1WKXA

Crystal structure of a hev b 6.02 isoallergen
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
43
structure length
43
Chain Sequence
b'EQCGRQAGGKLCPDNLCCSQWGWCGSTDEYCSPDHNCQSNCKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEVEIN ISOFORM 2
publication title Structural and Immunological Characterization of an Isoallergen of Hev b 6.02
rcsb
molecule tags Allergen
total genus 13
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2004-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1wkxA00
1ULKA 7WGAA 4AMLA 1Q9BA 1P9GA 2LB7A 2WGCA 2X3TA 2X52A 1WGTA 1K7VA 1ULMA 9WGAA 2CWGA 1P9ZA 1WGCA 4MPIA 1WKXA 4WP4A 1UHAA 2DKVA 1K7UA 1ULNA 1HEVA 2UVOA 1K7TA
chains in the Genus database with same CATH superfamily
7WGAA 2ENNA 3FC3A 1DS3I 5JHWC 3VDUA 5E3RA 2B0UC 1CT2I 1P9GA 1XA6A 1BUSA 1FARA 1BMOA 4E1RA 2LEOA 1K7VA 1IY6A 1TBQR 1Y1CA 2GVIA 1R79A 1MJ9A 2SGQI 2QQ0A 1DS2I 3TOAA 9WGAA 1SGPI 1XBTA 1P9ZA 3OL0A 1R0RI 2JYYA 5CCLA 1Y1BA 2JXDA 3FSYA 1OYVI 3MEKA 5EX0A 1WGCA 2ENZA 1N13A 1HDLA 4UXIA 2NU3I 1NUBA 1PPFI 1UHAA 2Y0MA 3CXLA 3R5AA 1LR8A 1IW4A 3OXGA 2E5RA 2SGEI 2XRCA 2VRWB 2V1CC 2OU2A 2SGDI 3QTLD 1KMAA 1SGQI 4JCVE 2B8TA 2N1AB 1CT0I 1SGRI 2RC4A 1H0ZA 2CJSC 2ORWA 1PCEA 2OZUA 2X52A 2OVOA 2A20A 1OMTA 3BJIA 3GOXA 3R5CA 2JW6A 2JZMA 2L8EA 2UVOA 1UVGA 2KMRA 3SGBI 1YTPA 3UEJA 1SGYI 2DIPA 4SGBI 3UGDA 3OXLA 1TBNA 1CHOI 3UFFA 1OVOA 1U5KA 1AN1I 3VDPA 4MPIA 1MT1A 2N71A 4UXJA 1WKXA 2QQEA 3TO9A 1LR7A 3QAHA 2DKVA 2CWHA 3VE5A 1X74A 2F3CI 2KCXA 3RU0A 3SEKC 5FUYA 2ELIA 2WVJA 2CWFA 1V1HA 1PTRA 4A24A 5HQ8A 1K7TA 3UOEA 1SGEI 1S20A 2J9RA 1MJAA 2M5XA 3UGLA 1PTQA 2N17A 1Q9BA 2W0TA 4OVOA 3E2IA 1Y8FA 2NU1I 1W4RA 3UEYA 5FUXA 1PJUA 3TJQA 2ODDA 1OMUA 2NU2I 1M8BA 5J8CA 1CE3A 2V1CA 4UXHA 5FUVA 2CWGA 5DAEA 3TOBA 1MJBA 1UVFA 2QQCA 3QWPA 2N52A 1NXUA 2WCYA 5EX3A 3TO7A 2ARPF 3D00A 2SGPI 2DB6A 2YQPA 1HPTA 3OXFA 3PDNA 1IY5A 4WP4A 1UUCA 2ERWA 3SGQI 2OD1A 1W3SA 1TOTA 1TIHA 4E1PA 2KMOA 2NU4I 2GKRI 1TURA 2L7XA 2NU0I 3UGIA 1KBFA 4HGUA 1HEVA 1CGII 1CSOI 1ULKA 5E3QA 5FUWA 2JA1A 2KMQA 2YUUA 1TUSA 2QPOA 2E73A 4AMLA 3KY9A 2LB7A 1FYBA 2WGCA 3FSXA 5E3PA 3TO6A 1TBRR 2X3TA 1KBEA 1CGJI 1SGDI 1WGTA 2QQDA 3E59A 2PQ8A 1SGNI 4DNCA 3HH2C 4L9MA 2KMPA 4B6DA 2GKTI 1Z2IA 1TGSI 3R5BA 1ULMA 2UZ3A 1V1IA 4FKDA 1CT4I 2RIJA 1VDDA 1HJAI 4GI3C 1WTJA 1XX6A 2ROWA 1YU6C 2K9HA 1RFHA 5CCMA 5HI7A 1LR9A 1FY7A 1TBOA 3B4VC 2FNFX 1FAQA 2GKVA 2V53A 2P6AC 5J8FA 2SGFI 2BUSA 2J87A 1M8CA 3R5DA 1K7UA 1ULNA 2ORVA 2GIVA 1Z7KB 3OVOA 1X4SA 2LUYA
chains in the Genus database with same CATH topology
1ULKA 7WGAA 4AMLA 1Q9BA 1P9GA 2LB7A 2WGCA 2X3TA 2X52A 1WGTA 1K7VA 1ULMA 9WGAA 2CWGA 1P9ZA 1WGCA 4MPIA 1WKXA 4WP4A 1UHAA 2DKVA 1K7UA 1ULNA 1HEVA 2UVOA 1K7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULK A;  7WGA A;  4AML A;  1Q9B A;  1P9G A;  2LB7 A;  2WGC A;  2X3T A;  2X52 A;  1WGT A;  1K7V A;  1ULM A;  9WGA A;  2CWG A;  1P9Z A;  1WGC A;  4MPI A;  1WKX A;  4WP4 A;  1UHA A;  2DKV A;  1K7U A;  1ULN A;  1HEV A;  2UVO A;  1K7T A; 
#chains in the Genus database with same CATH topology
 7WGA A;  2ENN A;  3FC3 A;  1DS3 I;  5JHW C;  3VDU A;  5E3R A;  2B0U C;  1CT2 I;  1P9G A;  1XA6 A;  1BUS A;  1FAR A;  1BMO A;  4E1R A;  2LEO A;  1K7V A;  1IY6 A;  1TBQ R;  1Y1C A;  2GVI A;  1R79 A;  1MJ9 A;  2SGQ I;  2QQ0 A;  1DS2 I;  3TOA A;  9WGA A;  1SGP I;  1XBT A;  1P9Z A;  3OL0 A;  1R0R I;  2JYY A;  5CCL A;  1Y1B A;  2JXD A;  3FSY A;  1OYV I;  3MEK A;  5EX0 A;  1WGC A;  2ENZ A;  1N13 A;  1HDL A;  4UXI A;  2NU3 I;  1NUB A;  1PPF I;  1UHA A;  2Y0M A;  3CXL A;  3R5A A;  1LR8 A;  1IW4 A;  3OXG A;  2E5R A;  2SGE I;  2XRC A;  2VRW B;  2V1C C;  2OU2 A;  2SGD I;  3QTL D;  1KMA A;  1SGQ I;  4JCV E;  2B8T A;  2N1A B;  1CT0 I;  1SGR I;  2RC4 A;  1H0Z A;  2CJS C;  2ORW A;  1PCE A;  2OZU A;  2X52 A;  2OVO A;  2A20 A;  1OMT A;  3BJI A;  3GOX A;  3R5C A;  2JW6 A;  2JZM A;  2L8E A;  2UVO A;  1UVG A;  2KMR A;  3SGB I;  1YTP A;  3UEJ A;  1SGY I;  2DIP A;  4SGB I;  3UGD A;  3OXL A;  1TBN A;  1CHO I;  3UFF A;  1OVO A;  1U5K A;  1AN1 I;  3VDP A;  4MPI A;  1MT1 A;  2N71 A;  4UXJ A;  1WKX A;  2QQE A;  3TO9 A;  1LR7 A;  3QAH A;  2DKV A;  2CWH A;  3VE5 A;  1X74 A;  2F3C I;  2KCX A;  3RU0 A;  3SEK C;  5FUY A;  2ELI A;  2WVJ A;  2CWF A;  1V1H A;  1PTR A;  4A24 A;  5HQ8 A;  1K7T A;  3UOE A;  1SGE I;  1S20 A;  2J9R A;  1MJA A;  2M5X A;  3UGL A;  1PTQ A;  2N17 A;  1Q9B A;  2W0T A;  4OVO A;  3E2I A;  1Y8F A;  2NU1 I;  1W4R A;  3UEY A;  5FUX A;  1PJU A;  3TJQ A;  2ODD A;  1OMU A;  2NU2 I;  1M8B A;  5J8C A;  1CE3 A;  2V1C A;  4UXH A;  5FUV A;  2CWG A;  5DAE A;  3TOB A;  1MJB A;  1UVF A;  2QQC A;  3QWP A;  2N52 A;  1NXU A;  2WCY A;  5EX3 A;  3TO7 A;  2ARP F;  3D00 A;  2SGP I;  2DB6 A;  2YQP A;  1HPT A;  3OXF A;  3PDN A;  1IY5 A;  4WP4 A;  1UUC A;  2ERW A;  3SGQ I;  2OD1 A;  1W3S A;  1TOT A;  1TIH A;  4E1P A;  2KMO A;  2NU4 I;  2GKR I;  1TUR A;  2L7X A;  2NU0 I;  3UGI A;  1KBF A;  4HGU A;  1HEV A;  1CGI I;  1CSO I;  1ULK A;  5E3Q A;  5FUW A;  2JA1 A;  2KMQ A;  2YUU A;  1TUS A;  2QPO A;  2E73 A;  4AML A;  3KY9 A;  2LB7 A;  1FYB A;  2WGC A;  3FSX A;  5E3P A;  3TO6 A;  1TBR R;  2X3T A;  1KBE A;  1CGJ I;  1SGD I;  1WGT A;  2QQD A;  3E59 A;  2PQ8 A;  1SGN I;  4DNC A;  3HH2 C;  4L9M A;  2KMP A;  4B6D A;  2GKT I;  1Z2I A;  1TGS I;  3R5B A;  1ULM A;  2UZ3 A;  1V1I A;  4FKD A;  1CT4 I;  2RIJ A;  1VDD A;  1HJA I;  4GI3 C;  1WTJ A;  1XX6 A;  2ROW A;  1YU6 C;  2K9H A;  1RFH A;  5CCM A;  5HI7 A;  1LR9 A;  1FY7 A;  1TBO A;  3B4V C;  2FNF X;  1FAQ A;  2GKV A;  2V53 A;  2P6A C;  5J8F A;  2SGF I;  2BUS A;  2J87 A;  1M8C A;  3R5D A;  1K7U A;  1ULN A;  2ORV A;  2GIV A;  1Z7K B;  3OVO A;  1X4S A;  2LUY A; 
#chains in the Genus database with same CATH homology
 1ULK A;  7WGA A;  4AML A;  1Q9B A;  1P9G A;  2LB7 A;  2WGC A;  2X3T A;  2X52 A;  1WGT A;  1K7V A;  1ULM A;  9WGA A;  2CWG A;  1P9Z A;  1WGC A;  4MPI A;  1WKX A;  4WP4 A;  1UHA A;  2DKV A;  1K7U A;  1ULN A;  1HEV A;  2UVO A;  1K7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...