2QQEA

Thymidine kinase from thermotoga maritima in complex with thymidine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
180
structure length
164
Chain Sequence
SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKNGVEAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGEEEIDVGGQEKYIAVCRDCYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidine kinase
publication title Quaternary structure change as a mechanism for the regulation of thymidine kinase 1-like enzymes.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 49
structure length 164
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2qqeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qqeA01
1QVRA 3ADBA 3GJ7A 2ZRNA 4TYQA 1HQCA 3WYFA 1ZM7A 5HZKA 2GJ8A 2D2EA 2LKCA 5AUQA 1MKYA 2E9SA 4A8JA 2FNFX 1NN5A 4Q03A 4TL8A 1OXTA 1E2PA 1FQJA 2H16A 2ZRIA 3KJEA 3WNDA 1P2VA 5CDFE 4NP6A 2EFEB 1Z83A 2O8BA 3KKNA 2ZIAA 3LVQE 3QKSB 4X8LA 1XCGB 3IQXA 4W7SA 2O0HA 3B7GA 2QAGB 2ERXA 1OH7A 1T3HA 2CNWD 3BFXA 3FE2A 1RVDA 1NVXQ 2ZJYA 3CW2A 2WOOA 4KFTA 3LX5A 2W6JD 4AC9A 1L2TA 1ZIPA 1E6CA 1SULA 3W8RA 3AVWA 4L15A 4KITB 2P0EA 2QGNA 4DLVA 4MA4A 4C0AC 4IXMA 1IY2A 5FFMA 4E22A 5F3WB 2HDNB 4RZ2A 1TPZA 3K9NA 3KQLA 2GEUA 1COWD 1KBFA 2IXEA 3R7WB 3K0CC 4DUGD 5CB6A 2GVDC 1E99A 2ZI6A 1Z8FA 5EXTA 3TR0A 4OI4A 4Q9HA 1RJ9A 1X6VA 2R6GA 4CRWB 4ASUD 4B73A 4JJZA 3CX8A 2A5YB 2XZLA 2IF0A 3KX2A 3T1QA 4GZMA 5JS7A 4EFMA 1BMFD 4C0SA 3L0IB 1EXMA 1II9A 3D3QA 4JVNA 1E4VA 3MWJA 4BLRA 1FTSA 4NZYA 3KJGA 5IRCD 4LSGA 3PEYA 3QKSA 2ZRDA 2QG6A 3UWKA 4BFZA 5KOYA 3PUYA 2JLVA 2C77A 4JIMA 3CNNA 2QAGA 4KSCA 2CJWB 4JLMA 2FX3A 2GBLC 2HXSA 1D2EA 2JGNA 1Z28A 1E9BA 1UF9A 3FB4A 4Q01A 1XJ0A 1CXZA 4H9GA 3G0HA 4B74A 2VP2A 5FOSA 1OXSC 3IIJA 3NHBA 1KHTA 3DDCA 2E73A 2C04A 4LJ6A 4ON9A 2HF8A 1D2NA 2IYTA 3VKWA 5GVSA 5LD2B 3I61A 5L8VA 221PA 1VDZA 1N3BA 1M7GA 1ZU4A 2XXAB 1CIPA 1U98A 1VMAA 2ZRPA 3IBYA 2KB0A 3ZDQA 1YR6A 2GAOA 3QY0A 2FWRA 4AY2A 1GVNB 3NEJA 3F3YA 2RGBA 2B6HA 3BB4A 5BW8A 4HB4A 1PTQA 1Q1QA 2RHDA 2ODBA 4C3ZA 3CR7A 2MMGA 1GNQA 3I8XA 5ANRB 3W34A 5FOUA 1WB9A 4M1MA 5KU1A 2CE2X 2HJGA 1AKEA 4Z1MD 4ZPXA 1N0VC 3W9YA 2WSSA 5J4YA 2DWPA 5FUXA 5HKKA 2QT0A 4UXJA 1G17A 2PX3A 4A82A 2ZROA 2ZTSA 1NJFA 5CIQA 4ESHA 2QRNA 3C5CA 1IY1A 4I81A 2ORWA 1O3YA 1YZNA 2CJWA 3EPKA 1TEVA 3A58B 1SXJC 4KFRA 4P32A 5A0FA 2QMHA 3ZVRA 4A1FA 3T1VA 3BIFA 5GJWC 1TF2A 4Q1DA 5JCZA 4TYPA 4CDGA 3RANA 2NGRA 4XVRA 1QG4A 5FBVB 2XXAA 3ZH9B 1VHTA 2GF0A 3MLEA 4GSYA 4Q4HB 5EUQB 4WIAA 1KI9A 2JLZA 3HPRA 3OEHD 1GRRA 2O8CB 3MD0A 3A6PC 4ITRC 3BJIC 4KU4A 2WAYA 2NO7A 2QTHA 4KO8A 1OH6A 3LDAA 5D3MB 1JR3E 3ZVNA 1AIPA 2QP9X 3GJ8A 5EE9A 3NH9A 1NI3A 4GT1A 2VSXA 5EE1A 3NWJA 4BLOA 5JLJA 4LBVA 4KI0A 1G21E 1UBCA 3AKEA 1K5GA 4Q1CA 2O8EA 1G5RA 3KB2A 2IS4A 3EASA 4BUJA 1TU4A 1TAGA 4NHOA 5CJPA 1OH8A 4ACBA 3TNFA 1B0UA 1HURA 4YC7A 2WIAA 2XTMA 3VNUA 3GLHE 4Q66C 4RVCA 1P2UA 1XTKA 1U0HC 4WXRA 3X2SA 3AKDA 2FGKA 1PVOA 4QJ3A 1CJVC 2FPMA 1FP6A 1ZD8A 3NHAA 3UMFA 1NN0A 3Q85A 3BE4A 1GNPA 2XGJA 1OHHA 3DZDA 4TLEA 1NLZA 2BV3A 3QF7A 1R2QA 5JJKA 2GKSA 1R79A 1T5IA 3G5UA 1AJEA 1CR1A 1YRAA 3CNLA 4URWR 1II0A 3LWNA 3R8FA 1NMZA 2O8CA 2G77B 3AGQA 2BBWA 4X8OA 5H1YA 3KJHA 4KHZA 4C0BA 1GL7A 1S0UA 2RGNC 2GZAA 5D3MA 3QJYA 1NRJB 1G291 2F1JA 1KDPA 1OFUX 1EFHA 4E5UA 4URVR 4C7OA 1R0XA 2CXXA 4NYIQ 3ZZTA 3LW7A 4MYUA 4D4KA 1E2MA 3M4YA 4OQFA 3LY5A 1WXQA 3MAAC 1FUKA 2N46A 4GFDA 2NO9A 2QE7A 1DG1G 2O8FB 1E1QA 4I99A 3R9IA 3RAPR 3CWZA 1P7CA 1N25A 4TQUS 2GDJA 2VP0A 2OAQ1 1E9CA 4UXHA 2JEOA 6Q21A 3ZS8A 2JJ2A 4MGKR 4UNQA 1JXMA 2G88A 5EP4A 1DBSA 4N0DA 3B5JA 3ZQ6A 2GJKA 4Q1AA 2B92A 1M1YE 3CH4B 4RKFA 5KO2A 3AP2A 3THXA 1NSTA 1QHIA 3B2EA 3KKMA 1R0YA 5BYKA 1YZTA 2G0NA 4M4SA 4Q1FA 1OE0A 1G20E 3MUFA 4OHZA 5FH9A 1NLFA 3A37A 1JI0A 5CYPA 3TW4A 1KI1A 2ZI9A 4HSEA 3H4MA 5SZIA 4DHEA 1TF7A 4IOLA 4LDJA 4C0HA 3PV0A 1DVRA 5FL3A 4BASA 4KV9A 4LCBA 1DAIA 1AQUA 1XJCA 4EJSA 1X8KA 1XD2B 3UIEA 4UXIA 1JAHA 1FPMA 2I4IA 4MH0R 4A9AA 3WHLA 4ESVA 2O8FA 3FFAA 1ZD1A 4BWYA 2ASEA 2IL1A 1NN1A 3TUZC 4TZ6A 2GHIA 2QROA 3ND9A 2E1RA 2PBRA 4JL6A 3UATA 2GESA 2JDIA 2GTPA 3ICEA 3GFOA 4HLQB 4B32A 4XWOA 3THYB 2ZSDA 1SHZA 3QXJA 3C4JA 3CPJB 1NY6A 1NY5A 4PTLA 2ZYTX 2QMEA 2A5GA 3DOEA 1I2MA 1TMKA 1G8FA 1Z0FA 2CL0X 3ECCA 2WPDA 4OQMA 4HI0E 1GKYA 2ZI3A 5G41A 2ZSEA 5K8LA 3I4LA 4TTPA 4M8NE 2Z4RA 4R9UC 2FSFA 3ZJYA 2GEVA 1G19A 4DLYA 1XD2A 2QM8A 2JASA 1YJ5A 2VIIA 4OQXA 4DDWA 3C7KA 2W0MA 3HDTA 3UEJA 4IDNA 1KO8A 5K8TA 1GAJA 1DAEA 1ZMXA 1Z06A 2XTNA 3H2YA 2BKEA 1XPUA 1R8QA 3H1TA 1E2EA 1PLLA 1XXHE 3TLXA 1YRBA 3A1VA 4DBLC 2OHFA 5F2EA 4PHTA 1KI2A 4PSKA 3DM5A 2CL6X 2IBMA 3WMGA 2C98A 2REXB 4JVSB 1WP9A 3THYA 2FU5C 4QJ5A 2VL7A 2PZGA 1OH5A 2J1LA 3KKPA 3I73A 2CNWA 1VG8A 3J81k 3NH6A 4RKEA 2KJQA 2W6JA 4PO1A 3UGDA 5FR2A 2PCLA 2R62A 1JECA 1N6KA 1RW4A 2Q6TA 2DR3A 4Q1BA 1OSNA 5JECA 3CZQA 1GUAA 4DVGA 2IS2A 1H8HD 1XMJA 3W5JA 1COWA 3RLFA 1M7HA 4L9WA 3W6PA 4V0KA 2R8RA 1Y63A 3SQWA 2JLWA 2B8TA 3A1SA 4DUGA 4W5HA 4JLBA 2BJWA 4AIIA 5CITA 2WWXA 2BBSA 3QPUA 2G9NA 3WYGA 4JKIA 2VP4A 4W5WA 2IXFA 4JJKA 4B3FX 4ERNA 1VCMA 2OBMA 4ASUA 1BO6A 1NG1A 2F9MA 3TAHA 5JJLA 1FX0B 2IX3A 3AF1A 3TVDA 5E7MA 3NC1C 4B3DA 1BMFA 1G6HA 2MSEB 2VHTA 4QGGA 3VTKA 2DB3A 2ZJZA 4FKDA 2OLJA 1Y8FA 5FOXA 3BORA 1KMQA 2PL3A 2AN9A 2CVHA 2AD1A 2RGAA 4OHWA 2KI5A 1E32A 3VKGA 1XJQA 3KB1A 3CBQA 1JB1A 4DLSA 4C0JA 4TL9A 4JBXA 1QG2A 1T4GA 2DFKB 4DDUA 2BM1A 2JAQA 1AS0A 2L0XA 4V0MA 4LOAA 4DCNA 2ZUBA 5GJVC 3K1JA 5FPSA 1KI8A 4PQYA 4TZ0A 4P4SA 3RHFA 3I8SA 2QGZA 3W6NA 4KAXA 1SVKA 3UXMA 4URYR 5TB5A 1IN7A 4BFYA 2ZJ8A 4KSBA 5EJEA 5HR5A 4IDPA 2HJVA 4IDQA 5EXPA 1ZM2A 2AX4A 4O0MA 3A4LA 2C5LA 1NSFA 4B34A 1ZIOA 2Q0HA 4IOKA 2HYIC 1FX0A 2DWOA 1ZNWA 2PJZA 4Z1MA 4DDVA 1GWNA 1GP2A 1CF4A 3PFIA 3KQKA 4Q5IA 4DC9A 1Z29A 3CKLA 5FI1B 2VRWA 1T0HB 2XZOA 4EPTA 2CL7X 4Q4JA 1OF1A 1MOZA 2OT3B 3H84A 3IO5A 4M1KA 4ZDJA 2IYSA 2J0VA 3BERA 1E2NA 2F1HA 2F6RA 2GJ9A 4CT5A 2TMKA 4LC1A 5B64A 5HZHA 1RYFA 1HE1C 3GJ6A 2XSZD 2WZQA 2YOFA 4YQFA 2CLCX 2ZPTX 2AK2A 1MRNA 2EWVA 3SBEA 4M1OA 3I62A 1UDXA 2IYXA 1NVUQ 3P26A 3ASYA 4I1VA 3TH5A 4QM7A 1N5IA 2H18A 2ZETA 5D3QA 4EPVA 5AUNB 1FMJA 2H5EA 1D2MA 4Q7MB 5K8IA 1J8MF 2OV2A 3MFYA 1E9EA 1GNRA 2ROWA 1N0WA 3AF0A 1R5OA 4KFSA 3HYRA 3I92A 3OEHA 4RZ3A 3RSLA 1A7JA 1Q1ZA 4FMBB 1YZKA 4EQ6B 1IJFA 2DHRA 1M34E 2ZVQX 3V4FA 1UKEA 3I3SR 4Q4LA 1W4BA 1Z22A 1S2MA 1KJYA 1HEIA 1DAMA 5FL7D 4D4MA 5AUOB 3BB1A 4OHVA 4HDCA 4FD2A 4BLSA 1VCNA 3VR1A 2IUSA 2H92A 4JYBA 2JLXA 2WBLC 1MR3F 4Q21A 3TSWA 1WE2A 3BC1A 3CF2A 2XZPA 3QEOA 3HR8A 4ARZB 3RYTC 1DAKA 3BH6A 1XF9A 2C78A 1G4UR 1KO4A 3BBPA 2V8OA 3QXCA 2GRJA 2G1JA 2QORA 4M53A 4PQFA 5LDDC 4BRWA 4DIDA 1AZTA 1DOAA 3GLGE 3FHCB 2P6NA 5J4LA 1X8JA 3EX7C 2YJTD 1E0KA 3ADCA 5BN5A 3QIAA 2CBZA 1QBKC 2P5SA 2V9PA 4FMCF 4NYJR 1BS1A 4IFBA 4PSAA 1Z0JA 1G6OA 3SFVA 1E4YA 4AYTA 4B47A 1W49A 1T0JB 4BFSA 1ZYUA 4LV8B 4JMPA 1P9WA 2F9LA 2YWHA 4OQNA 3CRQA 2GCNA 2Q9BA 3LO5A 4YDSA 1XBTA 2F3RA 3BFVA 5DIFA 1TF5A 3OE7D 1TTTA 2ORIA 1YU9A 4WA7A 3K70C 3O8BA 4D82A 4AG6A 3AUXA 4JBYA 2G83A 1QHGA 2YWGA 5FBQB 3AGPA 5DHFA 5DI9A 1XB2A 1ESMA 2WJJA 3U44B 2EQBA 1RE0A 3K9LA 3K09A 1K6MA 5AJWA 3FGNA 2IHBA 2AL7A 3H86A 4LPKA 3W6OA 5FPYA 4LHZA 4ZI2A 1Q12A 3CX6A 1Q3HA 1CJUC 3HR7A 3RABA 3B85A 2IYQA 4BFWA 1TADA 2CHVA 1KK0A 2BVNA 2NPIA 2PMDA 4DXAA 5E4FA 1Z0IA 2CK3D 4QM6A 2DFLA 1W36C 4TSFD 2PLRA 4S2EA 3KTAB 4KCGA 2JCSA 3K53A 3B6EA 4EPRA 4AURA 1UFQA 1KK2A 4TTQA 2MMCA 1JBKA 3P20A 3W90A 2XNSA 5DN6D 3QPWA 1E2HA 3SYKA 1HTWA 1KO5A 3B78A 5CK5A 4I1SA 4U02A 2OFOA 2ZS8A 5IF9A 3KFXA 4FCWA 1G64A 4V0OA 4XIGS 3DKVA 2ZS7A 5M04A 4GI7A 3WXMA 4NMMA 3IEUA 3QUSA 2ZRAA 4MGYR 4DEXA 2XJ9A 4G3XA 4BFUA 2VP6A 4X8HA 1QHHB 1XRJA 5L3QB 4GP6A 4QKQA 1RRCA 4YLGA 1CJTC 4NCIA 3K0CA 3U44A 2BOVA 1S4QA 3W5IA 3CRW1 1RZ3A 3UEYA 3KL4A 1TQ2A 4TMKA 4F38A 1CKEA 1TQ4A 4Q9IA 4L5BA 3U3JA 2R6CA 3RWOA 4RD0A 5SZJA 2CCGA 2Z83A 3WHKA 1ZC4A 3E2IA 2ZYWX 3GJ5A 2F55A 4HATA 4AKIA 3CX7A 5AWFC 3SS8A 2Z0MA 4G5SA 2A2ZA 4M1WA 4WAUA 4DT1B 4LJ9A 3TIFA 2J7PD 3KTAA 4K81B 1J7KA 1PZNA 4M2LA 5JWHA 2ZRMA 2HF9A 3GD7A 2FFBA 4LJ5A 3BOSA 2PCJA 1GIAA 2ZEJA 2ZJ5A 2GXSA 1A2BA 3L0SA 3ZQJA 5BYJA 2YZ2A 4XVQA 5HTKA 4HAVA 2R44A 3WBJA 2CLSA 2REOA 5FBWB 1WCV1 5ELXA 1G7SA 1UJ2A 1N6RA 3CWQA 2VHCA 1SVMA 3LQQA 1QHHA 3CIOA 5L3QA 2EFCB 5KDDA 3VNVA 3EARA 3EPHA 1L4UA 3WMEA 3RS0A 4POAA 1ZC3A 4LPSA 4EFNA 3TGPA 2IEZA 2CCJA 4CYMA 1Q1EA 5B58C 4EUNA 2ZU0C 4RD3A 2R9VA 4II7A 1AQYA 1FMLA 3I5XA 1U8ZA 4OK6A 2ZYVX 5IHPA 2ZREA 2PZEA 2C9YA 1E0SA 2ODWA 2EFDB 3FHOA 2VHJA 4OBEA 1V5WA 2AK3A 3C16C 5C4GB 4OHYA 3Q72A 4GRAA 4PO9A 1H8HA 3LVRE 1XEWY 4N1AA 2C9OA 4F4IA 1P3JA 2VTKA 4DLZA 4GOKA 1Q21A 5F9HA 2B7CA 2J5XA 1YR8A 3TK1A 2OESA 1H8ED 3A4NA 1EG7A 3UG7A 4DIEA 2BMJA 5C1BA 4TL6A 1F6BA 4HAZA 3UGIA 5KDLA 4GP7A 2OBNA 4XTRA 3NBYC 3T15A 1CR4A 1E1RD 2O52A 2OM2A 4EAQA 5G40A 2C2HA 1IN6A 1KAGA 1G41A 4XJXA 3TVTA 4CEJB 2O5VA 4Q1EA 2WM9B 3GEHA 3KZ1E 3PJRA 3SE0A 4R71A 1PLJA 3X1WA 2IF2A 2V7QD 4IVPA 3CO5A 2X1VA 4CGZA 4OI0A 3AVPA 4B3XA 4BFVA 1ZCAA 3EAQA 5TMPA 2WIBA 3MSXA 2C8VA 1U8AA 1E9FA 2I3BA 2PZFA 4QFMA 2PX0A 3G82C 3K0SA 4TLDA 4PPQA 1Q20A 4KVGA 3GLFB 2G3YA 4EPXA 3T61A 1E69A 2V6JA 1PUIA 4I1UA 5CB8A 1N6HA 1EGAA 2BHRA 3L0PA 2Q9AA 5J4HA 3SN6A 2ECKA 1OXUA 1E0JA 1W0KD 1N5JA 3R7WA 4E07A 2QBYB 4TWZA 4DZZA 2FH5B 3HU2A 4RD4A 1HUQA 1AM4D 1D5CA 2WMOB 1P62B 3T34A 2BMDA 3LXXA 1OLOA 1QHXA 1NVVR 1VCOA 4NCNA 4D2IA 2DCUA 3ZGXA 3WNCA 3D31A 1NLYA 3WY9A 1SVIA 1Y3AA 1S96A 2IA5A 4JVMA 3SEAA 2I1VB 4IHQA 2EYUA 5C18A 4MQBA 2IWHA 1N5KA 2EVWX 3LA6A 2IT1A 1RRPA 2CMKA 4MYCA 1G9XA 3K9GA 3GCGA 2W2TA 4KYUA 1F2TB 1GRQA 2OSBA 3VQTA 1JQJC 1WRBA 1TL7C 5TARA 2AKYA 1YZLA 4A8JC 4W9MC 1CRPA 3RC8A 3GJ0A 1U90A 4B3CA 1VG1A 1YKSA 1HY3A 2XSZA 2ZRJA 1IBRA 1P2TA 2QSYA 4OHXA 2ZXUA 1V43A 3WP0A 5FUWA 1CRQA 2OCYC 3IILA 1XZQA 4HB2A 4R2IA 1G8HA 5IT5A 3A1TA 4Z8YA 1CTQA 1UKVY 4Q9JA 2CVFA 3AH8A 3IBGA 3WNBA 4B6FA 4Z51A 2VF7A 1OIVA 5EXSA 2GXUA 2WOJA 4XVUA 2XAUA 2QBYA 1P5ZB 3X1DA 4A92A 1NG9A 2ZSFA 2FZ4A 3PUVA 2YWEA 3VU9B 2W00A 4ZO4A 2RGGA 1XTIA 3BRWD 4F93B 3CRVA 5L3VA 2VSOA 4YMVA 2ODEA 5FL7A 5AJVB 1G16A 3AVQA 2QTFA 4NCKA 1IJEA 3KY9A 3AF2A 3QXSA 2IW3A 1KI7A 1MH1A 2BDTA 4CT4B 1ZBDA 1FW6A 2ATXA 1RPZA 3QKRB 3SZRA 1KTVA 1U9IC 1KK1A 5L3SB 3SNHA 3PR1A 3TBKA 5JRJA 2ONKA 2QY9A 4HZIA 2PT5A 4HB0A 1RRFA 3RWMB 4M21A 4LUCA 1DARA 1Z6AA 4CEIB 1KSJA 4ABYA 3R9WA 4X8MA 1YZQA 1F5NA 3IEVA 1FNMA 1W5SA 1SKYB 2CEAA 2KBFA 4XWAA 2GZDA 3L2OB 4NYMR 4BFTA 5TXGA 2F7SA 3OEED 4Q4HA 3LH5A 2FDCA 2VHQA 2QPOA 1E9DA 1IXRC 2FA9A 3VU9A 4WOPA 4XTCS 4Z8XA 2QU8A 1I4LD 4YMTA 1WQ1R 1SVSA 2RGEA 2VA8A 4QNMA 2HLDD 4IOJA 4BZQA 4TMTA 1L8QA 1UADA 4A0FA 3OE7A 2HT6A 4TMXA 2MSDB 1IN5A 2X2EA 2ZI4A 1LV7A 5AJZA 3SR0A 3SI7A 3FMOB 5CLQA 3GLIE 4WZ6A 3VHLB 2VLIA 1P2SA 3KQHA 4IDHA 3QKRA 4C30A 1P75A 4QRHA 3U7GA 1W2GA 2OXCA 2C99A 3A4MA 1SKQA 1LY1A 1T9HA 3RRNA 4HB3A 2HXYA 4QBHA 4BE7B 2A5FA 2V54A 3DM9B 1IM2A 4DEYA 1OFIA 2WKRA 3S1AB 1N5LA 3EZFA 4QL3A 4CEIA 1JPNA 3L43A 3B1ZA 1K5DA 5E7JA 4C0KA 1KK3A 3UGLA 3VAAA 1RRGA 4NDZA 1KSHA 1R5NA 3KXLA 3PIRA 4C4PA 1LS6A 2D4HA 5C4MA 5EE0A 2CK3A 2GJSA 2UZIR 3NBXX 5J5CA 5FTLA 4TSFA 5EP1A 1OFHA 3QE0A 2J41A 2GVZC 3HPQA 5CYOA 2WKQA 2PT7A 1W47A 4LJAA 2QT1A 4PC7A 4EPWA 5DN6A 1E2IA 1WMSA 2ZJBA 3P1JA 1T5LA 1QRAA 1EX6A 3RVBA 3PITA 3CF0A 3CONA 5JEDA 3WP1B 2O0JA 4MYTA 1GM5A 2JA1A 1OIXA 1C4OA 1P9RA 4F4JA 2GJAA 2H8KA 1FNNA 4Q18A 4DCUA 3L8YA 2OE2A 4PPNA 4O3MA 3JVUA 3UKDA 2IK8A 4FXPA 4BLPA 4E03A 3NBFA 4OK5A 1E98A 5DYIA 5GJCA 3SYLA 2ANCA 2IC5A 3A1WA 4G5RA 4LC0A 2P65A 2VH5R 3KKOA 3DOFA 3ADKA 4MRVA 3S1AA 421PA 2XB2A 3LBIA 1G4AE 3T12A 2XJ4A 4ACAA 2QN6A 1KAOA 4D6PA 2X19A 5KUTA 2ZRLA 5B57C 3EIQA 1NF3A 1VCIA 2JLSA 2XOKD 2RGCA 4GDFA 1LFDB 1P73A 4TN1A 4RCYA 4DB2A 4B2IA 5JHGB 2J7PA 1YHNA 2V55B 2XNDD 4QGAA 4AKHA 2RH5A 2B8WA 5FOVA 2GCPA 3EW9A 5GADl 2BIFA 3HYTA 1I4DD 3THOA 721PA 2JIZD 2AWNA 2BJVA 2G1KA 4K46A 3JZMA 4M9ZA 5EP3A 3B60A 3LV8A 1KNXA 4IW3B 2PH1A 4KLNA 4FMDB 2GF9A 4JT4A 1W4RA 5AK0A 4B6DA 3QG5A 4D0GA 5TV2A 4ZKEA 3ZD7A 4KVAA 2NPFA 3DHWC 1WA5A 5SZHB 2OG2A 5CJ2A 1U99A 1US8B 1XMSA 5CIWA 1BH2A 3PVSA 1GTVA 3LNCA 4FI3C 2ATVA 2AFHE 1PTRA 2EWWA 3REFA 3SU8A 3T35A 3NDPA 3WYAA 4XD7D 5KNDA 1Q22A 5G3ZA 1NN3A 3OIYA 1N6PA 4RZXA 2QQ0A 3L82B 4P4TA 1P9NA 4V0NA 2D7CA 5JFGA 1N6OA 4PC2A 4TL7A 3EG5A 3EIHA 2ZRCA 1K8RA 4B6EA 1I2DA 1F2UB 1SGWA 5HCIA 1ZM3A 1ZNZA 1EFCA 3K0FB 5FOWA 5GVRA 3MG9A 4GMDA 3RRZA 4LHXA 2W83A 2QZ4A 1SXJD 1NBMD 1XP8A 2OFXA 2OO7A 1H8EA 1CU1A 2WJIA 4PAQA 3U5ZB 3L8ZA 1E96A 2QI9C 4A4DA 3FDIA 1NP6A 4QGHA 1FARA 1DAFA 1ELOA 1KNQA 3FMFA 4LBWA 3PEWA 1XTQA 4ZV4A 4TLCA 1T8UA 3AVOA 2UVQA 3CRRA 4Q7JB 3FTQA 4EIWA 1VTKA 4EJSC 1W46A 1E1RA 1G7TA 2GZHA 2ENNA 1HQYE 3AVXA 5GJBA 1US8A 1ZUIA 3I1FA 4OQLA 2Q9CA 2UKDA 4IEIA 2OBLA 2WWGA 1DTSA 3PEUA 2AR7A 2X77A 5EE3A 2V7QA 2CHQA 2IUTA 4FWIB 4URZR 5EZ5A 2N42A 2R6DA 3NVAA 5BXQC 4BRUA 2W2XA 2LWIA 4CIDA 1DG3A 4OKSA 1BIFA 2GAAA 4ZCIA 4MITA 4HLUA 3K70B 2HT1A 5KPDA 1QHNA 1GITA 5LB2A 2GK6A 1OYYA 1JEEA 3PUZA 2OUKA 1CP2A 5CM9C 3K0FA 3RS7A 1AGPA 4TYNA 1YR7A 1Z0DA 5JS8A 1SVWA 1FP7A 2BMEA 1W2HA 5FTJA 5JJIA 5H68A 1GL6A 2H17A 4AKGA 2R2AA 1W0KA 3BK7A 1QVAA 2WKPA 3QG1A 2FOLA 2K5UA 4IDOA 4A0HA 1MT0A 1QDEA 2A78A 1YQTA 1KO7A 1RC8A 3TR5A 2Q3HA 4RD2A 2GXQA 4ZDIA 1W36B 2WWHA 1KJWA 1XXHB 1ANKA 2QM7A 1BKDR 4TT3D 4PSVA 1XMVA 1LB1B 1NNEA 1GKIA 2BCJQ 2VO1A 4MDFA 3C41J 2J0SA 2FJUA 1KGDA 1A5TA 4PHHA 4QHYA 2GNOA 621PA 2VP9A 4GL2A 4ZCLA 2RHMA 2NOAA 4OJQA 3U3RA 4LK2A 4A6PA 3VX4A 4MRPA 4PX9A 3KXKA 3F5FA 4RJLA 2Z5FA 5JMTA 4UNSA 3EC1A 1EK0A 3W3ZB 1M7BA 1N6LA 3GPLA 3MWKA 4LJ8A 1Z3IX 4NKRA 5BN3A 4LJ4A 1W5TA 3NBZC 3QBTA 4KBGA 2R6FA 2JJ1D 2IUUA 1M6NA 1KDRA 3FVQA 1IQPA 2OXRA 4I4LA 1NVWQ 1VIYA 3IKJA 4AYWA 4DCSA 3ZD6A 1U81A 2Z43A 3OHMA 2ZYUX 5AJXA 5KSPA 3WRXC 4V0LA 1W0JD 4TMZA 4HLDA 3KQUA 1XXHA 2ZI7A 3FKQA 4G5QA 4PZYA 1IY0A 1R4AA 3CZPA 2OLKA 3IHLA 1GRNA 5J4VA 1UEJA 4CEHB 1KBEA 4Q19A 1GL9B 2XEXA 3RS3A 1C9KA 3OAAD 2ZE5A 4Q7KA 5HE8A 1N2CE 3V00A 2J9RA 4FWTA 5JI2E 3FKSD 2W0SA 1LF0A 2UZ3A 4TQAA 5JZVA 1Z07A 4M9XA 5DYGA 4C2TA 1HT2E 4PFSA 1OB2A 2RCNA 5EXXA 4AD8A 2P5TB 1XEWX 3FFBA 1UDWA 5B30A 2RMKA 4IRUB 4GNKA 2NZJA 1T6NA 2V3CC 1MO5A 1U0LA 1NKSA 2FSHA 2EYQA 3CB4A 3OEEA 2CCKA 2XX3A 4JYCA 1ZRHA 4KLZA 2GXAA 3ICQB 2BBTA 3GJ3A 2ONJA 2YOGA 4EQ6A 1UBEA 2R65A 1G3IA 3R20A 1KIMA 1XEXB 1X86B 1S9HA 2F1RA 1CULC 3SOPA 1LS1A 3T5DA 3U6BA 2HLDA 1EFUA 4RZUA 2ZRHA 4A15A 2QMOA 3DKPA 4R2HA 4NYIR 2RGDA 2JLRA 1OKKD 3OZXA 4CEHA 4OK3A 4NYMQ 3FMPB 2IYVA 3C15C 2WSMA 1GSIA 1R8SA 4L9SA 1RIFA 2DWQA 5TDHA 4DCVA 4LV5B 4ARZA 4DCTA 1E0AA 2DB6A 4WZBE 2DBYA 3N2IA 2ZJAA 4PZZA 1G7RA 2ZSBA 4B3GA 2O0KA 3ND8A 3KFVA 3AVTA 1HA3A 1MABB 2ZRGA 1N6NA 3BH7A 4CW7A 4BGDA 3A36A 3IIKA 4B76A 4RSGA 4DLRA 1IXZA 3CPHA 4QBGB 3L0OA 4UNPA 3NEYA 3T1OA 2ZAOA 4QHTA 1ZJ6A 1XZPA 2BEKA 1Z6XA 1OV4A 3U2QA 3K9HA 1R0ZA 2OCPA 1M74A 4G0NA 4LGMA 2NIPA 1KYIA 2P67A 2ZR0A 1XEXA 3DPUA 3ZZ0A 1X1SA 3AP1A 3SJCA 4NCJA 2YNMA 4HAXA 3CPEA 1VKJA 4NH0A 1IOZA 1AS3A 2GVIA 3ASZA 4DSNA 5J47A 1FAQA 3ZVMA 2F43B 5SZKB 4N3NA 1E9RA 2J0UB 4C0LA 1A82A 3EA0A 3AP3A 3CLVA 2GILA 4AYXA 4B43A 2J45A 4QC2A 4DSUA 1ZNXA 1MABA 2ZU6A 3NG1A 3TUJC 1ETUA 2FGJA 3W8NA 4Q02A 5H70A 3C5HA 4LYAA 3AVUA 1TBNA 2YV5A 2XOKA 2EFGA 3MWLA 3WBKA 1Z08A 1EFRD 1ZCBA 1KO1A 2P6RA 4JS0A 1ZVQA 1VECA 1G7CA 2V4ZA 2XNDA 2YVUA 3AF4A 3LD9A 4QG7A 1FQKA 2FN4A 4M0LA 4WW0A 3UMRA 1E2FA 3FMIA 2GBLA 4A8JB 1JR3D 2JIZA 4V03A 1SXJB 5JEEA 2F1IA 4D81A 2IWRA 4WZAE 1XWIA 4JBWA 4I1OA 4JLAA 2EW1A 2V1UA 1CBUA 2ZUDA 2FSGA 2IYLD 3M0EA 4B33A 5IK2D 3A1UA 4GPTA 1AGRA 4RD1A 1VIAA 2BWJA 3DO6A 1E2QA 2DY1A 3E5HA 4AK9A 1SVLA 3RSOA 4K8OA 4NBSA 2A7QA 1VYTA 1G1MA 4H1VA 4PXAA 2WTUA 2F43A 1F3OA 1Z6GA 4PR0A 3EZ6A 3OFND 4HUTA 2JLUA 2WVJA 4B3BA 4Z54A 1NMXA 5K8UA 4M1SA 4XD7A 3B9QA 3OIVA 2WAXA 3BS4A 1IAQA 4J0QA 3TQFA 2VQSA 2DFNA 4JLDA 4JLVA 1KMHB 5KYKA 1XDBA 4Q7LA 2QPAA 3UANA 4MGIR 2AFIE 3Q7PA 2YUUA 3CNOA 1M2OB 1E2KA 4DT1A 2NZ8A 4BQSA 3HU1A 4DJTA 3U6KA 4JLPA 1PUJA 5EE5B 1KSFX 1P4SA 3IPXA 3VR3A 1VYUA 3KUDA 2VYFA 2W6ID 2XB4A 2Y8EA 3DL0A 3EXAA 3CF6R 1SXJA 1NBMA 5UKDA 1UBFA 1Q3TA 1XMIA 1ZW6A 2FSIA 1J99A 1OW3B 4DRZA 5KSYA 1ESNA 4PQRA 1P61B 4NPHA 2QUZA 4CZ2A 1NIPA 4JL8A 3LW8A 5AR1A 1TQ6A 1U8YA 5A5GA 3IPYA 4O2LA 1JNYA 2FEOA 1JEDA 1GKUB 1ZM9A 3U3KA 3KUCA 1G5TA 1I4TD 2D2FA 4N0EA 3DVLA 2WV9A 1ZUHA 3BJIA 4OJKA 2RGXA 4LX0A 4MKFA 4OI1A 5FI0B 2CLDX 1F48A 2V6IA 3VR4A 4DLWA 2C96A 2WWIA 4A0GA 1N6IA 1KMHA 4B44A 1E2LA 4G5GA 2VP5A 4U00A 3Q7QA 2HYDA 4QBFA 3BH0A 2FF7A 4PHGA 3T5GA 5HE9A 3N5CA 2BCGY 1FOEB 2QEQA 4ZDWA 1XTRA 5FTNA 2A30A 3BD9A 3GEEA 2BM0A 1U9IA 3TW8B 4Q47A 2ODNA 3R8CA 2AHOA 3LLUA 3FOZA 2ZQ5A 2D3WA 2ZRBA 2YC2C 3P4YA 1LF5A 1R6BX 4MYHA 5CM8B 5FPHA 4TYYA 1E3MA 5AUPB 3SQXA 1LVGA 3LLMA 3N2EA 3BGWA 4US2R 3AVVA 5E3HA 4AKEA 4TT3A 2EU8A 2J0QA 1E2GA 2JATA 2ZVPX 4CEJA 1NMYA 4JZKA 3KDSE 5DE3A 4GOXA 5G53C 2Z4SA 2ZE8A 4QJ4A 4GZLA 1YE8A 1SKYE 2RGNA 3JVVA 4JL5A 4IKEA 4L16A 3K8YA 4OI2A 5FUYA 3RS5A 4MGZR 2P2LA 1CR0A 3K70D 1Q57A 4PANA 4S35A 5LB4A 4LYJA 3T1TA 1E9AA 4WXPA 5FBRB 3SJBA 2ZE6A 2IYUA 1QHYA 5FTMA 3GLFA 1DAGA 3QI2A 3IUYA 4HEJA 1PLKA 5DSZA 3BAFA 3QKUA 4DSTA 3KQNA 4LRWA 4TYWA 3LBNA 1L7VC 3CM0A 3VR2A 2JJ1A 1VPLA 2IYYA 1XD8A 1XEFA 2O8EB 1RYHA 2J7KA 2YWFA 2JJ8A 4HLCA 1KI6B 4PC1A 1S1CA 2BEJA 3I72A 3TRFA 1Q0UA 1Z0KA 4Q48A 5DHAA 3TKLA 1GG2A 1OB5A 4YXWD 1W0JA 521PA 1W36D 1L4YA 1G8YA 3IIMA 1Q44A 2MSCB 3C8UA 5LBIA 4Y0AA 1AK2A 3B8HA 4NU0A 3TJZA 2PEZA 3PXGA 1JPJA 1TU3A 5CDFA 1MO4A 1SQ5A 2OILA 3A8TA 3Q8XB 3OAAA 4JLKA 4JLNA 4HAUA 4ZIRB 3TSOA 2C03A 1F2TA 3EZ9A 4UJ5A 2F3TA 3U7EB 3FKSA 5HCNA 3W3AA 4EDHA 3ZVLA 3IHWA 3TQCA 1Z2AA 3RRYA 5JCPA 2Q21A 1DO2A 1W44A 1G5PA 1M8PA 4D80A 3SBDA 4P31A 4LBYA 2Z6VA 1ZD9A 1W7AA 1XPRA 4LY6A 4C7OB 2QAGC 3U61B 3IO3A 2ANBA 1F60A 3X1YA 1II8B 2BMFA 1EX7A 3B1VA 5KSOA 1U2RA 1W4AA 2FFAA 2WMNB 2XITA 1GILA 1XA6A 5LPNA 3QF4B 1KI6A 3HU3A 4HDOB 3VFDA 4PPFA 121PA 2CE7A 1R10A 2WWYA 4IVRA 4PC3A 5DNYB 2OAP1 1UBGA 2QNRA 1E2JA 3THXB 1W1WA 3NXSA 3AVYA 2KE5A 3P4XA 4F92B 1S9DA 1OKKA 3V9PA 1AN0A 2X8AA 1T3SA 2AXPA 4HAYA 4NYJQ 4O25A 2P3SA 5KNCA 2CDNA 4ZIRA 3OF5A 4BLTA 1W4CA 1NKTA 5JSZB 5L3SA 3ZS9A 4PO8A 1XFAA 1OXXK 1OIWA 4PZLA 3ZYCA 2A5JA 3UG6A 1SZPA 1GOTA 2WHXA 1H65A 3ZIAD 4A2PA 1RFLA 4EJSB 1XPOA 2IYRA 2IS1A 3P32A 1R0WA 2FPKA 5DISB 1TQDA 3MWYW 2RAPA 1II8A 2ZJ2A 2XTZA 4Q9LA 3O8CA 2NO0A 3BXZA 5LD2C 3CH5A 2QAJA 2QQEA 1FZQA 2N1BA 3QF4A 2WJVA 1D9ZA 4EFLA 4URUR 1AS2A 3C14C 2IS6A 3U7HB 1ZNYA 5C2JB 4G5OA 4KYIB 5FOTA 4U7DA 4R7ZA 4NONA 5EZ6B 1E79D 3JZAA 2P6UA 1G18A 4FIDA 5FUVA 4A6XA 1JJVA 2IXGA 1ZM4A 1AA9A 4D26A 2QRZA 1QZXA 4QNRA 1NL3A 5JSZA 3GLHB 1VYVA 5KPJA 4DDTA 1XCMA 2DPXA 2VBCA 1D8TA 4NL4H 1KZ7B 2CHGA 3AUYA 3IQWA 4XWKA 3FYHA 4V0ME 4ZKDA 2ZE7A 2D06A 1MRSA 5JBQA 4ZDKA 1E94E 3MRSA 5CLLA 4F7WA 1JR6A 1YR9A 4UNRA 1LW7A 1ZP6A 3K0EA 3Q5EA 5TY0A 2C9CA 3VX3A 1G3UA 4CF7A 1EFRA 1PJRA 2IEYA 5H8WA 3TE6A 4HZUB 4Q4AB 2WWFA 3PENA 3ZZUA 2J46A 1OYWA 4HYYA 1JR3A 3HP1A 1J8YF 4P0TA 3LX8A 2ORVA 4OL0A 1Z2CA 2YINC 1BYIA 1OXVA 4G1UC 3O8DA 4US0R 4A2WA 5C46F 1G3QA 1KSGA 4CVNA 5IK2A 5A4JA 2FFQA 2REBA 4FMCB 4B48A 3GLIB 5DO9A 1DPFA 3KXIA 2D7DA 4JSTA 4O2RA 8OHMA 1A4RA 2NO6A 1WBDA 4EPYA 4FCTA 1XCPA 3SHWA 4UQOA 3UPUA 1UAAA 1MO3A 4IXNA 5DLQC 4BEJA 2BKUA 3D7MA 4HAWA 3Q9LA 3OFNA 3X1XA 3GLHA 2GWHA 3NKVA 2ZRKA 3TAUA 4DLUA 4BECA 3B1WA 4LYFA 4B2LA 1FUUA 2G0TA 3EPJA 1Z5ZA 1S3GA 1IONA 3X1ZA 5F9FA 3O47A 3RS2A 3R9XA 1XX6A 1X3SA 1GFIA 2GK7A 2ZJOA 1EFTA 4ILEA 4JVLA 2D74A 2H7VA 3VKHA 3RRMA 2A5DA 3SHFA 2FNAA 3GFPA 3HJNA 2IHYA 4DKXA 4RFSB 4NCHA 2YHSA 5JWRA 4WBSA 1LTQA 4HZUA 3GJXC 4Q4AA 2QENA 1DO0A 1HV8A 3GQBA 3AF3A 2W6IA 1XTJA 2AWOA 4F4CA 1ONBA 3UWOA 1TNDA 3PQCA 1TUEA 2H57A 1ODFA 4YMUA 4M22A 3PG5A 3RNLA 2FV8A 1U94A 3GLIA 4BPBA 3QQ5A 1YZUA 1KZGB 1P60A 4DB4A 4IJMA 1O87A 2ZI5A 4Y0VA 4FW9A 2LKDA 1BYUA 1HT1E 1DEKA 1NJGA 1J2JA 3QVVA 4ZI3A 1G3RA 3EWAA 5IDVA 2ZANA 2RKOA 3GP8A 4KFUA 4MUBA 1G8PA 2VF8A 3M1IA 4P4SB 1IHUA 2FG5A 2E87A 2FMXA 1ZINA 3CRMA 3MCAA 4GMXA 1TEXA 5JI3E 4QGFA 1S1MA 4KBFA 4GBMA 1UEIA 1B23P 3TMKA 1BOFA 1A1VA 1F2UA 4RFSA 5EUMA 5F98A 2HCBA 1JJ7A 4LHWA 5JWOA 3EZ2A 2A3RA 2AKAB 3B1YA 2OZEA 3D6TB 5L3RA 1IN8A 2KSQA 4Q9KA 4B75A 2LCFA 3K0AB 2AD5A 4KXFB 4XH9B 821PA 2VRWB 5DGXA 2QTVB 3P27A 4QBIA 2ZUCA 4XSGA 5EQTA 3TSZA 2W2VA 1P6XA 4QHSA 4Q4JB 4BLQA 1DELA 4LV6A 1D6JA 3IDQA 4MKHA 3U60B 2NTYC 2FFHA 1XD9A 4M1TA 2C95A 3SYNA 4JLJA 3OIUA 4LYHA 1J90A 2FEMA 5FR1A 4P33A 3U7FB 3QXXA 2R6AA 3FWYA 3PUWA 1JAIA 2DYKA 1CLUA 2WJYA 3I5YA 1KI3A 2FE4A 3ADDA 5J4KA 3LXRA 3EPLA 4TMVA 1YVDA 3B1XA 2QL6A 3LBHA 4MKIA 3AKCA 1T8TA 3QKTA 5JHHB 4TLBA 5G3YA 1XTSA 2JLQA 4XSHA 4YMSA 4MRRA 3Q5DA 4ZCMA 4Q00A 4US1R 2FZLA 2ZR7A 1X1RA 2ZSAA 1NVVQ 4U5XA 4TMWA 5HPYB 1C1YA 5KNBA 5P21A 3SJAA 1XNJA 1OT3A 1FL9A 2ELIA 1QHSA 4D4LA 1IN4A 3U3MA 1CR2A 2V1XA 4MRSA 4JKYA 2HUPA 2Q3MA 2ZS9A 3MGCA 2WSSD 4B2PA 5BQ5A 3K0AA 4LI0A 2B21A 4UNNA 2PMKA 4G01B 5AJYA 3UMSA 3SFZA 5HKKD 2QA5A 4RFVA 2I1QA 4D25A 4L8GA 5EP2A 1OPXA 2YKGA 2YOHA 4A36A 4BFXA 3QVUA 3QSYA 1VG0B 3PEVA 2RB4A 1D9XA 1OJLA 1R5BA 2AXNA 4YXWA 3WRYC 2QSZA 4UKDA 1ZU5A 1JQLB 4C0QC 2WICA 1DE0A 1PV4A 2H1LA 1WDTA 3B82A 4LBZA 1CS4C 2QPTA 1VG9B 4HUQB 4R98A 1WBBA 1SHKA 5J40A 3AM1A 1CJMA 1HYQA 4D4JA 1SVOA 4PAMA 1E9SA 1TBOA 1AZSC 1HE8B 4E09A 3O8RA 1CEEA 1LNZA 2ZITA 4H1UA 4NTZA 5KTYA 5B2ZA 1T91A 1RKBA 2ZM5A 3OESA 3SC3A 4RCZA 2ENZA 3GFTA 3AEZA 3KKQA 1S8FA 4PPGA 3V4RA 1KY3A 1Q1BA 3EC2A 3QEJA 3THWB 1Z6YA 2NQ2C 4DWJA 2VSFA 3LQRA 5FTKA 1QF9A 4M1YA 3AB3A 3PUXA 3T06B 3VR5A 1G3MA 3AQ4A 3KJIA 4DLXA 4MUAA 4HLUC 3F0TA 3QBVA 4LWZA 1U0JA 2VPPA 3MMPA 2WJHA 5KSZA 1GDDA 1WF3A 1Z63A 2J87A 2Q3FA 3U4QB 4YMWA 3EIEA 4AG5A 5TVKA 2YC4C 4QOSA 4A2QA 2VEDA 1RFHA 2ZAMA 1E2DA 3E1SA 3D8BA 1G8GA 3B13B 1FFHA 1UM8A 4JLOA 4FCVA 3F8TA 2BC9A 2WJGA 4IEEA 5DI3B 1YZGA 4HUQA 2B7BA 3BFKA 3M6AA 4FN5A 1OHHD 5JRZA 1JALA 1VHLA 3AKYA 4V02A 4C2UA 3LFUA 4FMDF 4B71A 4TQ9A 1CJKC 1S3SA 2FPLA 3MJHA 5FPKA 1EWQA 4MKGA 1KJZA 3IGFA 4LHVA 2ZRFA 3THWA 3ZIAA 3NTUA 5BWMA 1XU4A 3QPVA 5BN4A 2J3EA 4FINA 1R7RA 4GOJA 3B9PA 3ONWA 4LJYA 1SXJE 1NBME 1Z47A 2IYWA 4IOMA 3ETLA 3U3OA 2VHUA 3CUEF 5CK4A 5E95A 2HCJB 4AWXA 1UKYA 2ZR9A 4PC6A 2GCOB 1AKYA 2G6BA 1N0UA 4NE2A 2QE7D 2WWWA 4P4UA 4PAOA 1E1QD 4MRNA 2O8DB 1T3LA 1JXOA 1ZAKA 3MJRA 3U4QA 1KI4A 2JJ2D 3H0KA 4M9SA 3DZ8A 4YDHB 2PEYA 3AV0B 3VMFA 3LRPA 1X8LA 4P3YA 5KDOA 4XOIA 3DMDA 2HV8A 1Z6TA 4BZPA 3PCRB 3OIWA 5DI3A 1ZUNB 3GMTA 1DADA 1J70A 4QXAA 5KHOC 5FBLB 1E79A 1KDTA 3VHXA 2BBOA 3QXHA 4B35A 1KOFA 4BZXA 2OCAA 3ZLJA 1NIJA 1DAHA 4LHYA 2GA8A 4KODA 2HEIA 3FHTA 2PJRA 4HDQB 4JT2A 1HH4A 1OFTA 3QENA 3GLGB 2D62A 4JSYA 3N70A 2JLYA 1UPTA 4W5JA 1DS6A 4URXR 5E7IA 2NMVA 3UFFA 4IFEA 4IVQA 4WVFA 2IYZA 2J59A 4TLAA 2OFWA 4D0NA 4KJZA 2GCOA 5DH9A 3WMFA 2NO1A 3RC3A 2O8DA 3CXLA 1KDOA 3E70C 2QP3A 3NIBA 3NDBB 1EESA 3TUIC 3SDZA 4DSOA 4YONB 1TX4B 2JDID 3HWSA 3DEFA 1Z0AA 3BWDD 4L9MA 4C9BA 3GJ4A 2O8BB 1W48A 2QP4A 3CR8A 4LZZA 4OYHA 4RY2A 3UK6A 1KKMA 4DLTA 2W58A 3LAWA 2PLFA 2KWIA 4RD6A 4UJ3A 4A0RA 3QOFA 1IXSB 4M9QA 2KBEA 3QNUA 5FPTA 1MO6A 4AI6A 1UKZA 1EWRA 3REGA 1A2KC 2QMUA 3SJZA 2J0UA 2GETA 3GEIA 3Q3JB 3VR6A 2A9KA 3EWSA 1FTNA 2WPDD 3BB3A 3GLFE 3GLGA 2OEPA 3FPAA 2SHKA 3NC0C 3RDPA 2ERYA 4EKDA 2YYZA 1KY2A 4L4UA 1GZSA 4LJ7A 3EA5A 1TUIA 2GEDA 2OCBA 2NG1A 1MV5A 3EZ7A 2EFHB 3K09C 4TTRA 2X2FA 4MDEA 3I32A 1P72A 3RS4A 3DMNA 4BEBA 4D0LB 4PHFA 1KKLA 1RJ9B 4F91B 2DFTA
chains in the Genus database with same CATH superfamily
1LCIA 3ADBA 4FOSA 1B8OA 1XG5A 3CW8X 3PKJA 2WYOA 4UCFA 5MF6A 5BV8A 1JN0A 1ZM7A 2I8LA 1AB6A 1TJYA 1NXVA 4WUVA 4C08A 2DPYA 2LKCA 1RWXA 2HHJA 2E9SA 1KL7A 2FZKA 2K7FA 4Q03A 3HJUA 1GD1O 4QIHA 1P2VA 1W4ZA 1ZWLA 5CDFE 5E4YA 3DAPA 2KM1A 3QKSB 2ZIAA 3LVQE 3CSUA 2TMYA 4BNDB 1L5ZA 1Y3BE 4AKTA 3RYCA 1QVVA 4N01A 1ULNA 2IUYA 1OX5A 3UHPA 3F9CA 3FCUB 4Y8VA 3WAKA 3O2QB 3LX5A 1POXA 1L2TA 2Q46A 4EI2A 5FXMA 1PJ2A 4LY3A 3AVWA 1VZ2A 1XI2A 1EUZA 2G4CA 1EXWA 2P0EA 3N2ZB 4EO7A 2IYNA 4DLVA 3RRNA 1S89A 1TYZA 4HDNA 4IXMA 2NV0A 5CJJA 5EPEA 1Q83A 2HDNB 4IFTA 4RZ2A 5FFMA 1UWCA 2GEUA 2QGFA 3A1FA 2IXEA 5AKXA 1ZUD1 4S0XA 3ANXA 5EYPB 1E5XA 3USES 4MWDA 4DUGD 1KBOA 3VTFA 4ZYTA 4TSKA 1I4EB 2X0FA 2PLNA 3ORFA 2X3YA 1B8UA 3G89A 4Q9HA 4XB2A 3KPVA 1X6VA 2R6GA 3D4LA 4JR2A 5ICEA 2BR3A 1GV0A 3C8HA 3CX8A 2A5YB 2HPVA 3A3OA 4UEQA 3H9CA 2XZLA 4J8PA 2X4DA 1LK0A 4N8DA 1ZI8A 2OLEA 5JS7A 2GYVA 1Y7IA 3Q7TA 1BMFD 4IHJF 5FO1A 1JVNA 3IAXA 3P94A 4JR0A 4JVNA 4QPNA 2FW9A 4O2AB 5EKDA 1DQSA 5IRCD 3KJGA 2XADA 4M8IA 4UAUA 4C20A 2AOXA 3FPFA 3HE3A 1NXXA 2J3QA 1YBFA 4C0XA 1INLA 4HDRA 4HDSB 5FI3A 1BWPA 2AE1A 3CNNA 4O4JB 5IH3A 2CJWB 2FX3A 1EUDA 2GBLC 1SHUX 2O8VA 1CR6A 2JGNA 2ZCVA 3IDSA 4FDUA 3SX2A 4H9GA 5DV9A 4E5SA 4UOEA 3IKMB 1YRHA 1KHTA 2XGMA 2D5IA 3DUFB 1IQRA 2HF8A 3VKWA 5A3RA 2PV7A 3ACBA 2JGMA 4J49A 4I46A 5A1TA 5D1HA 3KHSA 1JSXA 3C4VA 4ZV9A 1NULA 3WKEA 1VMAA 2OV1A 3IBYA 1YDEA 2QLTA 5KYYB 1ZI6A 1CZLA 2GAOA 2FWRA 3L7YA 3UAWA 4J0DA 3FNFA 4XQGA 3V4SA 4CI9A 3RVSA 2AG0A 1ZLYA 4WXHA 3BB4A 3IL2A 1KVRA 7WGAA 2H3HA 4HB4A 1RXUA 3ECAA 3L6CA 1CQIA 3K2EA 2VWPA 2WP0A 4IQGA 1FRQA 4X84A 1ZH8A 4CBVA 1GNQA 5KTNA 3I8XA 4EK9A 2G7ZA 3RPEA 4D5GA 2BDUA 5M29A 1WB9A 2VTVA 4M1MA 5A4KA 5JAOA 2CE2X 1CY4A 2Q07A 2V8BA 3HXMA 2DVMA 4NZZA 2BPOA 1N0VC 5HF8A 2YXPX 5J4YA 3VDUA 1M0SA 4K9KA 1TLTA 1Q0LA 4G4JA 4PEVA 3RV3A 3WDMA 3ZLUA 2X13A 3RM3A 2PX3A 1E3IA 3LT4A 3M6LA 1PFGA 4MARA 4RSMA 2ZTSA 4MAFA 2O2YA 1WQ3A 3IQFA 1IY1A 1QE3A 3M5DA 2ORWA 1O3YA 3HEAA 1Z5OA 4D1YA 4NPCA 4B82A 2B9VA 4NCBA 1OZFA 2QJOA 3I2IA 5G4KB 4TTVA 5A0FA 3KXPA 3L07A 4RSRA 3BIFA 4XSVA 1FS4A 1OFGA 1YQXA 4G5YA 1A3CA 1M6YA 2G9UA 2ZBEA 1CQWA 2FFJA 2NQTA 4YCAA 4DM4A 2DEUA 3WLAA 5LXTF 4NAUA 4XVRA 1QG4A 1ULUA 4R0NA 1N34B 2XXAA 4C05A 2QUAA 2X7JA 4O4IA 3LXUX 3EFBA 1A76A 1G0NA 1EH5A 1CZHA 1KI9A 1NZDA 3EVNA 2IOYA 3H1FA 3LUAA 3MD0A 3SK0A 3A6PC 3V4LA 4S05A 2X3UA 4ZZIA 3JYOA 2NO7A 2QTHA 2OP0A 2ZLBA 2R84A 1A95A 4JQOA 2QP9X 4KGXA 4RU1A 3GJ8A 3PFBA 3A6DA 1WDMA 3K9BA 3E9EA 5EE9A 3ST7A 3T5BA 3FNRA 5LYJA 3QUQA 4KX3A 3PD0A 3U3DA 3WB0A 3W5BA 1LTHR 4LBVA 3DVAB 4P5PA 1G21E 4RTQA 1UBCA 1PT6A 5L40A 1QANA 1V1JA 1K5GA 2HRQA 5K8JB 1YGYA 3OOJA 5WRFA 5HS4A 1JZSA 2NX2A 1QO7A 1RE1A 2X86A 3E2PA 4FYJA 5G0WA 5KTTA 3U5TA 2FUG6 3AF5A 4YAFA 1U1CA 4NHOA 5CJPA 4XJVA 3TNFA 4ACBA 4ENVA 4EJ2A 1AN1I 1XIVA 1TOTA 1KS2A 3N28A 3C3MA 2DQKA 3MOIA 3GLHE 4YHHB 3LKDA 3NYIA 4QG3A 1Y5NA 4RVCA 3RV4A 4D9EA 1F8FA 1XTKA 4WXRA 1MX9A 1HLPA 3IYLW 4EG8A 3A6GA 4RCVA 3M3DA 3LTEA 1V5GA 1PL8A 3NHAA 4M3NA 4CQNA 1NN0A 3ITDA 2EIHA 1O54A 2L7XA 5HDBB 2JHGA 4XOUA 5TEVA 3SDSA 5CA0F 4V1CB 1WTAA 3QF7A 2K9HA 3PC6A 2H2WA 1EGVB 1KAMA 1CZOA 1ZRNA 2VF5X 1R79A 4YAIA 4U7GA 3RHZA 1AJEA 1X7GA 2VVTA 1RZRD 2VCYA 2O8CA 3R8FA 1JDSA 1OR8A 1DKUA 4CIWA 2GPYA 1AQNA 2DF8A 3KJHA 2C88A 2D3TA 2OCIA 2VZ9A 3M1AA 2O2IA 3VDRA 3QJYA 3H0CA 3GP5A 4EUKA 3KELA 3VYRB 3FG9A 1NMSA 4AF8A 1DJMA 5ES3A 3QU2A 2QKYA 4MYUA 1F0NA 1XROA 3AOEA 1JLRA 1X1EA 4MQ4A 1YD7A 1CJCA 2NO9A 2QE7A 3U62A 3A4TA 4I99A 2ATEA 4JNCA 3CWZA 1I01A 2GDJA 1XRNA 2X52A 4F9TA 1E9CA 1CY7A 1JS1X 3F2IA 3FDXA 2A0UA 3O5AA 2PGAA 2W6QA 3HY4A 4N0DA 3LOQA 2GJKA 1VLZA 4MUFA 1MA3A 1KH1A 5H82A 2DPMA 3DTVA 5FBZA 3THXA 4GVPA 4PG4A 1RXSA 3FMVA 4NZNA 3RBAA 1YVRA 1E6MA 1V6AA 2YJ6A 3KAPA 2KCXA 1R0YA 5LA6F 3K35A 5AVZA 1DFGA 3W7BA 1XMOB 3CB2A 2B9EA 1OE0A 3DDZX 5GIOE 2VTBB 2JG3A 1C1XB 3JW8A 4IDEA 2H9IA 2XE8A 1JI0A 4FNOA 2CLKB 5CYPA 2QRLA 2ZI9A 1P18A 1M2VB 4HY3A 4LDJA 4C0HA 1IM8A 4FLFA 4P3KA 4Q9NA 3SM9A 3TD9A 4LCBA 1AQUA 3QWPA 3OEYA 4EJSA 1X8KA 4DMUB 1FLNA 3E58A 2QZSA 1EHYA 1MOPA 3UIEA 3WQRA 2AGVA 1MHTA 3H5VA 4OAQA 2CMHA 1B14A 1ZK4A 1FPMA 2I4IA 5CVVA 5J1TB 1ZL0A 4ZT7A 3BREA 4EVRA 4EENA 1U4SA 4IQ0A 4RJJA 3CLUD 2O8FA 4OMFG 1N5RA 4BEWA 3TUZC 2XCUA 3E3NA 4HYEA 2GHIA 2XUOA 1DXQA 1N4DA 2E1RA 2PBRA 3GXBA 3M4NA 1I2CA 4JL6A 2B69A 2JDIA 2LCIA 2GTPA 1EZ4A 3R1IA 3ICEA 5H59A 1CUZA 4Y2VA 5T4HA 2HMVA 4MR7A 4RFLA 1X7WB 3T7AA 3UB4A 3W2GA 5DBOA 1EG2A 1GUDA 3ZE9A 3A7DA 1UHAA 1P7VA 2VPWA 3C4JA 1NY5A 4N3AA 1K3TA 2MSKA 3ZU2A 2YHBA 2FR1A 1C41A 1NXUA 2C5GA 3K6JA 3TOZA 4MQ5A 2AZDA 3C45A 2J4DA 3DOEA 1KQOA 1VDMA 1R66A 4O6VA 4WDRA 1HYHA 2RK6A 2OYSA 3KQQA 3X2SA 1Z2NX 3W6UA 1G8FA 3OLXA 3BMQA 4ZZ1A 3TOAA 2WPDA 4HI0E 3LLVA 3G0DA 2ZSEA 3H19A 3WO1A 3I4LA 4M8NE 2HJWA 2DUWA 4R9UC 4CMCA 3FWPA 2INGX 1NU8A 1G19A 4KWTA 2JBAA 4OQXA 2VIIA 4DDWA 2B4QA 3C7KA 2JFZA 3UEJA 4BAUA 3EGOA 1KO8A 2I34A 3N6RA 1ZO8A 3FUUA 4IP0A 1GAJA 4EMUA 1J8QA 2YIJA 1D2CA 3QWAA 3W1EA 3V7NA 5B3JC 1KJ9A 3IUQA 3N8NA 1AK9A 3RKRA 3MFQA 3QU9A 3HYLA 2BGJA 1WZUA 3T52A 2DSTA 4IQFA 1ZH2A 2VQDA 1W76A 3A1VA 4IXDA 5C5IA 3ZIAA 2IBMA 3NGMA 4R3UC 2H1SA 5C5CA 2VJBA 3FGOA 4XUGB 2PA0A 4U6QA 3HYNA 1GAXA 2PX8A 1XQWA 2BUCA 5L51A 3KKPA 1DQNA 1EX9A 3DBOB 2ACWA 1FFXA 1VG8A 3J81k 2BFCB 1KFKB 4RKEA 3VXKA 2R4QA 3IAEA 4PO1A 3IP9A 1H0SA 5FR2A 2Z2JA 4TLMB 2PUFA 1T2NA 4JB3A 1VXOA 5DWDA 4G84A 3O6VA 4K1XA 4C6HA 5CDHA 1G2PA 4PZAA 3BXGA 4M0PA 3VNRA 4NJEB 1WPQA 3VPHA 1R6DA 3HB0A 4OKNA 3QVGA 3ESZA 2FN9A 3RLFA 3ZGZA 4L9WA 2BCEA 1ID8A 2PKYX 4FOOA 3PDIB 3WKCA 3AY7A 5JVDA 1QPZA 1P2BA 4XLLA 1CDOA 4W5HA 4DUGA 2E49A 4JLBA 4FFSA 4DUYB 1CQJA 2PWYA 4AIIA 4F5EA 1FFAA 4OBWA 3WYGA 1WXEA 1T9DA 2VP4A 2PU7A 4URHA 5EIWA 4RVHA 1YU6C 3WHKA 4ERNA 1KEEA 2OBMA 3HCNA 5K2MA 5A4DA 2A7XA 3BJEA 3CE9A 2PO7A 2IPXA 3EHDA 1ZD4A 4IHKA 3DE1X 4P58A 3NC1C 3N2KB 4BNZA 3ELYA 5JADA 1BMFA 1P7YA 1E6LA 2VHTA 4CM8A 2Q2OA 4EGQA 3DTYA 3DMRA 1MRZA 2ZJZA 4JJ4A 1Y8FA 4RIEA 1F4PA 4JDPA 4U4AA 2IODA 2I7CA 4E30A 5G1NA 2I7TA 1ZWKA 4DV1B 2VZ8A 1I3MA 1ISHA 2BFBA 4L3VA 2G82A 4MW1A 3UAVA 1KP3A 2PPVA 1JL3A 2V6MA 1Y0BA 3AR2A 3IIIA 3OECA 2DBVO 4MOWA 5AK6A 1YE3A 1YMQA 1JIUA 5D8DA 1E32A 5HMMA 3GVXA 3OD1A 4KQ1A 3CBQA 5BN3B 2HK6A 2IQIA 4DLSA 1CUDA 4GLLA 1QGDA 2XHEA 2I7VA 4C0JA 1QG2A 1SKBA 3ZK8A 1HE5A 1I80A 4G67A 4TV9F 3HO1A 3GFBA 4HGNA 1U8UA 2C4UA 2CUTA 2ESRA 3DSRA 4Y9SA 3RHFA 1RQ7A 2DJ5A 1SVKA 3GX1A 2AUMA 3I2JA 5C3MA 3UXMA 4URYR 1P1HA 5TB5A 2GXAA 3FXAA 4PZEA 1QRSA 4U8HA 1JTEA 1ZW1A 4I5DA 3TOSA 1I33A 1TEHA 1TIPA 2NVUB 4E32A 3ICQB 3HS3A 4NPAA 5BSRA 2DU8A 5BUSA 4B34A 5K3EA 3TGWA 1USIA 4P3OA 2GKGA 1LDYA 3VDQA 4CMAA 1MG0A 4REQA 2EP7A 3O8QA 3VO9A 1GWNA 2P7IA 3BTVA 3PFIA 3UK7A 3ZNNA 1ST3A 3V1LA 1PJBA 5FI1B 3WFZA 4DY6A 4NXMB 5NULA 2J4FA 2D1RA 4QDTA 2XEDA 7MDHA 1MOZA 2OT3B 3F96A 4ZDJA 3BERA 3LP8A 2PGIA 2PSDA 2GJ9A 1YWGO 4FHGA 5HZHA 1R9GA 3WGLA 2RARA 3V2IA 4YQFA 1Y5RA 2ZPTX 2AK2A 1NWHA 1I10A 3L1HA 1U7HA 3G5AA 4Z2YA 3ZKAA 1SA0A 3D8TA 3I3OA 1UDXA 2IYXA 1NVUQ 1XLTC 2VXOA 3CZRA 4I1VA 4RGQA 3E9QA 3TW6A 5KTSA 4EPVA 5JSHA 4J03A 5K8IA 1D2MA 1LGYA 1J8MF 3I5AA 1FIUA 3OI7A 2ATIA 1WUHS 3DAOA 1WZ2A 5JQWA 3EC7A 1N0WA 1C3EA 1SC9A 3AF0A 1D0SA 3DLTA 3GMIA 3I92A 3MTDA 3HNRA 4KFSA 1ODLA 3RSLA 2WYHA 3BMNB 1BVUA 3F4LA 5DLPA 1MDFA 3CNQS 1YZKA 3P7MA 4EQ6B 1J23A 3LX6A 2DHRA 5B1EA 2IZ1A 1MX3A 1BG6A 1UKEA 3PDJA 4Q4LA 5A3QA 5HQTA 4EITA 2P2YA 4GE0A 4DILA 5REQB 4YAKA 5FL7D 4D4HA 3BB1A 3S8YA 4JUFA 3OLQA 2DR2A 1LBEA 1J56A 3KE9A 4BLSA 4HX2A 2RHJA 2IUSA 1JSCA 1RPTA 1V1RA 1MR3F 1VKOA 2YQZA 4QU8A 1I6WA 1WE2A 4O1IA 4QYWA 5EWLA 2B1IA 3VH2A 3OM8A 3QEOA 2BM9A 3F6EX 3HR8A 1DAKA 4E5MA 1VJGA 1GT91 3ZEAA 1B8NA 1V3TA 5GAJA 1FJ2A 4PIVA 4PQFA 4WVLA 3H4TA 4DIDA 1DRKA 3GA0A 5LQDA 3IVRA 4OHPA 5EGSA 3ZWCA 3GLGE 2GN2A 2P6NA 4R5HA 1Z7WA 2Z2XA 3TD6A 4CKWB 5J4LA 2PSJA 5KYTA 2H1VA 3TRJA 3MTQA 1RBZA 4GECA 1YUMA 3RAFC 1ULKA 1JFFB 1GG5A 2BEVB 3OE1A 3QIAA 1D4OA 1NFQA 4FMCF 4X64B 3I4FA 1DUSA 3GD5A 1RZRA 3AQIA 1IRIA 3IXQA 4OHMA 1Z0JA 2HA7A 3GOXA 4W9NA 2EDCA 2VRBA 2CVPA 2HF7A 3N76A 2ZB2A 1T0JB 5AW9A 2QVLA 2E89A 3EZGA 3STXA 2WF5A 5BV7A 4YUZA 1ZYUA 5IAJA 2YWHA 5DZSA 4DQDA 3CRQA 1W75A 2Q9BA 3LO5A 5LP6C 1F6DA 1GCAA 3NJRA 4IIFA 5DIFA 5JAHA 2C1EA 4JI0B 1EVZA 3QJGA 4L8VA 3WL3A 1TTTA 2ZCUA 2C5AA 4P7FA 1NUHA 3K70C 1ZOOA 4NBRA 5EJAA 4BNHA 1U7PA 2PIDA 3AUXA 4EY6A 3FYUC 2EGGA 2BD0A 3Q6IA 2YWGA 1NMQA 3I9FA 3QBDA 4N47A 3W9UA 2WG2A 2YQ5A 5DI9A 1XB2A 1PSDA 2CWDA 2WHPA 2RD2A 5IM4A 1E5VA 2YWDA 2DPLA 4BUCA 4M8KA 1H2YA 1T8PA 3EPPA 3DV0B 3H86A 3JZFA 3W6OA 1O5OA 5FPYA 3ZBUA 2LB7A 2FMIA 4R1SA 1VPTA 3B85A 3AJDA 3FDJA 4CODB 1I4WA 1L3CA 2LGJA 5CEEA 1EYZA 2WZCA 4DXAA 3SGBI 5EMMA 2F2TA 3FX2A 3R7FA 3STTA 3FTCA 4KCGA 5TT0A 2Y2UA 3K53A 1BMQA 1KK2A 2NW6A 3M89A 2WVHA 3MF4A 4GHWA 3W90A 1S2OA 4DBZA 3SYKA 1HTWA 2WAAA 4OSPA 3O8OB 1FPQA 4EJ6A 3EF0A 4TUYF 2FF5A 5BQPA 2PZKA 2ZTVA 4V0OA 3DKVA 5M04A 1BOOA 3HB4X 3WXMA 1NW7A 3IEUA 2ZRAA 1JE1A 5IBPA 1CY8A 5CBKA 1RI3A 3ZDEA 1E92A 4E5PA 3JWEA 4RMJA 4IIDA 1PK7A 1D7OA 1FW8A 1RRCA 1HQDA 2P41A 2X2OA 4FR0A 4YPOA 3K0CA 4RLFA 5DBEX 3U44A 3IAS6 2D1QA 2JI8A 4ZEOA 5IEBA 3LWDA 4FLMA 4N40A 1S4QA 1DOHA 1QIHA 2AX3A 1RZ3A 1NVFA 1ORTA 4LRTB 4MMZB 4RW0A 4YBRA 4DIMA 5E6UB 2ZWPA 4F38A 2HC9A 1V25A 3JQGA 3PA6A 3KLBA 4Q9IA 4L5AA 3U3JA 1MORA 2WB4A 3BM5A 3RWOA 3SY8A 4RD0A 3PWZA 4G24A 1NR5A 4ND8B 2NU1I 4QECA 4ZP1A 5AJUA 3GPBA 1ZMOA 2DLDA 1UFOA 3AWDA 4FYXA 3SCZA 1XVAA 3SWWA 1T9GR 3GOHA 1GPKA 1H0HA 2OQ2A 1Q7TA 2VHXA 3DMGA 3FRIA 2QD3A 2Z0MA 3IP3A 3NU1A 3Q15C 4ITUA 4MDHA 4NJMB 1T2EA 3UOWA 4BAZA 2PY6A 3CUTA 2QRUA 3AEUB 3T3HA 1QLWA 1CDDA 4M36A 3TIFA 3UFXB 4B7ZA 4CM4B 4YVFA 4OH1A 1O7JA 1PZNA 4M2LA 4DPKA 4PVCA 3GD7A 4QOEA 4UHKA 4XIYA 2PCJA 2OZVA 3AOGA 5FT9A 4WJLA 2GXSA 3L0SA 2QD4A 2V53A 2VLBA 1LPBB 3GH3A 3OOHA 1Q77A 2WUGA 2YZ2A 5DYYA 3JAKA 4HAVA 2R44A 5CLHA 3WBJA 4DZRA 2JAXA 3QVTA 5DLYA 4DR7B 5KOIA 3OQIA 5ELXA 1G7SA 4MIKA 3WK5A 4A3SA 2PRJA 2VJMB 2PXHA 3CWQA 4JGBA 4M0FA 4N03A 5EIXA 1SVMA 2Y76A 1YB5A 4JWKA 1QHHA 1PR9A 5FJIA 3B1JA 4HEQA 5IF3A 5KDDA 3ZWPA 3WWYA 4OB8A 4CCWA 4A5OA 3EPHA 2O50A 1L4UA 4L51A 3WMEA 3RS0A 3OFKA 4TKMA 1BMDA 1L3IA 3UUFA 3WGQA 3WWDA 3E1GA 4UHJA 2ZJ6A 4LPSA 5DLDA 5EZSA 4EFNA 3TGPA 3TO7A 2HO4A 4KLRA 3RAGA 1Q1EA 5EFOA 3FPJA 3UT5A 4CU5A 2ZU0C 2PS0A 4DANA 4RJIA 2RC6A 2XGOA 3EVFA 1JQDA 2VYQA 3WDKA 1FMLA 4KAJA 4H4CA 4KR0A 4U7FA 2ZYVX 4AJPA 1PJSA 4FYIA 4WP4A 2R1VB 2JAUA 3I64A 3AXSA 2PZEA 3OPYA 4ZZ3A 3C6BA 1WW2A 5JBIA 1E0SA 2ODWA 2EFDB 1WQ4A 4HWSA 3D8RA 3PZRA 4HKTA 4WZBA 5IDQA 1E6EA 5JARA 2BP7A 3NTVA 1V5WA 2QMYA 1HBJA 4RXTA 1SQSA 3Q72A 4K03A 4TKUB 4CG0A 6NULA 1XEWY 3NC4A 3SYTA 1BE8A 1A8QA 4DLZA 1B2LA 3ME5A 4JI5B 5F9HA 4MTCA 4B7UA 5KC8A 2J5XA 5HGJA 1LDGA 3IXMA 3KVVA 1H8ED 3PPWA 1EG7A 1ES9A 4IGAA 3F5DA 4MV6A 4N3GA 1R1DA 4PZPA 2X0EA 4EELA 1F6BA 2A1UA 2R6JA 5KDLA 3Q41A 4GP7A 5KU7A 1Q74A 5DXAA 1C1HA 1J6UA 1ESZA 3W8EA 2E4WA 2RGUA 3AEXA 4LS3A 4MQEB 2E0IA 5C8XA 4I4TB 1XE3A 3O4HA 5CNIA 1PZMA 1ODCA 2EZTA 2PX2A 1GT6A 4BKOA 4DWWA 4O29A 5G4LA 2FFRA 4Z1OA 2N52A 1ZPDA 2JS7A 2VAWA 3K0BA 4C7MA 5BPFA 4CEJB 1U7DA 3LL7A 2O5VA 3QH4A 1RWMA 2QOEA 5KQSA 3GEHA 3UWSA 5AHXA 4J0CA 3SC6A 4R71A 4H15A 4PS0A 5JSYA 1GXSB 3A6HA 4FNAA 3FSRA 2X1VA 1BHSA 4QTUB 1VE7A 1AQIA 3UB2A 3MTIA 5B1IA 3EAQA 4Z7OB 1Z7EA 3EXIB 2FUNB 3EXEB 5TMPA 5FLXA 1RYEA 3SIWA 1LLCA 1B00A 1YB2A 2GM4A 3LE8A 3ICPA 3IE0A 3P0IA 4YY3B 3KG2A 2C8VA 3JR3A 4H7DA 2YFQA 3C3JA 3Q40A 2QR2A 2FPIB 2I3BA 3AHCA 1LD3A 3ETEA 2WLTA 5T4BA 4E4TA 4A23A 3IAAA 1MC8A 2O7NA 3T61A 4MA0A 5IUKC 4EPXA 1G5FA 2V6JA 4MIOA 4N9WA 1RCFA 2IGTA 4OSOA 1ONSA 1N6HA 1EGAA 1UPCA 1DDOA 2BHRA 3IIEA 4B0PA 2ECKA 1W0KD 3PQDA 3D2LA 5L7YA 3R7WA 5BVHA 3L4KA 4HS4A 3AYZB 2QBYB 2ENUA 1VRCA 4TWZA 2FH5B 2O5RA 4CKBA 4DZZA 1PW5A 3KR2A 5DAEA 3PGLA 2AR0A 4AJ2A 5EQJB 1OLOA 1PEDA 4LECA 1C9DB 4YAWA 2JBWA 4NE7A 1Y6FA 3AB7A 2G9ZA 2X0JA 4ZI7A 5IJ9A 1EXDA 4UQPA 1VJ5A 4L0QA 2FXVA 2IA5A 4YT4A 3SEAA 4D5EA 5M5BA 4BMVA 3E59A 3OP4A 4QWMA 4OQYA 3TMYA 4CL0A 1ZFNA 4GMGA 2EVWX 5K0TA 1Z4QA 4Q3AA 4Q6WA 1SG0A 3JWIA 5F2NA 2OXTA 3W78A 1FP4B 4KYUA 1I2AA 2DOKA 1KARA 2Q1UA 2ZJ3A 2QIOA 4PQEA 3CGWA 1UMCB 1DCTA 1WRBA 5TARA 2AKYA 1YZLA 3OD5A 4YJ3A 2XXBA 1MC4A 1I0IA 4BMZA 2DTEA 3QVJA 5LNK1 5BYAA 1TW2A 3RC8A 3B3JA 2P4QA 1HL3A 3ZCVA 2AG8A 1V43A 4AJHA 2P2GA 3IILA 4HB2A 4URFA 1G8HA 3H99A 5JO0A 1W93A 2I6FA 3U09A 2JGLA 3GYGA 2FW0A 2F3SA 3AH8A 3RVNA 4X7PA 4MULA 2ZSIA 4AJEA 1QOZA 2BISA 5EXSA 2GXUA 2GTIA 2WOJA 4XVUA 3TS1A 1P5ZB 1TD1A 4A92A 3ZCSA 3B48A 2R8ZA 3RK1A 1VPVA 1HE4A 1ZK1A 1XTIA 2HDHA 3JQDA 2SCUA 3HNOA 4S1PA 4PO3X 5T5QA 4Q4CA 3U56A 2K87A 2XLBA 3H11A 3CRVA 1G55A 3FCEA 5L3VA 4YMVA 1P1CA 4BB6A 2XDWA 1ZEJA 2ODEA 2VBIA 3QVOA 5AJVB 5FL7A 2QTFA 4QE3A 1PJZA 3FUXA 5AYVA 1ZI9A 3QXSA 8ADHA 2IW3A 3FCOA 1ZKMA 2G67A 4BV8A 3OQVA 3ABQB 4I14A 1XZDA 4R2XA 3BD8A 3RIEA 2BDTA 4CT4B 5A02A 2ATXA 2JAHA 5LNK6 1BE0A 2ZIXB 1KTVA 3SZRA 1A2OA 1U9IC 5JSFA 5L3SB 2AVNA 1W30A 4NICA 3QLUC 4RK0A 2BGTA 2IXTA 3B3FA 4TRRA 4CHGA 3G0GA 5LYJB 2H1OA 4ZT6A 1LLFA 3TIIA 4XIJA 1AMOA 4M21A 1CG6A 4UUBA 4LUCA 5CFOA 7MHTA 3GGSA 3ZWVA 4CEIB 1KSJA 4NOKA 1QHEA 4JY7A 3DXXA 1YZQA 1F5NA 2M6KA 1WDWB 2FAXA 1L8AA 3H2KA 2XI4A 1N2SA 4KUGA 5CP8A 3UJ7A 2GPSA 1W59A 4QDXA 3M5WA 1SKYB 2CEAA 3JPYA 2OORA 5DNEA 3PLRA 3HH8A 3L2OB 1M2NA 4NYMR 3LECA 1LZKA 1XL1A 2BKLA 3V55A 3LH5A 1FYVA 1MAHA 3IKTA 2PD4A 2QPOA 2XDQA 1E9DA 5TIIA 2VK2A 4RH3A 4PV7A 1IXRC 4J0JA 4N48A 2V9ZA 2OVOA 4LDPA 2QU8A 2GD1O 4DHWA 1JKJB 1XPJA 4YMTA 1KMMA 5I8WA 4IX1A 1JLLB 2A59A 2NVBA 1HDRA 3H6KA 5AKGA 2YXLA 4H31A 3PRKE 3STUA 4TMTA 2BF4A 4D99A 1GPJA 1QIKA 2HT6A 4TMXA 2MSDB 1MOSA 1YFKA 1IN5A 2HBRA 2PS3A 5AVTA 4JCVE 5JALA 1GFWA 4BN5A 5CLQA 3JY6A 3NEPX 4PCLA 2C7QA 3FJYA 1AVTA 3LK7A 3LUJA 3NI2A 1BCRA 1XVTA 1VFNA 3QKRA 4C30A 4W82A 4QRHA 3U7GA 1W2GA 2QPLA 3A4MA 1SKQA 1LY1A 1T9HA 4H3HB 2HGSA 4HB3A 2V54A 1M2FA 4HQRA 3ZDAA 1OFIA 5IKEA 4QZVA 4P4NA 1VKHA 4KE7A 2H1IA 1JPNA 1R6UA 3U4AA 3CEHA 3NM5A 4YK7A 2O59A 3LT0A 5CX4A 1RRGA 3UMJA 1WABA 2BKAA 4WLEA 2JCBA 1KSHA 1R5NA 2JJYA 3WDLA 4N5IX 3FPHA 2P6MA 3AEKA 5J5CA 5FTLA 1QG6A 3DDOA 4DQKA 1K7TA 2CV1A 3OWHA 4FFVA 1FU8A 1W47A 5ILQA 4X66B 3V5NA 1LBHA 4GI5A 5JS1A 1NOKA 3I6ZA 4I2NA 2C1XA 1E2IA 1OBOA 1WMSA 1V11B 2V1CC 2QVXX 1QRAA 3AG5A 3FPGA 4W1RA 3RJTA 3CONA 3WP1B 2ZOSA 4HN2A 4MYTA 5K3DA 4DRXB 4OGKA 2H8KA 3JATA 1FNNA 1IBSA 1T8SA 3JVEA 4PPNA 4Q18A 4C3OB 3KJQA 1IBKB 2YNMD 2JRCA 1MAVA 3KYIB 4AJ9A 1GPYA 3QFRA 3EYWA 1P8JA 5B7QA 2G6TA 2A20A 1IYZA 2WD9A 1S7GA 2DHQA 5DYIA 4IKPA 5GJCA 4IPTA 4XYMA 2IC5A 3SYLA 1NF9A 1UC5B 4PG6A 2LRHA 1TFUA 3D4IA 4LC0A 2F3UA 4PTZA 4DW8A 4ARUA 4DJFC 4D9JA 3AHDA 3TIVA 1NP3A 3HBMA 2BGRA 3PPVA 1EJ0A 4B4UA 3DOFA 4JJ6A 1BA2A 4QGSA 4QBKA 5CH5A 3IP7A 4WD3A 1CY6A 2IEBA 4O33A 3T12A 2XJ4A 1FNBA 3HZZA 4ZJPA 3FZYA 1NA5A 1ZY2A 4D6PA 2X19A 5MHTA 1G8KA 1P1JA 1F8YA 4B3HA 3R9XB 3ESYA 2AI2A 1EWKA 4RADA 1FTQA 2JLSA 5JFOA 4ND2A 1RHQA 4B2IA 3KKLA 4F3RA 1Y6ZA 1QCDA 2V55B 2XNDD 3KYCB 4RANA 5DRTA 1A9XA 3TL6A 4IDBA 1OILA 2RH5A 2B8WA 3L02A 4OXKA 3EW9A 5E4TA 2C20A 3LY7A 1N5MA 3P0HA 4G85A 1HDEA 3ONNA 4IJ5A 3AZQA 3HYTA 5F1OA 721PA 2XVYA 2FG6C 1EEXB 1ULHA 4P5EA 2BJVA 2G1KA 3H4VA 4K46A 5EP3A 4EUFA 5BSVA 1Z4JA 4E2ZA 1TCUA 1KNXA 3EVGA 1SM4A 4DDKA 4BMYA 3AM3A 4IMPA 1SCDA 1T34A 2YWJA 4FMDB 1KDYA 4A7PA 2QRVA 1Q16A 4LXHA 4B6DA 3IERA 4O4IF 5AK0A 1C3VA 5T41A 4D0GA 4P6VF 3PGJA 1WSBA 5TV2A 4DCMA 3ZD7A 2O7RA 4AP6A 3OF2A 1VKNA 5AVSA 5SZHB 1HZZA 4J1NA 5CFNA 1SPBS 4JLUA 2O3UA 1UVFA 5CJ2A 2E5LB 5DM0A 4E33A 2DRIA 3EWNA 1BH2A 1GTVA 1VMEA 3H2HA 3LUDA 4X3PA 5JZBA 4L78A 1YJ8A 4YA6A 5TQ2A 3H8JA 2ZPAA 3REFA 1T4DA 3SU8A 4QUJA 1O6ZA 1NN3A 4OXNA 2OWDA 3V8NA 3V4ZA 2OCXA 3L82B 5L9AA 2BHLA 3QYJA 4P4TA 4U5QA 3N8IA 1N6OA 4PC2A 4TL7A 1YL7A 4NR0A 2SECE 3NAZA 5K3AA 1I4OA 1ZGZA 1GQFA 1I2DA 1MNAA 4E1PA 2QTZA 5HCIA 2XKBA 2XNHA 2W2KB 1C2TA 4C2UA 3VR3D 3K0FB 3N0XA 3HCEA 3GUYA 5GVRA 3WQSB 1S3FA 1BROA 3EH1A 5KVAA 3RF7A 2FPGA 4O4LB 4FJ1A 1GJRA 1DL5A 1YIOA 2HQSA 5AI6A 4K9DA 4LZPA 1SCUB 3F7NA 1H8EA 2WJIA 3ZV5A 2WK1A 4E5VA 4MKXA 3L8ZA 3R3HA 3V1MA 3FGZA 2I67A 4HWOA 4A4DA 1AV6A 5BURA 3G0OA 4G23A 2X8WA 1ELOA 3BK2A 4LBWA 4YJHB 1TB4A 4ENQA 2NQ8A 2MINB 3OCUA 3GFGA 4K5QA 4OU5A 1VI6A 4Q7JB 4R54A 1NGSA 3IUBA 4PYJA 3K3PA 1W46A 1HWYA 3USCS 1NBAA 3W5CA 3FKJA 5DWQA 4YRAA 4KHPB 5FWDA 1US8A 1VP3A 2IY7A 2WM2A 2GEFA 2X3FA 3NS7A 1XHEA 2Q9CA 2UKDA 3M9WA 4IEIA 5HF5A 5KVQA 3W2IA 4H7IA 4NBWA 3LT5A 3R5FA 4NU5A 4XCXA 4GH5A 1IHOA 2IU3A 1STOA 1NXOA 1JR2A 1U04A 1Z17A 2IUTA 2X0RA 1PWZA 4Y2YA 2N9UA 1YAJA 3NVAA 4OXRA 4R2WA 4CIDA 5LP6B 4FU0A 5IYZB 2QXTA 1NPYA 4BIIA 5ESWA 4HLUA 3VPSA 3K70B 1HNZB 4I50B 3WB1A 5KPDA 1CWUA 1BU8A 2IIVA 1BFUA 2GK6A 1OYYA 1WP4A 3I12A 1EQ2A 3ML1A 3PUZA 4G8JA 1JKMA 1JSRA 4R1NA 4RY0A 3RG8A 3UGTA 3VMMA 1MJFA 3D9QX 1AGPA 2HFJA 2XZDA 3NUGA 1OLUB 2JANA 4RY9A 5CGQB 3LK6A 3STYA 1Z0DA 2WSLA 5KWIA 4A03A 4EZIA 1W35A 4ZARA 3PJFA 2P27A 4Y2XA 4X1YA 3RU7A 4AKGA 2CXRA 3BZWA 1X7YA 1W0KA 4UZFA 3VHQA 1QVAA 3UOGA 2FSVA 4M1EA 1ORDA 2CMGA 1E7QA 2FOLA 3F7OA 2A78A 1RC8A 1WY5A 2Q3HA 1MN6A 1QYRA 1YNSA 3DKIA 3DT6A 1NASA 1KJWA 3PQ6A 1KEPA 4AQDA 4AXBA 2QTTA 1I3LA 2AE2A 2FCRA 4LZLA 3ZXYA 3ESXA 1T2FA 1FXUA 1SC3A 1NNEA 4M9UA 3RYFA 5C53B 3AJEA 2H4YA 3T3GA 4L4RA 3QYPA 4ZK2A 5MFZA 2AQ8A 4UU8A 2XMZA 1Z8DA 5FWYA 3CSDA 5TQ0A 5TC4A 5TLSA 3HDVA 4PX9A 3H5AA 3KXKA 3R0XA 2WWTA 3F5FA 2DM6A 4ZU3A 2UZ1A 1G9SA 3F6PA 4UUAA 4KWEA 3EC1A 2UXCB 2DQ4A 1M7BA 4LKRA 5K0NA 4HNVA 1RWKA 2LTAA 2VCHA 4HOYA 1Z3IX 1XYGA 1Y7HA 1Q7BA 2GEBA 4LJ8A 3HTXA 2BL4A 4PLHA 1NRIA 4CLEA 4DJDC 3GCWA 1C8BA 3VM6A 2W2MA 1C9YA 2IJGX 4A8HA 1Q95A 3GLQA 5ISMA 3HVUA 4KBGA 2SGPI 4FE3A 3MEKA 3UJCA 2LVBA 5TGTA 3EXFB 2R6FA 2JJ1D