2BUSA

Solution conformation of proteinase inhibitor iia from bull seminal plasma by 1h nuclear magnetic resonance and distance geometry
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
57
structure length
57
Chain Sequence
EGAQVDCAEFKDPKVYCTRESNPHCGSNGETYGNKCAFCKAVMKSGGKINLKHRGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE INHIBITOR IIA
publication title Solution conformation of proteinase inhibitor IIA from bull seminal plasma by 1H nuclear magnetic resonance and distance geometry.
pubmed doi rcsb
source organism Bos taurus
molecule tags Proteinase inhibitor
total genus 7
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1990-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2busA00
2KCXA 1BUSA 1HDLA 4GI3C 2N71A 1TUSA 1CT0I 1TBQR 1YTPA 1SGRI 2JYYA 1Z7KB 4SGBI 2N52A 3HH2C 1Y1CA 3SGQI 1SGEI 1TBRR 2NU1I 2GKRI 2WCYA 1OVOA 2KMPA 3OVOA 1LR8A 1SGDI 1DS3I 1CHOI 1CGII 1KMAA 2SGPI 2ERWA 2QQDA 2JXDA 2SGEI 3B4VC 1OMUA 5DAEA 1PPFI 2B0UC 1CT4I 1IW4A 3SGBI 1SGYI 2M5XA 1SGQI 1FYBA 2JZMA 2N17A 2GKVA 1TGSI 1TURA 4OVOA 1IY6A 1Y1BA 1N13A 1OYVI 5JHWC 2GKTI 1UVFA 1IY5A 2SGQI 1MT1A 2NU4I 1M8BA 2V53A 1PJUA 2SGFI 1BMOA 2KMQA 2XRCA 1NUBA 4HGUA 1H0ZA 1DS2I 2LEOA 2OVOA 1CT2I 1OMTA 1HJAI 2KMOA 1SGPI 1AN1I 1HPTA 1YU6C 2ARPF 1UUCA 2QQCA 2NU2I 1LR7A 2BUSA 2F3CI 2KMRA 3TJQA 2P6AC 3QTLD 1TIHA 1CE3A 1CGJI 1UVGA 1LR9A 1R0RI 2SGDI 1PCEA 2NU3I 1SGNI 1M8CA 1CSOI 3SEKC 2NU0I
chains in the Genus database with same CATH superfamily
2KCXA 2DKVA 1BUSA 1HDLA 1ULKA 3PDNA 4GI3C 2N71A 1TUSA 2GVIA 1CT0I 2A20A 2YQPA 1PTQA 5FUYA 4FKDA 4AMLA 2E73A 5E3PA 1TBQR 1FY7A 2CWFA 1YTPA 2RC4A 1SGRI 2JW6A 2JYYA 3E59A 1Z7KB 3R5AA 3QWPA 2OU2A 1FARA 5FUWA 1S20A 4SGBI 2N52A 4WP4A 3HH2C 1U5KA 1XX6A 3UEYA 1Y1CA 2OZUA 3FSXA 5FUVA 1SGEI 1TBRR 3SGQI 2NU1I 2GKRI 2WCYA 4E1RA 1OVOA 2KMPA 3UFFA 1RFHA 3OVOA 1SGDI 1DS3I 1CHOI 1CGII 1KMAA 1X74A 1TBNA 2LB7A 3VE5A 2SGPI 2V1CA 2ERWA 5J8CA 2UVOA 2QQDA 1K7UA 3E2IA 3TO6A 2JXDA 2SGEI 3B4VC 3OXGA 1OMUA 1NXUA 2YUUA 2QQEA 5DAEA 5EX0A 1K7VA 1PPFI 2B0UC 2J9RA 1Y8FA 5E3RA 1KBFA 3VDPA 2WVJA 1CT4I 3TO7A 9WGAA 1IW4A 2B8TA 2DB6A 3SGBI 1SGYI 2CWHA 2M5XA 1TBOA 1SGQI 2LUYA 3QAHA 3R5BA 3CXLA 1FYBA 1ULNA 1WGTA 2JZMA 1P9ZA 3MEKA 4DNCA 5EX3A 5HQ8A 3TO9A 2N17A 2DIPA 2ODDA 2V1CC 1MJ9A 2GKVA 2K9HA 1TGSI 1TURA 4OVOA 1XA6A 1IY6A 1WTJA 1Y1BA 3VDUA 1N13A 1OYVI 5JHWC 2GKTI 2QQ0A 1VDDA 1UVFA 5CCMA 1IY5A 2RIJA 2SGQI 1WGCA 1R79A 3BJIA 5J8FA 2ROWA 2X3TA 1MT1A 1Q9BA 2ORWA 4B6DA 2NU4I 1M8BA 1Z2IA 2V53A 3FSYA 5CCLA 1PJUA 4A24A 2SGFI 3OXLA 1BMOA 3KY9A 2KMQA 3UOEA 2QPOA 2XRCA 1NUBA 4HGUA 1H0ZA 2L8EA 1DS2I 2LEOA 2UZ3A 4L9MA 3GOXA 2OVOA 2FNFX 1TOTA 1CT2I 1OMTA 2E5RA 1HJAI 3RU0A 2ELIA 1PTRA 2KMOA 2PQ8A 4E1PA 2ENZA 2L7XA 2JA1A 2WGCA 1UHAA 3R5DA 1SGPI 2GIVA 1AN1I 1HEVA 5HI7A 3FC3A 2ORVA 1XBTA 1HPTA 3D00A 2CWGA 1YU6C 4UXHA 2ARPF 3UGIA 1UUCA 1W4RA 2QQCA 1ULMA 2NU2I 4UXJA 1FAQA 1LR7A 1MJAA 2BUSA 2F3CI 2KMRA 2Y0MA 2N1AB 4JCVE 3TJQA 1MJBA 3TOAA 3TOBA 2P6AC 3QTLD 2ENNA 1TIHA 2OD1A 3OL0A 4UXIA 1CE3A 5E3QA 1CGJI 1V1HA 1UVGA 1LR9A 1R0RI 1W3SA 2SGDI 2W0TA 3OXFA 1V1IA 1PCEA 3UEJA 7WGAA 3UGDA 2NU3I 2X52A 3R5CA 1K7TA 1P9GA 1SGNI 2CJSC 2J87A 4MPIA 3UGLA 1X4SA 1M8CA 2NU0I 5FUXA 1WKXA 1CSOI 3SEKC 1KBEA 2VRWB 1LR8A
chains in the Genus database with same CATH topology
2KCXA 1BUSA 1HDLA 3PDNA 4GI3C 2N71A 1TUSA 2GVIA 1CT0I 2A20A 2YQPA 1PTQA 5FUYA 4FKDA 2E73A 1TBQR 1YTPA 1SGRI 2JW6A 2JYYA 3E59A 1Z7KB 3QWPA 1FARA 5FUWA 4SGBI 2N52A 3HH2C 1U5KA 1XX6A 3UEYA 1Y1CA 5FUVA 3SGQI 1SGEI 1TBRR 4E1RA 2NU1I 2GKRI 2WCYA 1OVOA 2KMPA 3UFFA 1RFHA 3OVOA 1SGDI 1DS3I 1CHOI 1CGII 1KMAA 1X74A 1TBNA 3VE5A 2SGPI 2V1CA 2ERWA 2QQDA 3E2IA 2JXDA 2SGEI 3B4VC 3OXGA 1OMUA 2YUUA 5DAEA 2QQEA 5EX0A 1KBFA 1PPFI 2B0UC 2J9RA 1Y8FA 3VDPA 2WVJA 1CT4I 1IW4A 2B8TA 2DB6A 3SGBI 1SGYI 2M5XA 1TBOA 1SGQI 2LUYA 1FYBA 3CXLA 2JZMA 3MEKA 5EX3A 5HQ8A 2N17A 2DIPA 2ODDA 2V1CC 2GKVA 2K9HA 1TGSI 1TURA 4OVOA 1XA6A 1IY6A 1Y1BA 3VDUA 1N13A 1OYVI 5JHWC 2GKTI 2QQ0A 1VDDA 1UVFA 5CCMA 1IY5A 2SGQI 1R79A 3BJIA 2ROWA 1MT1A 2ORWA 4B6DA 2NU4I 1M8BA 2V53A 5CCLA 1PJUA 4A24A 2SGFI 3OXLA 1BMOA 3KY9A 2KMQA 2QPOA 2XRCA 1NUBA 4HGUA 1H0ZA 2L8EA 1DS2I 2LEOA 2UZ3A 4L9MA 3GOXA 2OVOA 2FNFX 1TOTA 1CT2I 1OMTA 2E5RA 1HJAI 3RU0A 2ELIA 1PTRA 2KMOA 4E1PA 2ENZA 2L7XA 2JA1A 1SGPI 1AN1I 5HI7A 3FC3A 2ORVA 1XBTA 1HPTA 3D00A 1YU6C 4UXHA 2ARPF 3UGIA 1UUCA 1W4RA 2QQCA 2NU2I 4UXJA 1FAQA 1LR7A 2BUSA 2F3CI 2KMRA 2N1AB 4JCVE 3TJQA 2P6AC 3QTLD 2ENNA 1TIHA 2OD1A 3OL0A 4UXIA 1CE3A 1CGJI 1V1HA 1UVGA 1LR9A 1R0RI 1W3SA 2SGDI 2W0TA 3OXFA 1V1IA 1PCEA 3UEJA 3UGDA 2NU3I 1SGNI 2CJSC 2J87A 3UGLA 1X4SA 1M8CA 2NU0I 5FUXA 1CSOI 3SEKC 1KBEA 2VRWB 1LR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCX A;  1BUS A;  1HDL A;  4GI3 C;  2N71 A;  1TUS A;  1CT0 I;  1TBQ R;  1YTP A;  1SGR I;  2JYY A;  1Z7K B;  4SGB I;  2N52 A;  3HH2 C;  1Y1C A;  3SGQ I;  1SGE I;  1TBR R;  2NU1 I;  2GKR I;  2WCY A;  1OVO A;  2KMP A;  3OVO A;  1LR8 A;  1SGD I;  1DS3 I;  1CHO I;  1CGI I;  1KMA A;  2SGP I;  2ERW A;  2QQD A;  2JXD A;  2SGE I;  3B4V C;  1OMU A;  5DAE A;  1PPF I;  2B0U C;  1CT4 I;  1IW4 A;  3SGB I;  1SGY I;  2M5X A;  1SGQ I;  1FYB A;  2JZM A;  2N17 A;  2GKV A;  1TGS I;  1TUR A;  4OVO A;  1IY6 A;  1Y1B A;  1N13 A;  1OYV I;  5JHW C;  2GKT I;  1UVF A;  1IY5 A;  2SGQ I;  1MT1 A;  2NU4 I;  1M8B A;  2V53 A;  1PJU A;  2SGF I;  1BMO A;  2KMQ A;  2XRC A;  1NUB A;  4HGU A;  1H0Z A;  1DS2 I;  2LEO A;  2OVO A;  1CT2 I;  1OMT A;  1HJA I;  2KMO A;  1SGP I;  1AN1 I;  1HPT A;  1YU6 C;  2ARP F;  1UUC A;  2QQC A;  2NU2 I;  1LR7 A;  2BUS A;  2F3C I;  2KMR A;  3TJQ A;  2P6A C;  3QTL D;  1TIH A;  1CE3 A;  1CGJ I;  1UVG A;  1LR9 A;  1R0R I;  2SGD I;  1PCE A;  2NU3 I;  1SGN I;  1M8C A;  1CSO I;  3SEK C;  2NU0 I; 
#chains in the Genus database with same CATH topology
 2KCX A;  2DKV A;  1BUS A;  1HDL A;  1ULK A;  3PDN A;  4GI3 C;  2N71 A;  1TUS A;  2GVI A;  1CT0 I;  2A20 A;  2YQP A;  1PTQ A;  5FUY A;  4FKD A;  4AML A;  2E73 A;  5E3P A;  1TBQ R;  1FY7 A;  2CWF A;  1YTP A;  2RC4 A;  1SGR I;  2JW6 A;  2JYY A;  3E59 A;  1Z7K B;  3R5A A;  3QWP A;  2OU2 A;  1FAR A;  5FUW A;  1S20 A;  4SGB I;  2N52 A;  4WP4 A;  3HH2 C;  1U5K A;  1XX6 A;  3UEY A;  1Y1C A;  2OZU A;  3FSX A;  5FUV A;  1SGE I;  1TBR R;  3SGQ I;  2NU1 I;  2GKR I;  2WCY A;  4E1R A;  1OVO A;  2KMP A;  3UFF A;  1RFH A;  3OVO A;  1SGD I;  1DS3 I;  1CHO I;  1CGI I;  1KMA A;  1X74 A;  1TBN A;  2LB7 A;  3VE5 A;  2SGP I;  2V1C A;  2ERW A;  5J8C A;  2UVO A;  2QQD A;  1K7U A;  3E2I A;  3TO6 A;  2JXD A;  2SGE I;  3B4V C;  3OXG A;  1OMU A;  1NXU A;  2YUU A;  2QQE A;  5DAE A;  5EX0 A;  1K7V A;  1PPF I;  2B0U C;  2J9R A;  1Y8F A;  5E3R A;  1KBF A;  3VDP A;  2WVJ A;  1CT4 I;  3TO7 A;  9WGA A;  1IW4 A;  2B8T A;  2DB6 A;  3SGB I;  1SGY I;  2CWH A;  2M5X A;  1TBO A;  1SGQ I;  2LUY A;  3QAH A;  3R5B A;  3CXL A;  1FYB A;  1ULN A;  1WGT A;  2JZM A;  1P9Z A;  3MEK A;  4DNC A;  5EX3 A;  5HQ8 A;  3TO9 A;  2N17 A;  2DIP A;  2ODD A;  2V1C C;  1MJ9 A;  2GKV A;  2K9H A;  1TGS I;  1TUR A;  4OVO A;  1XA6 A;  1IY6 A;  1WTJ A;  1Y1B A;  3VDU A;  1N13 A;  1OYV I;  5JHW C;  2GKT I;  2QQ0 A;  1VDD A;  1UVF A;  5CCM A;  1IY5 A;  2RIJ A;  2SGQ I;  1WGC A;  1R79 A;  3BJI A;  5J8F A;  2ROW A;  2X3T A;  1MT1 A;  1Q9B A;  2ORW A;  4B6D A;  2NU4 I;  1M8B A;  1Z2I A;  2V53 A;  3FSY A;  5CCL A;  1PJU A;  4A24 A;  2SGF I;  3OXL A;  1BMO A;  3KY9 A;  2KMQ A;  3UOE A;  2QPO A;  2XRC A;  1NUB A;  4HGU A;  1H0Z A;  2L8E A;  1DS2 I;  2LEO A;  2UZ3 A;  4L9M A;  3GOX A;  2OVO A;  2FNF X;  1TOT A;  1CT2 I;  1OMT A;  2E5R A;  1HJA I;  3RU0 A;  2ELI A;  1PTR A;  2KMO A;  2PQ8 A;  4E1P A;  2ENZ A;  2L7X A;  2JA1 A;  2WGC A;  1UHA A;  3R5D A;  1SGP I;  2GIV A;  1AN1 I;  1HEV A;  5HI7 A;  3FC3 A;  2ORV A;  1XBT A;  1HPT A;  3D00 A;  2CWG A;  1YU6 C;  4UXH A;  2ARP F;  3UGI A;  1UUC A;  1W4R A;  2QQC A;  1ULM A;  2NU2 I;  4UXJ A;  1FAQ A;  1LR7 A;  1MJA A;  2BUS A;  2F3C I;  2KMR A;  2Y0M A;  2N1A B;  4JCV E;  3TJQ A;  1MJB A;  3TOA A;  3TOB A;  2P6A C;  3QTL D;  2ENN A;  1TIH A;  2OD1 A;  3OL0 A;  4UXI A;  1CE3 A;  5E3Q A;  1CGJ I;  1V1H A;  1UVG A;  1LR9 A;  1R0R I;  1W3S A;  2SGD I;  2W0T A;  3OXF A;  1V1I A;  1PCE A;  3UEJ A;  7WGA A;  3UGD A;  2NU3 I;  2X52 A;  3R5C A;  1K7T A;  1P9G A;  1SGN I;  2CJS C;  2J87 A;  4MPI A;  3UGL A;  1X4S A;  1M8C A;  2NU0 I;  5FUX A;  1WKX A;  1CSO I;  3SEK C;  1KBE A;  2VRW B;  1LR8 A; 
#chains in the Genus database with same CATH homology
 2KCX A;  1BUS A;  1HDL A;  3PDN A;  4GI3 C;  2N71 A;  1TUS A;  2GVI A;  1CT0 I;  2A20 A;  2YQP A;  1PTQ A;  5FUY A;  4FKD A;  2E73 A;  1TBQ R;  1YTP A;  1SGR I;  2JW6 A;  2JYY A;  3E59 A;  1Z7K B;  3QWP A;  1FAR A;  5FUW A;  4SGB I;  2N52 A;  3HH2 C;  1U5K A;  1XX6 A;  3UEY A;  1Y1C A;  5FUV A;  3SGQ I;  1SGE I;  1TBR R;  4E1R A;  2NU1 I;  2GKR I;  2WCY A;  1OVO A;  2KMP A;  3UFF A;  1RFH A;  3OVO A;  1SGD I;  1DS3 I;  1CHO I;  1CGI I;  1KMA A;  1X74 A;  1TBN A;  3VE5 A;  2SGP I;  2V1C A;  2ERW A;  2QQD A;  3E2I A;  2JXD A;  2SGE I;  3B4V C;  3OXG A;  1OMU A;  2YUU A;  5DAE A;  2QQE A;  5EX0 A;  1KBF A;  1PPF I;  2B0U C;  2J9R A;  1Y8F A;  3VDP A;  2WVJ A;  1CT4 I;  1IW4 A;  2B8T A;  2DB6 A;  3SGB I;  1SGY I;  2M5X A;  1TBO A;  1SGQ I;  2LUY A;  1FYB A;  3CXL A;  2JZM A;  3MEK A;  5EX3 A;  5HQ8 A;  2N17 A;  2DIP A;  2ODD A;  2V1C C;  2GKV A;  2K9H A;  1TGS I;  1TUR A;  4OVO A;  1XA6 A;  1IY6 A;  1Y1B A;  3VDU A;  1N13 A;  1OYV I;  5JHW C;  2GKT I;  2QQ0 A;  1VDD A;  1UVF A;  5CCM A;  1IY5 A;  2SGQ I;  1R79 A;  3BJI A;  2ROW A;  1MT1 A;  2ORW A;  4B6D A;  2NU4 I;  1M8B A;  2V53 A;  5CCL A;  1PJU A;  4A24 A;  2SGF I;  3OXL A;  1BMO A;  3KY9 A;  2KMQ A;  2QPO A;  2XRC A;  1NUB A;  4HGU A;  1H0Z A;  2L8E A;  1DS2 I;  2LEO A;  2UZ3 A;  4L9M A;  3GOX A;  2OVO A;  2FNF X;  1TOT A;  1CT2 I;  1OMT A;  2E5R A;  1HJA I;  3RU0 A;  2ELI A;  1PTR A;  2KMO A;  4E1P A;  2ENZ A;  2L7X A;  2JA1 A;  1SGP I;  1AN1 I;  5HI7 A;  3FC3 A;  2ORV A;  1XBT A;  1HPT A;  3D00 A;  1YU6 C;  4UXH A;  2ARP F;  3UGI A;  1UUC A;  1W4R A;  2QQC A;  2NU2 I;  4UXJ A;  1FAQ A;  1LR7 A;  2BUS A;  2F3C I;  2KMR A;  2N1A B;  4JCV E;  3TJQ A;  2P6A C;  3QTL D;  2ENN A;  1TIH A;  2OD1 A;  3OL0 A;  4UXI A;  1CE3 A;  1CGJ I;  1V1H A;  1UVG A;  1LR9 A;  1R0R I;  1W3S A;  2SGD I;  2W0T A;  3OXF A;  1V1I A;  1PCE A;  3UEJ A;  3UGD A;  2NU3 I;  1SGN I;  2CJS C;  2J87 A;  3UGL A;  1X4S A;  1M8C A;  2NU0 I;  5FUX A;  1CSO I;  3SEK C;  1KBE A;  2VRW B;  1LR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...