2OD1A

Solution structure of the mynd domain from human aml1-eto
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
50
structure length
50
Chain Sequence
DSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein CBFA2T1
publication title Structural basis for recognition of SMRT/N-CoR by the MYND domain and its contribution to AML1/ETO's activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 6
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.180 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2od1A00
5CCLA 3RU0A 5HQ8A 3OXGA 2JW6A 2ODDA 3QWPA 5EX0A 5HI7A 3OXLA 5CCMA 3OXFA 2OD1A 5EX3A 4A24A 3PDNA 3MEKA
chains in the Genus database with same CATH superfamily
2QQ0A 4L9MA 1PJUA 2WGCA 5E3QA 1BMOA 2JW6A 2N17A 1MJBA 2WCYA 2ENNA 3UEYA 3TOAA 4DNCA 2SGEI 4UXHA 4E1PA 5HQ8A 3QTLD 3TO9A 2ARPF 3R5BA 2L7XA 5J8CA 2NU1I 4WP4A 2OZUA 2X3TA 4SGBI 3UGDA 1WTJA 2VRWB 3UEJA 5CCMA 1U5KA 1LR8A 1IW4A 1OMTA 2KMRA 1HDLA 2ENZA 3FSXA 2LB7A 1WKXA 2RIJA 3OL0A 1HPTA 1FARA 1UVFA 2GVIA 1Z2IA 5HI7A 1PPFI 3E2IA 1CSOI 1PCEA 1R0RI 1FYBA 3E59A 2XRCA 2QPOA 1Q9BA 1MJAA 1FAQA 1OYVI 1FY7A 2JZMA 1BUSA 3KY9A 1CT2I 3SGBI 1OMUA 1TBNA 1UUCA 2B0UC 1SGPI 1ULKA 2LUYA 2X52A 1TGSI 3R5DA 1R79A 3PDNA 2NU2I 1X4SA 2A20A 3QWPA 5EX0A 4E1RA 2N1AB 5FUXA 1SGYI 1XA6A 1CT4I 4AMLA 2OD1A 4A24A 3R5AA 3MEKA 2UZ3A 1CGJI 3RU0A 1TOTA 1K7UA 1AN1I 1ULNA 4GI3C 3OXLA 1MJ9A 2YUUA 1TBOA 1Z7KB 1HJAI 3FC3A 1KBEA 2NU4I 2BUSA 4MPIA 2FNFX 1W3SA 2E73A 2YQPA 3TJQA 3D00A 2QQEA 2SGPI 1YTPA 4UXIA 1M8CA 2KCXA 3SEKC 1UVGA 1SGQI 1W4RA 2CWHA 2N71A 2ORVA 2V1CA 2PQ8A 2K9HA 4UXJA 2OU2A 5FUVA 1TUSA 7WGAA 2SGFI 3UFFA 2KMPA 2DIPA 1S20A 1NUBA 2Y0MA 1NXUA 2QQCA 3TO6A 1M8BA 2KMOA 1CT0I 3R5CA 5E3PA 3BJIA 1K7VA 1TBRR 1WGCA 1KMAA 1TURA 4FKDA 2WVJA 1K7TA 3QAHA 4B6DA 1DS2I 3B4VC 3OXGA 3VE5A 1XX6A 1MT1A 1TIHA 1ULMA 1Y8FA 2QQDA 3TOBA 1IY5A 2V1CC 1CE3A 1UHAA 2JXDA 2CJSC 2UVOA 1Y1CA 3HH2C 1N13A 2B8TA 2DB6A 1HEVA 2W0TA 2DKVA 2NU0I 3OVOA 3TO7A 3UGIA 1X74A 5CCLA 2L8EA 1PTQA 1SGEI 2ROWA 1DS3I 1V1HA 2RC4A 1KBFA 2GKRI 2F3CI 2ORWA 2LEOA 5EX3A 3UOEA 3VDPA 1V1IA 1LR9A 2GKTI 1P9GA 3GOXA 1YU6C 1CHOI 2V53A 1H0ZA 1LR7A 2GKVA 2JA1A 5FUYA 1Y1BA 4JCVE 1PTRA 5DAEA 1P9ZA 3CXLA 5FUWA 2SGQI 5E3RA 1CGII 1SGDI 2CWGA 3UGLA 4HGUA 3FSYA 5J8FA 2ELIA 2KMQA 2P6AC 1XBTA 1RFHA 2ODDA 1SGRI 1WGTA 1TBQR 1VDDA 3SGQI 1OVOA 2M5XA 4OVOA 3VDUA 2J9RA 2CWFA 2GIVA 2N52A 2OVOA 5JHWC 2E5RA 1IY6A 2J87A 9WGAA 2JYYA 1SGNI 2NU3I 3OXFA 2ERWA 2SGDI
chains in the Genus database with same CATH topology
2QQ0A 4L9MA 1PJUA 1BMOA 2JW6A 2N17A 2WCYA 2ENNA 3UEYA 2SGEI 4UXHA 4E1PA 5HQ8A 3QTLD 2ARPF 2L7XA 2NU1I 3UGDA 4SGBI 2VRWB 3UEJA 5CCMA 1U5KA 1LR8A 1OMTA 2KMRA 1HDLA 2ENZA 3OL0A 1HPTA 1FARA 1UVFA 2GVIA 5HI7A 1PPFI 3E2IA 1CSOI 1PCEA 1R0RI 1FYBA 3E59A 2XRCA 2QPOA 1FAQA 1OYVI 2JZMA 1BUSA 1IW4A 3KY9A 1CT2I 3SGBI 1OMUA 1TBNA 1UUCA 2B0UC 1SGPI 2LUYA 1TGSI 1R79A 3PDNA 2NU2I 1X4SA 2A20A 3QWPA 5EX0A 4E1RA 2N1AB 5FUXA 1SGYI 1XA6A 1CT4I 2OD1A 4A24A 3MEKA 2UZ3A 1CGJI 3RU0A 1TOTA 1AN1I 4GI3C 3OXLA 2YUUA 1TBOA 1Z7KB 1HJAI 3FC3A 1KBEA 2NU4I 2BUSA 2FNFX 1W3SA 2E73A 2YQPA 3TJQA 3D00A 2QQEA 2SGPI 1YTPA 4UXIA 1M8CA 2KCXA 3SEKC 1UVGA 1SGQI 1W4RA 2N71A 2V1CA 2ORVA 4UXJA 2K9HA 5FUVA 1TUSA 2SGFI 3UFFA 2KMPA 2DIPA 1NUBA 2QQCA 1M8BA 2KMOA 1CT0I 3BJIA 1TBRR 1KMAA 1TURA 4FKDA 2WVJA 4B6DA 1DS2I 3B4VC 3OXGA 3VE5A 1XX6A 1MT1A 1TIHA 1Y8FA 2QQDA 1IY5A 2V1CC 1CE3A 2JXDA 2CJSC 1Y1CA 3HH2C 1N13A 2B8TA 2DB6A 2W0TA 2NU0I 3OVOA 3UGIA 1X74A 5CCLA 2L8EA 1PTQA 1SGEI 2ROWA 1DS3I 1V1HA 1KBFA 2GKRI 2F3CI 2ORWA 2LEOA 5EX3A 3VDPA 1V1IA 1LR9A 2GKTI 3GOXA 1YU6C 1CHOI 2V53A 1H0ZA 1LR7A 2GKVA 2JA1A 5FUYA 1Y1BA 4JCVE 1PTRA 5DAEA 3CXLA 5FUWA 2SGQI 1CGII 1SGDI 3UGLA 4HGUA 2ELIA 2KMQA 2P6AC 1XBTA 1RFHA 2ODDA 1SGRI 1TBQR 1VDDA 3SGQI 1OVOA 2M5XA 4OVOA 3VDUA 2J9RA 2N52A 2OVOA 5JHWC 1IY6A 2E5RA 2J87A 2JYYA 1SGNI 2NU3I 3OXFA 2ERWA 2SGDI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCL A;  3RU0 A;  5HQ8 A;  3OXG A;  2JW6 A;  2ODD A;  3QWP A;  5EX0 A;  5HI7 A;  3OXL A;  5CCM A;  3OXF A;  2OD1 A;  5EX3 A;  4A24 A;  3PDN A;  3MEK A; 
#chains in the Genus database with same CATH topology
 2QQ0 A;  4L9M A;  1PJU A;  2WGC A;  5E3Q A;  1BMO A;  2JW6 A;  2N17 A;  1MJB A;  2WCY A;  2ENN A;  3UEY A;  3TOA A;  4DNC A;  2SGE I;  4UXH A;  4E1P A;  5HQ8 A;  3QTL D;  3TO9 A;  2ARP F;  3R5B A;  2L7X A;  5J8C A;  2NU1 I;  4WP4 A;  2OZU A;  2X3T A;  4SGB I;  3UGD A;  1WTJ A;  2VRW B;  3UEJ A;  5CCM A;  1U5K A;  1LR8 A;  1IW4 A;  1OMT A;  2KMR A;  1HDL A;  2ENZ A;  3FSX A;  2LB7 A;  1WKX A;  2RIJ A;  3OL0 A;  1HPT A;  1FAR A;  1UVF A;  2GVI A;  1Z2I A;  5HI7 A;  1PPF I;  3E2I A;  1CSO I;  1PCE A;  1R0R I;  1FYB A;  3E59 A;  2XRC A;  2QPO A;  1Q9B A;  1MJA A;  1FAQ A;  1OYV I;  1FY7 A;  2JZM A;  1BUS A;  3KY9 A;  1CT2 I;  3SGB I;  1OMU A;  1TBN A;  1UUC A;  2B0U C;  1SGP I;  1ULK A;  2LUY A;  2X52 A;  1TGS I;  3R5D A;  1R79 A;  3PDN A;  2NU2 I;  1X4S A;  2A20 A;  3QWP A;  5EX0 A;  4E1R A;  2N1A B;  5FUX A;  1SGY I;  1XA6 A;  1CT4 I;  4AML A;  2OD1 A;  4A24 A;  3R5A A;  3MEK A;  2UZ3 A;  1CGJ I;  3RU0 A;  1TOT A;  1K7U A;  1AN1 I;  1ULN A;  4GI3 C;  3OXL A;  1MJ9 A;  2YUU A;  1TBO A;  1Z7K B;  1HJA I;  3FC3 A;  1KBE A;  2NU4 I;  2BUS A;  4MPI A;  2FNF X;  1W3S A;  2E73 A;  2YQP A;  3TJQ A;  3D00 A;  2QQE A;  2SGP I;  1YTP A;  4UXI A;  1M8C A;  2KCX A;  3SEK C;  1UVG A;  1SGQ I;  1W4R A;  2CWH A;  2N71 A;  2ORV A;  2V1C A;  2PQ8 A;  2K9H A;  4UXJ A;  2OU2 A;  5FUV A;  1TUS A;  7WGA A;  2SGF I;  3UFF A;  2KMP A;  2DIP A;  1S20 A;  1NUB A;  2Y0M A;  1NXU A;  2QQC A;  3TO6 A;  1M8B A;  2KMO A;  1CT0 I;  3R5C A;  5E3P A;  3BJI A;  1K7V A;  1TBR R;  1WGC A;  1KMA A;  1TUR A;  4FKD A;  2WVJ A;  1K7T A;  3QAH A;  4B6D A;  1DS2 I;  3B4V C;  3OXG A;  3VE5 A;  1XX6 A;  1MT1 A;  1TIH A;  1ULM A;  1Y8F A;  2QQD A;  3TOB A;  1IY5 A;  2V1C C;  1CE3 A;  1UHA A;  2JXD A;  2CJS C;  2UVO A;  1Y1C A;  3HH2 C;  1N13 A;  2B8T A;  2DB6 A;  1HEV A;  2W0T A;  2DKV A;  2NU0 I;  3OVO A;  3TO7 A;  3UGI A;  1X74 A;  5CCL A;  2L8E A;  1PTQ A;  1SGE I;  2ROW A;  1DS3 I;  1V1H A;  2RC4 A;  1KBF A;  2GKR I;  2F3C I;  2ORW A;  2LEO A;  5EX3 A;  3UOE A;  3VDP A;  1V1I A;  1LR9 A;  2GKT I;  1P9G A;  3GOX A;  1YU6 C;  1CHO I;  2V53 A;  1H0Z A;  1LR7 A;  2GKV A;  2JA1 A;  5FUY A;  1Y1B A;  4JCV E;  1PTR A;  5DAE A;  1P9Z A;  3CXL A;  5FUW A;  2SGQ I;  5E3R A;  1CGI I;  1SGD I;  2CWG A;  3UGL A;  4HGU A;  3FSY A;  5J8F A;  2ELI A;  2KMQ A;  2P6A C;  1XBT A;  1RFH A;  2ODD A;  1SGR I;  1WGT A;  1TBQ R;  1VDD A;  3SGQ I;  1OVO A;  2M5X A;  4OVO A;  3VDU A;  2J9R A;  2CWF A;  2GIV A;  2N52 A;  2OVO A;  5JHW C;  2E5R A;  1IY6 A;  2J87 A;  9WGA A;  2JYY A;  1SGN I;  2NU3 I;  3OXF A;  2ERW A;  2SGD I; 
#chains in the Genus database with same CATH homology
 2QQ0 A;  4L9M A;  1PJU A;  1BMO A;  2JW6 A;  2N17 A;  2WCY A;  2ENN A;  3UEY A;  2SGE I;  4UXH A;  4E1P A;  5HQ8 A;  3QTL D;  2ARP F;  2L7X A;  2NU1 I;  3UGD A;  4SGB I;  2VRW B;  3UEJ A;  5CCM A;  1U5K A;  1LR8 A;  1OMT A;  2KMR A;  1HDL A;  2ENZ A;  3OL0 A;  1HPT A;  1FAR A;  1UVF A;  2GVI A;  5HI7 A;  1PPF I;  3E2I A;  1CSO I;  1PCE A;  1R0R I;  1FYB A;  3E59 A;  2XRC A;  2QPO A;  1FAQ A;  1OYV I;  2JZM A;  1BUS A;  1IW4 A;  3KY9 A;  1CT2 I;  3SGB I;  1OMU A;  1TBN A;  1UUC A;  2B0U C;  1SGP I;  2LUY A;  1TGS I;  1R79 A;  3PDN A;  2NU2 I;  1X4S A;  2A20 A;  3QWP A;  5EX0 A;  4E1R A;  2N1A B;  5FUX A;  1SGY I;  1XA6 A;  1CT4 I;  2OD1 A;  4A24 A;  3MEK A;  2UZ3 A;  1CGJ I;  3RU0 A;  1TOT A;  1AN1 I;  4GI3 C;  3OXL A;  2YUU A;  1TBO A;  1Z7K B;  1HJA I;  3FC3 A;  1KBE A;  2NU4 I;  2BUS A;  2FNF X;  1W3S A;  2E73 A;  2YQP A;  3TJQ A;  3D00 A;  2QQE A;  2SGP I;  1YTP A;  4UXI A;  1M8C A;  2KCX A;  3SEK C;  1UVG A;  1SGQ I;  1W4R A;  2N71 A;  2V1C A;  2ORV A;  4UXJ A;  2K9H A;  5FUV A;  1TUS A;  2SGF I;  3UFF A;  2KMP A;  2DIP A;  1NUB A;  2QQC A;  1M8B A;  2KMO A;  1CT0 I;  3BJI A;  1TBR R;  1KMA A;  1TUR A;  4FKD A;  2WVJ A;  4B6D A;  1DS2 I;  3B4V C;  3OXG A;  3VE5 A;  1XX6 A;  1MT1 A;  1TIH A;  1Y8F A;  2QQD A;  1IY5 A;  2V1C C;  1CE3 A;  2JXD A;  2CJS C;  1Y1C A;  3HH2 C;  1N13 A;  2B8T A;  2DB6 A;  2W0T A;  2NU0 I;  3OVO A;  3UGI A;  1X74 A;  5CCL A;  2L8E A;  1PTQ A;  1SGE I;  2ROW A;  1DS3 I;  1V1H A;  1KBF A;  2GKR I;  2F3C I;  2ORW A;  2LEO A;  5EX3 A;  3VDP A;  1V1I A;  1LR9 A;  2GKT I;  3GOX A;  1YU6 C;  1CHO I;  2V53 A;  1H0Z A;  1LR7 A;  2GKV A;  2JA1 A;  5FUY A;  1Y1B A;  4JCV E;  1PTR A;  5DAE A;  3CXL A;  5FUW A;  2SGQ I;  1CGI I;  1SGD I;  3UGL A;  4HGU A;  2ELI A;  2KMQ A;  2P6A C;  1XBT A;  1RFH A;  2ODD A;  1SGR I;  1TBQ R;  1VDD A;  3SGQ I;  1OVO A;  2M5X A;  4OVO A;  3VDU A;  2J9R A;  2N52 A;  2OVO A;  5JHW C;  1IY6 A;  2E5R A;  2J87 A;  2JYY A;  1SGN I;  2NU3 I;  3OXF A;  2ERW A;  2SGD I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...