1WKXA

Crystal structure of a hev b 6.02 isoallergen
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
43
structure length
43
Chain Sequence
EQCGRQAGGKLCPDNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords HEVEIN ISOFORM 2
publication title Structural and Immunological Characterization of an Isoallergen of Hev b 6.02
rcsb
total genus 13
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2004-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1wkxA00
2X52A 1WKXA 1HEVA 2LB7A 1WGCA 1ULKA 2CWGA 2UVOA 1P9GA 1P9ZA 1UHAA 1ULMA 1K7VA 2X3TA 9WGAA 2DKVA 4WP4A 7WGAA 2WGCA 1K7UA 4MPIA 1ULNA 1K7TA 1Q9BA 1WGTA 4AMLA
chains in the Genus database with same CATH superfamily
3RU0A 2CWFA 1WKXA 2K9HA 2CWHA 2LUYA 2NU2I 3OL0A 3OXLA 1KMAA 2JW6A 1W3SA 1WGCA 2JA1A 1CGJI 1TGSI 3OXGA 3R5DA 1NUBA 5E3PA 3TJQA 2DB6A 3VDPA 3D00A 2OU2A 2V1CA 2QQ0A 3E59A 3FSXA 3TOBA 4UXHA 1OYVI 2L7XA 1UVFA 1XBTA 2NU3I 2SGQI 3SEKC 1Y8FA 2GKRI 2GKVA 1TBNA 3QAHA 1PTRA 1S20A 1LR9A 1AN1I 1FARA 2N17A 5E3QA 1CHOI 3GOXA 1LR7A 1X4SA 2RIJA 1V1HA 5FUWA 2GKTI 4FKDA 2SGDI 4AMLA 2SGFI 3QTLD 1SGPI 2ERWA 2OVOA 2QPOA 2SGEI 2QQDA 2OD1A 3VE5A 1VDDA 2LB7A 1OMUA 3KY9A 1CT0I 4L9MA 2WCYA 1IW4A 2ODDA 1SGNI 2CWGA 1IY6A 5HI7A 1KBFA 3PDNA 1ULMA 2ENNA 1K7VA 1XA6A 2KMQA 3MEKA 1MT1A 1TOTA 5FUVA 3OVOA 4SGBI 2N52A 1TBQR 1SGDI 1MJBA 1UVGA 5FUYA 1BUSA 2DIPA 1M8BA 2WGCA 1YTPA 1UUCA 1Y1BA 2SGPI 3UEJA 4B6DA 1XX6A 2A20A 1ULNA 4JCVE 1V1IA 2ROWA 3CXLA 5CCLA 4E1RA 2JZMA 2LEOA 2M5XA 2QQEA 2WVJA 1CGII 4HGUA 1SGEI 1WTJA 3TO6A 1R79A 1TBRR 1MJ9A 2X52A 2KMPA 3BJIA 3UGIA 4A24A 1HPTA 5E3RA 2NU4I 3VDUA 1BMOA 1W4RA 2CJSC 1OVOA 1ULKA 1SGQI 2KMOA 2W0TA 3TO7A 5J8CA 2UZ3A 1P9GA 2ENZA 2JYYA 3E2IA 1P9ZA 5EX3A 4UXIA 1TBOA 5CCMA 1Z2IA 1KBEA 2X3TA 1YU6C 3UOEA 5J8FA 2YUUA 2Y0MA 3OXFA 1MJAA 3UFFA 3R5AA 3B4VC 3UEYA 1SGRI 2PQ8A 3TO9A 3FC3A 1M8CA 2J9RA 1HJAI 2E73A 5JHWC 2KMRA 2JXDA 2F3CI 1N13A 2P6AC 2ORVA 2V53A 4UXJA 1DS2I 1Q9BA 1PCEA 2N71A 1H0ZA 2FNFX 4OVOA 2RC4A 2VRWB 1OMTA 1DS3I 1R0RI 1CT4I 2OZUA 1FY7A 5HQ8A 1HEVA 1TIHA 3UGDA 3HH2C 1CT2I 1PJUA 3TOAA 3R5BA 1NXUA 1TUSA 2L8EA 2NU1I 2NU0I 2ORWA 2UVOA 4GI3C 1FYBA 1PTQA 2J87A 1UHAA 5DAEA 1X74A 1PPFI 3FSYA 1TURA 1RFHA 1Z7KB 2B8TA 3QWPA 2GVIA 1FAQA 2YQPA 2QQCA 9WGAA 3R5CA 1HDLA 2DKVA 2E5RA 4WP4A 4DNCA 7WGAA 3UGLA 1U5KA 1K7UA 1CE3A 2XRCA 4MPIA 3SGQI 2N1AB 5EX0A 1LR8A 5FUXA 1K7TA 2V1CC 2B0UC 1IY5A 2ARPF 2KCXA 1CSOI 1SGYI 2GIVA 3SGBI 1WGTA 1Y1CA 2BUSA 2ELIA 4E1PA
chains in the Genus database with same CATH topology
2X52A 1WKXA 1HEVA 2LB7A 1WGCA 1ULKA 2CWGA 2UVOA 1P9GA 1P9ZA 1UHAA 1ULMA 1K7VA 2X3TA 9WGAA 2DKVA 4WP4A 7WGAA 2WGCA 1K7UA 4MPIA 1ULNA 1K7TA 1Q9BA 1WGTA 4AMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X52 A;  1WKX A;  1HEV A;  2LB7 A;  1WGC A;  1ULK A;  2CWG A;  2UVO A;  1P9G A;  1P9Z A;  1UHA A;  1ULM A;  1K7V A;  2X3T A;  9WGA A;  2DKV A;  4WP4 A;  7WGA A;  2WGC A;  1K7U A;  4MPI A;  1ULN A;  1K7T A;  1Q9B A;  1WGT A;  4AML A; 
#chains in the Genus database with same CATH topology
 3RU0 A;  2CWF A;  1WKX A;  2K9H A;  2CWH A;  2LUY A;  2NU2 I;  3OL0 A;  3OXL A;  1KMA A;  2JW6 A;  1W3S A;  1WGC A;  2JA1 A;  1CGJ I;  1TGS I;  3OXG A;  3R5D A;  1NUB A;  5E3P A;  3TJQ A;  2DB6 A;  3VDP A;  3D00 A;  2OU2 A;  2V1C A;  2QQ0 A;  3E59 A;  3FSX A;  3TOB A;  4UXH A;  1OYV I;  2L7X A;  1UVF A;  1XBT A;  2NU3 I;  2SGQ I;  3SEK C;  1Y8F A;  2GKR I;  2GKV A;  1TBN A;  3QAH A;  1PTR A;  1S20 A;  1LR9 A;  1AN1 I;  1FAR A;  2N17 A;  5E3Q A;  1CHO I;  3GOX A;  1LR7 A;  1X4S A;  2RIJ A;  1V1H A;  5FUW A;  2GKT I;  4FKD A;  2SGD I;  4AML A;  2SGF I;  3QTL D;  1SGP I;  2ERW A;  2OVO A;  2QPO A;  2SGE I;  2QQD A;  2OD1 A;  3VE5 A;  1VDD A;  2LB7 A;  1OMU A;  3KY9 A;  1CT0 I;  4L9M A;  2WCY A;  1IW4 A;  2ODD A;  1SGN I;  2CWG A;  1IY6 A;  5HI7 A;  1KBF A;  3PDN A;  1ULM A;  2ENN A;  1K7V A;  1XA6 A;  2KMQ A;  3MEK A;  1MT1 A;  1TOT A;  5FUV A;  3OVO A;  4SGB I;  2N52 A;  1TBQ R;  1SGD I;  1MJB A;  1UVG A;  5FUY A;  1BUS A;  2DIP A;  1M8B A;  2WGC A;  1YTP A;  1UUC A;  1Y1B A;  2SGP I;  3UEJ A;  4B6D A;  1XX6 A;  2A20 A;  1ULN A;  4JCV E;  1V1I A;  2ROW A;  3CXL A;  5CCL A;  4E1R A;  2JZM A;  2LEO A;  2M5X A;  2QQE A;  2WVJ A;  1CGI I;  4HGU A;  1SGE I;  1WTJ A;  3TO6 A;  1R79 A;  1TBR R;  1MJ9 A;  2X52 A;  2KMP A;  3BJI A;  3UGI A;  4A24 A;  1HPT A;  5E3R A;  2NU4 I;  3VDU A;  1BMO A;  1W4R A;  2CJS C;  1OVO A;  1ULK A;  1SGQ I;  2KMO A;  2W0T A;  3TO7 A;  5J8C A;  2UZ3 A;  1P9G A;  2ENZ A;  2JYY A;  3E2I A;  1P9Z A;  5EX3 A;  4UXI A;  1TBO A;  5CCM A;  1Z2I A;  1KBE A;  2X3T A;  1YU6 C;  3UOE A;  5J8F A;  2YUU A;  2Y0M A;  3OXF A;  1MJA A;  3UFF A;  3R5A A;  3B4V C;  3UEY A;  1SGR I;  2PQ8 A;  3TO9 A;  3FC3 A;  1M8C A;  2J9R A;  1HJA I;  2E73 A;  5JHW C;  2KMR A;  2JXD A;  2F3C I;  1N13 A;  2P6A C;  2ORV A;  2V53 A;  4UXJ A;  1DS2 I;  1Q9B A;  1PCE A;  2N71 A;  1H0Z A;  2FNF X;  4OVO A;  2RC4 A;  2VRW B;  1OMT A;  1DS3 I;  1R0R I;  1CT4 I;  2OZU A;  1FY7 A;  5HQ8 A;  1HEV A;  1TIH A;  3UGD A;  3HH2 C;  1CT2 I;  1PJU A;  3TOA A;  3R5B A;  1NXU A;  1TUS A;  2L8E A;  2NU1 I;  2NU0 I;  2ORW A;  2UVO A;  4GI3 C;  1FYB A;  1PTQ A;  2J87 A;  1UHA A;  5DAE A;  1X74 A;  1PPF I;  3FSY A;  1TUR A;  1RFH A;  1Z7K B;  2B8T A;  3QWP A;  2GVI A;  1FAQ A;  2YQP A;  2QQC A;  9WGA A;  3R5C A;  1HDL A;  2DKV A;  2E5R A;  4WP4 A;  4DNC A;  7WGA A;  3UGL A;  1U5K A;  1K7U A;  1CE3 A;  2XRC A;  4MPI A;  3SGQ I;  2N1A B;  5EX0 A;  1LR8 A;  5FUX A;  1K7T A;  2V1C C;  2B0U C;  1IY5 A;  2ARP F;  2KCX A;  1CSO I;  1SGY I;  2GIV A;  3SGB I;  1WGT A;  1Y1C A;  2BUS A;  2ELI A;  4E1P A; 
#chains in the Genus database with same CATH homology
 2X52 A;  1WKX A;  1HEV A;  2LB7 A;  1WGC A;  1ULK A;  2CWG A;  2UVO A;  1P9G A;  1P9Z A;  1UHA A;  1ULM A;  1K7V A;  2X3T A;  9WGA A;  2DKV A;  4WP4 A;  7WGA A;  2WGC A;  1K7U A;  4MPI A;  1ULN A;  1K7T A;  1Q9B A;  1WGT A;  4AML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...