  1XA6 A;  1V1H A;  3SGQ I;  3VDU A;  1OYV I;  4OVO A;  1FAR A;  2WCY A;  4SGB I;  2QQE A;  2VRW B;  1IW4 A;  2QQ0 A;  2GKT I;  1CT2 I;  2ENZ A;  1X74 A;  1SGQ I;  1AN1 I;  3MEK A;  2DB6 A;  2ELI A;  2V53 A;  2L8E A;  3B4V C;  2K9H A;  2E5R A;  1TOT A;  5JHW C;  1W4R A;  1W3S A;  1SGD I;  2SGF I;  2KMQ A;  2QQD A;  1SGE I;  2F3C I;  2XRC A;  2J9R A;  1HPT A;  2E73 A;  3QTL D;  5EX3 A;  3SGB I;  2N17 A;  2SGE I;  1M8B A;  4E1P A;  1PJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...