1WKXA

Crystal structure of a hev b 6.02 isoallergen
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
43
structure length
43
Chain Sequence
EQCGRQAGGKLCPDNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEVEIN ISOFORM 2
publication title Structural and Immunological Characterization of an Isoallergen of Hev b 6.02
rcsb
molecule tags Allergen
total genus 13
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2004-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1wkxA00
2WGCA 1ULMA 4AMLA 1ULKA 2X3TA 2LB7A 2X52A 1ULNA 2CWGA 4MPIA 1WGCA 2UVOA 1K7TA 1WKXA 1P9ZA 1K7VA 2DKVA 1P9GA 4WP4A 1HEVA 1UHAA 1Q9BA 7WGAA 9WGAA 1K7UA 1WGTA
chains in the Genus database with same CATH superfamily
2ORVA 3R5DA 2XRCA 1BUSA 3D00A 2N1AB 1OMUA 2LUYA 3QWPA 4AMLA 1ULKA 2OVOA 2FNFX 5JHWC 2PQ8A 5FUVA 3GOXA 2SGQI 3PDNA 2ENNA 4HGUA 3SGQI 4JCVE 5HI7A 2F3CI 1NUBA 1WKXA 2P6AC 1CHOI 3KY9A 3QTLD 3FC3A 1PTQA 1K7VA 1YU6C 1MJBA 1PCEA 1FARA 2Y0MA 5FUYA 1TUSA 3TO7A 1TBRR 3R5AA 2V53A 1YTPA 3OXLA 2KMPA 1AN1I 1LR8A 1Y1BA 2NU0I 3R5CA 1CE3A 2OU2A 1WGTA 1UVFA 1TURA 1PJUA 2N17A 2GKRI 5J8FA 1OMTA 2NU3I 1CSOI 3UEJA 2WGCA 1MT1A 3VE5A 2GKTI 2OZUA 2SGFI 1TBOA 2B0UC 2KMQA 1SGNI 4OVOA 3TJQA 5CCMA 2CWFA 4DNCA 1TBNA 1XA6A 2JW6A 2X52A 1HPTA 3SEKC 2NU1I 4UXHA 1IW4A 5FUWA 2B8TA 4MPIA 2DIPA 1TIHA 2QPOA 2ODDA 1K7TA 1XX6A 1P9ZA 3CXLA 2KCXA 1HDLA 2A20A 5DAEA 2E73A 1PTRA 1OYVI 1WTJA 4WP4A 4E1PA 3FSXA 4UXJA 2VRWB 5CCLA 1IY6A 2SGDI 3TO6A 3TO9A 2J9RA 1TGSI 7WGAA 4E1RA 1SGDI 1R0RI 4SGBI 5E3QA 3UGLA 3FSYA 4FKDA 2LEOA 2ARPF 2JXDA 2L7XA 4UXIA 3VDPA 2JYYA 2N71A 2E5RA 1FAQA 3E59A 1ULMA 1UVGA 2SGEI 1H0ZA 1V1HA 1XBTA 1NXUA 1MJ9A 1CGJI 1FYBA 2YUUA 2V1CA 1R79A 2WVJA 1SGYI 2LB7A 3RU0A 2ELIA 4A24A 1IY5A 2CWHA 2JA1A 2UVOA 1V1IA 2NU4I 2N52A 2QQEA 2UZ3A 2DB6A 2ERWA 2KMRA 1W4RA 1BMOA 2RC4A 2DKVA 1DS3I 3E2IA 1KBEA 2BUSA 2SGPI 5E3PA 2GIVA 1CT0I 1VDDA 1UHAA 5E3RA 1KBFA 2JZMA 1N13A 3QAHA 9WGAA 1LR7A 1M8BA 2WCYA 1MJAA 2NU2I 1Z7KB 3TOAA 1M8CA 2QQDA 3B4VC 4L9MA 2ENZA 3OVOA 1Y8FA 2W0TA 5J8CA 2K9HA 1CT2I 2YQPA 1X4SA 3HH2C 2ROWA 1UUCA 1CT4I 2X3TA 1SGPI 1Y1CA 3UOEA 1Z2IA 1TOTA 4GI3C 1CGII 1DS2I 1ULNA 2M5XA 2ORWA 1S20A 2CWGA 1U5KA 1WGCA 2GVIA 2J87A 3MEKA 5EX3A 1TBQR 5FUXA 3OXFA 1RFHA 3UEYA 5HQ8A 2CJSC 2QQ0A 3BJIA 1P9GA 2GKVA 1SGRI 3UGIA 2L8EA 4B6DA 1HEVA 3OXGA 5EX0A 3UFFA 1Q9BA 2OD1A 1OVOA 2KMOA 1HJAI 1PPFI 2RIJA 1SGQI 3UGDA 1K7UA 3SGBI 3VDUA 1W3SA 1KMAA 3OL0A 1SGEI 2QQCA 1LR9A 1FY7A 1X74A 3TOBA 2V1CC 3R5BA
chains in the Genus database with same CATH topology
2WGCA 1ULMA 4AMLA 1ULKA 2X3TA 2LB7A 2X52A 1ULNA 2CWGA 4MPIA 1WGCA 2UVOA 1K7TA 1WKXA 1P9ZA 1K7VA 2DKVA 1P9GA 4WP4A 1HEVA 1UHAA 1Q9BA 7WGAA 9WGAA 1K7UA 1WGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGC A;  1ULM A;  4AML A;  1ULK A;  2X3T A;  2LB7 A;  2X52 A;  1ULN A;  2CWG A;  4MPI A;  1WGC A;  2UVO A;  1K7T A;  1WKX A;  1P9Z A;  1K7V A;  2DKV A;  1P9G A;  4WP4 A;  1HEV A;  1UHA A;  1Q9B A;  7WGA A;  9WGA A;  1K7U A;  1WGT A; 
#chains in the Genus database with same CATH topology
 2ORV A;  3R5D A;  2XRC A;  1BUS A;  3D00 A;  2N1A B;  1OMU A;  2LUY A;  3QWP A;  4AML A;  1ULK A;  2OVO A;  2FNF X;  5JHW C;  2PQ8 A;  5FUV A;  3GOX A;  2SGQ I;  3PDN A;  2ENN A;  4HGU A;  3SGQ I;  4JCV E;  5HI7 A;  2F3C I;  1NUB A;  1WKX A;  2P6A C;  1CHO I;  3KY9 A;  3QTL D;  3FC3 A;  1PTQ A;  1K7V A;  1YU6 C;  1MJB A;  1PCE A;  1FAR A;  2Y0M A;  5FUY A;  1TUS A;  3TO7 A;  1TBR R;  3R5A A;  2V53 A;  1YTP A;  3OXL A;  2KMP A;  1AN1 I;  1LR8 A;  1Y1B A;  2NU0 I;  3R5C A;  1CE3 A;  2OU2 A;  1WGT A;  1UVF A;  1TUR A;  1PJU A;  2N17 A;  2GKR I;  5J8F A;  1OMT A;  2NU3 I;  1CSO I;  3UEJ A;  2WGC A;  1MT1 A;  3VE5 A;  2GKT I;  2OZU A;  2SGF I;  1TBO A;  2B0U C;  2KMQ A;  1SGN I;  4OVO A;  3TJQ A;  5CCM A;  2CWF A;  4DNC A;  1TBN A;  1XA6 A;  2JW6 A;  2X52 A;  1HPT A;  3SEK C;  2NU1 I;  4UXH A;  1IW4 A;  5FUW A;  2B8T A;  4MPI A;  2DIP A;  1TIH A;  2QPO A;  2ODD A;  1K7T A;  1XX6 A;  1P9Z A;  3CXL A;  2KCX A;  1HDL A;  2A20 A;  5DAE A;  2E73 A;  1PTR A;  1OYV I;  1WTJ A;  4WP4 A;  4E1P A;  3FSX A;  4UXJ A;  2VRW B;  5CCL A;  1IY6 A;  2SGD I;  3TO6 A;  3TO9 A;  2J9R A;  1TGS I;  7WGA A;  4E1R A;  1SGD I;  1R0R I;  4SGB I;  5E3Q A;  3UGL A;  3FSY A;  4FKD A;  2LEO A;  2ARP F;  2JXD A;  2L7X A;  4UXI A;  3VDP A;  2JYY A;  2N71 A;  2E5R A;  1FAQ A;  3E59 A;  1ULM A;  1UVG A;  2SGE I;  1H0Z A;  1V1H A;  1XBT A;  1NXU A;  1MJ9 A;  1CGJ I;  1FYB A;  2YUU A;  2V1C A;  1R79 A;  2WVJ A;  1SGY I;  2LB7 A;  3RU0 A;  2ELI A;  4A24 A;  1IY5 A;  2CWH A;  2JA1 A;  2UVO A;  1V1I A;  2NU4 I;  2N52 A;  2QQE A;  2UZ3 A;  2DB6 A;  2ERW A;  2KMR A;  1W4R A;  1BMO A;  2RC4 A;  2DKV A;  1DS3 I;  3E2I A;  1KBE A;  2BUS A;  2SGP I;  5E3P A;  2GIV A;  1CT0 I;  1VDD A;  1UHA A;  5E3R A;  1KBF A;  2JZM A;  1N13 A;  3QAH A;  9WGA A;  1LR7 A;  1M8B A;  2WCY A;  1MJA A;  2NU2 I;  1Z7K B;  3TOA A;  1M8C A;  2QQD A;  3B4V C;  4L9M A;  2ENZ A;  3OVO A;  1Y8F A;  2W0T A;  5J8C A;  2K9H A;  1CT2 I;  2YQP A;  1X4S A;  3HH2 C;  2ROW A;  1UUC A;  1CT4 I;  2X3T A;  1SGP I;  1Y1C A;  3UOE A;  1Z2I A;  1TOT A;  4GI3 C;  1CGI I;  1DS2 I;  1ULN A;  2M5X A;  2ORW A;  1S20 A;  2CWG A;  1U5K A;  1WGC A;  2GVI A;  2J87 A;  3MEK A;  5EX3 A;  1TBQ R;  5FUX A;  3OXF A;  1RFH A;  3UEY A;  5HQ8 A;  2CJS C;  2QQ0 A;  3BJI A;  1P9G A;  2GKV A;  1SGR I;  3UGI A;  2L8E A;  4B6D A;  1HEV A;  3OXG A;  5EX0 A;  3UFF A;  1Q9B A;  2OD1 A;  1OVO A;  2KMO A;  1HJA I;  1PPF I;  2RIJ A;  1SGQ I;  3UGD A;  1K7U A;  3SGB I;  3VDU A;  1W3S A;  1KMA A;  3OL0 A;  1SGE I;  2QQC A;  1LR9 A;  1FY7 A;  1X74 A;  3TOB A;  2V1C C;  3R5B A; 
#chains in the Genus database with same CATH homology
 2WGC A;  1ULM A;  4AML A;  1ULK A;  2X3T A;  2LB7 A;  2X52 A;  1ULN A;  2CWG A;  4MPI A;  1WGC A;  2UVO A;  1K7T A;  1WKX A;  1P9Z A;  1K7V A;  2DKV A;  1P9G A;  4WP4 A;  1HEV A;  1UHA A;  1Q9B A;  7WGA A;  9WGA A;  1K7U A;  1WGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...