2OD1A

Solution structure of the mynd domain from human aml1-eto
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
50
structure length
50
Chain Sequence
DSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Protein CBFA2T1
publication title Structural basis for recognition of SMRT/N-CoR by the MYND domain and its contribution to AML1/ETO's activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.180 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2od1A00
3QWPA 3OXFA 5CCLA 3OXLA 3OXGA 3RU0A 3MEKA 3PDNA 5EX3A 5HQ8A 5HI7A 2OD1A 5EX0A 5CCMA 2ODDA 4A24A 2JW6A
chains in the Genus database with same CATH superfamily
1K7UA 2SGDI 3TO9A 3VDPA 2K9HA 2J9RA 2GKVA 3R5AA 1KBEA 4UXIA 1TBOA 5FUVA 1PTRA 1U5KA 1R79A 1TBRR 2E73A 2JXDA 3R5DA 1ULMA 2DIPA 2B8TA 1TURA 3HH2C 1M8CA 2N52A 1KMAA 1K7TA 1DS3I 1V1IA 2N1AB 5HQ8A 1XA6A 4FKDA 1TUSA 4GI3C 1TBNA 3OXLA 1PCEA 1BMOA 1Z2IA 2JZMA 1SGEI 2QPOA 5HI7A 1CGII 1OMTA 1XBTA 2M5XA 1PJUA 5CCLA 2W0TA 4MPIA 1X4SA 1CT2I 1P9GA 1H0ZA 1TGSI 5FUYA 3MEKA 1FAQA 1FYBA 3FSXA 2JYYA 1TOTA 5DAEA 2X3TA 1CSOI 1ULNA 2ELIA 1ULKA 2V1CC 3SGBI 3UFFA 1LR9A 1FARA 1CHOI 1SGRI 1W4RA 2GKRI 2GVIA 1HJAI 1TBQR 2V1CA 1Y1CA 1OVOA 5EX3A 2CWFA 3FSYA 4UXJA 3TOAA 4SGBI 3QTLD 1Y1BA 1CT4I 2SGEI 1SGYI 2P6AC 1UHAA 2QQ0A 1YU6C 2CJSC 4L9MA 1HEVA 3UOEA 1YTPA 3UGDA 1UVGA 1SGQI 2L7XA 2XRCA 2X52A 2ENNA 4AMLA 9WGAA 2KMRA 1IY6A 3UGLA 5E3PA 2L8EA 1FY7A 2PQ8A 3SEKC 2N71A 3R5CA 4UXHA 4A24A 2OVOA 1K7VA 1UUCA 3UEYA 1DS2I 3OL0A 1SGPI 3OVOA 3PDNA 4E1RA 2ENZA 1IY5A 2BUSA 2RIJA 3SGQI 3E2IA 2QQDA 3KY9A 2N17A 1CT0I 2LUYA 2NU4I 2QQCA 4JCVE 5FUWA 1MJBA 2SGFI 1Y8FA 2SGQI 3B4VC 3QWPA 1R0RI 4WP4A 2WCYA 1W3SA 3VDUA 1AN1I 1WTJA 3OXGA 1IW4A 3E59A 1OYVI 2KMOA 1WKXA 2ERWA 2FNFX 1KBFA 1Z7KB 2KMPA 5CCMA 5JHWC 2J87A 2JW6A 2V53A 1MJAA 4DNCA 1N13A 2QQEA 1HDLA 3GOXA 1VDDA 1X74A 2NU2I 1MJ9A 2GIVA 2LEOA 4B6DA 1CE3A 3R5BA 2ORWA 2NU1I 2SGPI 1Q9BA 1TIHA 5E3QA 4E1PA 1LR8A 4HGUA 1RFHA 1SGNI 2VRWB 1P9ZA 1M8BA 3TJQA 2JA1A 3RU0A 1UVFA 1WGCA 2E5RA 3TO7A 2UVOA 3VE5A 5EX0A 2ROWA 2OZUA 2NU0I 2GKTI 1BUSA 2CWHA 5J8FA 2B0UC 2WGCA 1PTQA 4OVOA 1MT1A 2RC4A 2Y0MA 2YUUA 3TO6A 1S20A 2F3CI 2YQPA 5E3RA 3FC3A 2DKVA 1PPFI 3QAHA 2A20A 3CXLA 3UEJA 3UGIA 3BJIA 7WGAA 1WGTA 2DB6A 2KCXA 5FUXA 1NXUA 5J8CA 1NUBA 2CWGA 1LR7A 2LB7A 2ARPF 3OXFA 2OU2A 1OMUA 3TOBA 1V1HA 2KMQA 1XX6A 1HPTA 2ORVA 2UZ3A 2NU3I 3D00A 2OD1A 1SGDI 1CGJI 2ODDA 2WVJA
chains in the Genus database with same CATH topology
2SGDI 3VDPA 2K9HA 2J9RA 2GKVA 4UXIA 1KBEA 1TBOA 5FUVA 1PTRA 1U5KA 1R79A 1TBRR 2E73A 2JXDA 2DIPA 2B8TA 1TURA 3HH2C 1M8CA 2N52A 1KMAA 1DS3I 1V1IA 2N1AB 5HQ8A 1XA6A 4FKDA 1TUSA 4GI3C 1TBNA 3OXLA 1PCEA 1BMOA 2JZMA 1SGEI 2QPOA 5HI7A 1CGII 1OMTA 1XBTA 2M5XA 1PJUA 5CCLA 2W0TA 1X4SA 1CT2I 1H0ZA 1TGSI 5FUYA 3MEKA 1FAQA 1FYBA 2JYYA 1TOTA 5DAEA 1CSOI 2ELIA 2V1CC 3SGBI 3UFFA 1LR9A 1FARA 1CHOI 1SGRI 1W4RA 2GKRI 2GVIA 1HJAI 1TBQR 2V1CA 1Y1CA 1OVOA 5EX3A 4UXJA 4SGBI 3QTLD 1Y1BA 1CT4I 2SGEI 1SGYI 2P6AC 2QQ0A 1YU6C 2CJSC 4L9MA 1YTPA 3UGDA 1UVGA 1SGQI 2L7XA 2XRCA 2ENNA 2KMRA 1IY6A 3UGLA 2L8EA 3SEKC 2N71A 4UXHA 4A24A 2OVOA 1UUCA 3UEYA 1DS2I 3OL0A 1SGPI 3OVOA 3PDNA 4E1RA 2ENZA 1IY5A 2BUSA 3SGQI 3E2IA 2QQDA 3KY9A 2N17A 1CT0I 2LUYA 2NU4I 2QQCA 4JCVE 5FUWA 2SGFI 1Y8FA 2SGQI 3B4VC 3QWPA 1R0RI 2WCYA 1W3SA 3VDUA 1AN1I 3OXGA 3E59A 1OYVI 2KMOA 2ERWA 1KBFA 2FNFX 1Z7KB 2KMPA 5CCMA 5JHWC 2J87A 2JW6A 2V53A 1N13A 2QQEA 1HDLA 3GOXA 1VDDA 1X74A 2NU2I 2LEOA 4B6DA 1CE3A 2ORWA 2NU1I 2SGPI 1TIHA 4E1PA 1LR8A 4HGUA 1RFHA 1SGNI 2VRWB 1M8BA 3TJQA 2JA1A 3RU0A 1UVFA 2E5RA 3VE5A 1IW4A 5EX0A 2ROWA 2NU0I 2GKTI 1BUSA 2B0UC 4OVOA 1PTQA 1MT1A 2YUUA 2F3CI 2YQPA 3FC3A 1PPFI 2A20A 3CXLA 3UEJA 3UGIA 3BJIA 2DB6A 2KCXA 5FUXA 1NUBA 1LR7A 2ARPF 3OXFA 1OMUA 1V1HA 2KMQA 1XX6A 1HPTA 2ORVA 2UZ3A 2NU3I 3D00A 2OD1A 1SGDI 1CGJI 2ODDA 2WVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWP A;  3OXF A;  5CCL A;  3OXL A;  3OXG A;  3RU0 A;  3MEK A;  3PDN A;  5EX3 A;  5HQ8 A;  5HI7 A;  2OD1 A;  5EX0 A;  5CCM A;  2ODD A;  4A24 A;  2JW6 A; 
#chains in the Genus database with same CATH topology
 1K7U A;  2SGD I;  3TO9 A;  3VDP A;  2K9H A;  2J9R A;  2GKV A;  3R5A A;  1KBE A;  4UXI A;  1TBO A;  5FUV A;  1PTR A;  1U5K A;  1R79 A;  1TBR R;  2E73 A;  2JXD A;  3R5D A;  1ULM A;  2DIP A;  2B8T A;  1TUR A;  3HH2 C;  1M8C A;  2N52 A;  1KMA A;  1K7T A;  1DS3 I;  1V1I A;  2N1A B;  5HQ8 A;  1XA6 A;  4FKD A;  1TUS A;  4GI3 C;  1TBN A;  3OXL A;  1PCE A;  1BMO A;  1Z2I A;  2JZM A;  1SGE I;  2QPO A;  5HI7 A;  1CGI I;  1OMT A;  1XBT A;  2M5X A;  1PJU A;  5CCL A;  2W0T A;  4MPI A;  1X4S A;  1CT2 I;  1P9G A;  1H0Z A;  1TGS I;  5FUY A;  3MEK A;  1FAQ A;  1FYB A;  3FSX A;  2JYY A;  1TOT A;  5DAE A;  2X3T A;  1CSO I;  1ULN A;  2ELI A;  1ULK A;  2V1C C;  3SGB I;  3UFF A;  1LR9 A;  1FAR A;  1CHO I;  1SGR I;  1W4R A;  2GKR I;  2GVI A;  1HJA I;  1TBQ R;  2V1C A;  1Y1C A;  1OVO A;  5EX3 A;  2CWF A;  3FSY A;  4UXJ A;  3TOA A;  4SGB I;  3QTL D;  1Y1B A;  1CT4 I;  2SGE I;  1SGY I;  2P6A C;  1UHA A;  2QQ0 A;  1YU6 C;  2CJS C;  4L9M A;  1HEV A;  3UOE A;  1YTP A;  3UGD A;  1UVG A;  1SGQ I;  2L7X A;  2XRC A;  2X52 A;  2ENN A;  4AML A;  9WGA A;  2KMR A;  1IY6 A;  3UGL A;  5E3P A;  2L8E A;  1FY7 A;  2PQ8 A;  3SEK C;  2N71 A;  3R5C A;  4UXH A;  4A24 A;  2OVO A;  1K7V A;  1UUC A;  3UEY A;  1DS2 I;  3OL0 A;  1SGP I;  3OVO A;  3PDN A;  4E1R A;  2ENZ A;  1IY5 A;  2BUS A;  2RIJ A;  3SGQ I;  3E2I A;  2QQD A;  3KY9 A;  2N17 A;  1CT0 I;  2LUY A;  2NU4 I;  2QQC A;  4JCV E;  5FUW A;  1MJB A;  2SGF I;  1Y8F A;  2SGQ I;  3B4V C;  3QWP A;  1R0R I;  4WP4 A;  2WCY A;  1W3S A;  3VDU A;  1AN1 I;  1WTJ A;  3OXG A;  1IW4 A;  3E59 A;  1OYV I;  2KMO A;  1WKX A;  2ERW A;  2FNF X;  1KBF A;  1Z7K B;  2KMP A;  5CCM A;  5JHW C;  2J87 A;  2JW6 A;  2V53 A;  1MJA A;  4DNC A;  1N13 A;  2QQE A;  1HDL A;  3GOX A;  1VDD A;  1X74 A;  2NU2 I;  1MJ9 A;  2GIV A;  2LEO A;  4B6D A;  1CE3 A;  3R5B A;  2ORW A;  2NU1 I;  2SGP I;  1Q9B A;  1TIH A;  5E3Q A;  4E1P A;  1LR8 A;  4HGU A;  1RFH A;  1SGN I;  2VRW B;  1P9Z A;  1M8B A;  3TJQ A;  2JA1 A;  3RU0 A;  1UVF A;  1WGC A;  2E5R A;  3TO7 A;  2UVO A;  3VE5 A;  5EX0 A;  2ROW A;  2OZU A;  2NU0 I;  2GKT I;  1BUS A;  2CWH A;  5J8F A;  2B0U C;  2WGC A;  1PTQ A;  4OVO A;  1MT1 A;  2RC4 A;  2Y0M A;  2YUU A;  3TO6 A;  1S20 A;  2F3C I;  2YQP A;  5E3R A;  3FC3 A;  2DKV A;  1PPF I;  3QAH A;  2A20 A;  3CXL A;  3UEJ A;  3UGI A;  3BJI A;  7WGA A;  1WGT A;  2DB6 A;  2KCX A;  5FUX A;  1NXU A;  5J8C A;  1NUB A;  2CWG A;  1LR7 A;  2LB7 A;  2ARP F;  3OXF A;  2OU2 A;  1OMU A;  3TOB A;  1V1H A;  2KMQ A;  1XX6 A;  1HPT A;  2ORV A;  2UZ3 A;  2NU3 I;  3D00 A;  2OD1 A;  1SGD I;  1CGJ I;  2ODD A;  2WVJ A; 
#chains in the Genus database with same CATH homology
 2SGD I;  3VDP A;  2K9H A;  2J9R A;  2GKV A;  4UXI A;  1KBE A;  1TBO A;  5FUV A;  1PTR A;  1U5K A;  1R79 A;  1TBR R;  2E73 A;  2JXD A;  2DIP A;  2B8T A;  1TUR A;  3HH2 C;  1M8C A;  2N52 A;  1KMA A;  1DS3 I;  1V1I A;  2N1A B;  5HQ8 A;  1XA6 A;  4FKD A;  1TUS A;  4GI3 C;  1TBN A;  3OXL A;  1PCE A;  1BMO A;  2JZM A;  1SGE I;  2QPO A;  5HI7 A;  1CGI I;  1OMT A;  1XBT A;  2M5X A;  1PJU A;  5CCL A;  2W0T A;  1X4S A;  1CT2 I;  1H0Z A;  1TGS I;  5FUY A;  3MEK A;  1FAQ A;  1FYB A;  2JYY A;  1TOT A;  5DAE A;  1CSO I;  2ELI A;  2V1C C;  3SGB I;  3UFF A;  1LR9 A;  1FAR A;  1CHO I;  1SGR I;  1W4R A;  2GKR I;  2GVI A;  1HJA I;  1TBQ R;  2V1C A;  1Y1C A;  1OVO A;  5EX3 A;  4UXJ A;  4SGB I;  3QTL D;  1Y1B A;  1CT4 I;  2SGE I;  1SGY I;  2P6A C;  2QQ0 A;  1YU6 C;  2CJS C;  4L9M A;  1YTP A;  3UGD A;  1UVG A;  1SGQ I;  2L7X A;  2XRC A;  2ENN A;  2KMR A;  1IY6 A;  3UGL A;  2L8E A;  3SEK C;  2N71 A;  4UXH A;  4A24 A;  2OVO A;  1UUC A;  3UEY A;  1DS2 I;  3OL0 A;  1SGP I;  3OVO A;  3PDN A;  4E1R A;  2ENZ A;  1IY5 A;  2BUS A;  3SGQ I;  3E2I A;  2QQD A;  3KY9 A;  2N17 A;  1CT0 I;  2LUY A;  2NU4 I;  2QQC A;  4JCV E;  5FUW A;  2SGF I;  1Y8F A;  2SGQ I;  3B4V C;  3QWP A;  1R0R I;  2WCY A;  1W3S A;  3VDU A;  1AN1 I;  3OXG A;  3E59 A;  1OYV I;  2KMO A;  2ERW A;  1KBF A;  2FNF X;  1Z7K B;  2KMP A;  5CCM A;  5JHW C;  2J87 A;  2JW6 A;  2V53 A;  1N13 A;  2QQE A;  1HDL A;  3GOX A;  1VDD A;  1X74 A;  2NU2 I;  2LEO A;  4B6D A;  1CE3 A;  2ORW A;  2NU1 I;  2SGP I;  1TIH A;  4E1P A;  1LR8 A;  4HGU A;  1RFH A;  1SGN I;  2VRW B;  1M8B A;  3TJQ A;  2JA1 A;  3RU0 A;  1UVF A;  2E5R A;  3VE5 A;  1IW4 A;  5EX0 A;  2ROW A;  2NU0 I;  2GKT I;  1BUS A;  2B0U C;  4OVO A;  1PTQ A;  1MT1 A;  2YUU A;  2F3C I;  2YQP A;  3FC3 A;  1PPF I;  2A20 A;  3CXL A;  3UEJ A;  3UGI A;  3BJI A;  2DB6 A;  2KCX A;  5FUX A;  1NUB A;  1LR7 A;  2ARP F;  3OXF A;  1OMU A;  1V1H A;  2KMQ A;  1XX6 A;  1HPT A;  2ORV A;  2UZ3 A;  2NU3 I;  3D00 A;  2OD1 A;  1SGD I;  1CGJ I;  2ODD A;  2WVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...