2QQEA

Thymidine kinase from thermotoga maritima in complex with thymidine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
180
structure length
164
Chain Sequence
b'SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKNGVEAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGEEEIDVGGQEKYIAVCRDCYNTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidine kinase
publication title Quaternary structure change as a mechanism for the regulation of thymidine kinase 1-like enzymes.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 49
structure length 164
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2qqeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qqeA01
1M7BA 2LCFA 3GLGB 1LTQA 1E1QA 3DZDA 1GZSA 2IYQA 1W0JA 1Z2AA 5G41A 4I1SA 3GLIE 1Z22A 4Q48A 4PXAA 1PZNA 4UXJA 4WBSA 2R2AA 2X2EA 3ADCA 3DKPA 4LJAA 3D7MA 4RFSB 4H9GA 2VH5R 4FMDB 4HLUA 4LBWA 5TMPA 3T12A 2BV3A 1ETUA 2G83A 2QBYB 1HT1E 4HUQA 1GVNB 4PFSA 1LF5A 5CM9C 4C4PA 1ESNA 1U81A 3WMGA 3KJGA 2ANBA 2FJUA 4A2PA 3SFZA 2BKEA 2FA9A 1OKKA 4US0R 1XJ0A 2I1QA 5AJWA 1RYFA 4M9SA 1C9KA 2GZDA 3VR6A 2IS6A 4PX9A 4LUCA 4PAMA 4GMXA 4PAOA 2WIBA 4MKFA 1NVXQ 3N2EA 3TIFA 3IIJA 5EE9A 2GBLC 5FBLB 3B8HA 3SBDA 1FNMA 4Q4AB 1JJ7A 3ZVLA 1KIMA 1KO7A 1VDZA 2RAPA 1QHHB 5FBQB 3TW4A 3ZIAA 3EWSA 2ZRGA 4IOMA 4LHXA 4TN1A 2ZJ8A 1DE0A 4B48A 2IW3A 1Q1ZA 3UMRA 1IONA 1UF9A 2ORIA 3CLVA 1KI9A 2CJWA 2ECKA 1CS4C 2H16A 2Q3HA 2PL3A 2F6RA 2W00A 4QNRA 4BFYA 3GFOA 3MCAA 4LWZA 4E03A 4EFMA 2QQ0A 2A5GA 2Z43A 3LBHA 3IIKA 4HAZA 4NPHA 4B6FA 2DFKB 4AY2A 2DFTA 121PA 1J90A 1ZCBA 3CPHA 2CVHA 4KITB 1VMAA 1ZD1A 2BM1A 1S2MA 3ZZ0A 1TX4B 4XTCS 3NEJA 1AGPA 2PMDA 2JATA 1QHYA 1NP6A 3SYKA 4DCVA 1RRGA 4R2IA 2N46A 2QP3A 2JLUA 2N1BA 4A2QA 1JEEA 3ZLJA 3LV8A 1LW7A 3CBQA 3K0CC 4NHOA 2Q21A 3A1TA 1UBCA 3CX6A 3KL4A 4X8OA 3KQKA 1PTRA 3K0SA 3NBYC 4D81A 4DIDA 5FTLA 4MITA 4TLBA 2EYQA 1T3LA 2FSFA 2ORWA 4LBZA 2F9LA 1KK3A 3QSYA 2P6UA 4B3CA 1W44A 1MOZA 1RPZA 5JI3E 2Q6TA 4JS0A 4HAYA 2EWVA 4QJ3A 3B2EA 1TADA 5FUXA 2NG1A 1X1RA 2G1KA 3ZDQA 2QE7D 5L8VA 1E2DA 1OXTA 2H8KA 4NBSA 4KSBA 1XEWY 5GVRA 1EFRA 1VHTA 4QBIA 1G20E 2HXSA 2ODWA 3ICQB 3MGCA 2KBFA 2R9VA 2WHXA 5J40A 2ZYTX 2NO7A 2AKAB 1X3SA 5B58C 4UXIA 1BS1A 4Z54A 2Z4SA 2FOLA 4LBVA 3GLHA 3LWNA 4BLPA 3TLXA 2J3EA 1FP7A 3D6TB 3WY9A 1G5TA 2IC5A 4I1VA 4M1YA 2E1RA 1XTKA 3BBPA 3CF0A 3NWJA 1SXJC 1HA3A 2QZ4A 4QHYA 1NVWQ 1OFUX 3CKLA 3MJHA 3RRYA 4LPKA 521PA 2W83A 4BE7B 4KVAA 2BBOA 4FMCF 1P7CA 5FPTA 3UWOA 2QY9A 3R20A 4URYR 1KI8A 5BN4A 5HPYB 2ZM5A 1X6VA 2EFCB 2JASA 3IUYA 5A0FA 3TSZA 3C5HA 1YR8A 1TU3A 3PVSA 4GZMA 4PPGA 1BH2A 1GSIA 5KHOC 4MUAA 4HZUB 4NYJR 1EWRA 5HZHA 2D74A 2XNSA 4C30A 3VR1A 4RZ3A 4YMVA 5L3QA 3QXHA 1SQ5A 3SDZA 1T8TA 3QENA 3VU9B 4IOKA 4Q4LA 4FMBB 3CNNA 1VCNA 1TMKA 3BH0A 1N6PA 4CEJA 1OXUA 4D26A 4IRUB 2KSQA 3U7FB 3FDIA 3B1XA 4D80A 3WYFA 1ZNYA 3M1IA 3I32A 1NSTA 3GJ6A 3GMTA 3W6PA 2JLSA 2V1UA 3HPRA 5C4GB 1OE0A 4V0LA 2IYWA 1TF5A 1Z0DA 1W2HA 1ZW6A 2LKDA 1DVRA 3QPVA 3R7WB 2YNMA 4GMDA 3AVTA 2Q3FA 1Z0AA 1E2MA 5FOUA 3E5HA 5P21A 3WYGA 5FPKA 1YKSA 4PSAA 3WRYC 1G7CA 4U7DA 1E2JA 1KJWA 4PC3A 1N6KA 4ARZA 3NXSA 2ZETA 4IVQA 4PZYA 2RGAA 1A2KC 1KYIA 1XNJA 2C96A 1FTNA 3AKYA 3GFPA 3LQRA 4JLKA 1S8FA 4NU0A 1NG1A 3GLFE 2FSHA 2ZSAA 5FL7D 3SE0A 3WBKA 4F4IA 1N3BA 1CP2A 4PHTA 1CJUC 4RJLA 3REFA 3HU3A 3H0KA 4Q1FA 1FX0B 4D0NA 4MH0R 5K8TA 1T0HB 4V0KA 3C4JA 3MAAC 3FYHA 5GVSA 4A15A 3DZ8A 1KSHA 2PX0A 2A3RA 3A1WA 3EZ6A 5KPJA 4EKDA 4AYXA 1IY2A 2ZRIA 3GLHE 4DDTA 1FTSA 1KSJA 3GJ3A 3CRRA 5JBQA 1GFIA 3K70B 1MT0A 2A78A 1E9CA 3GEEA 1G21E 4S35A 2BM0A 1RRPA 2ZJAA 4OKSA 4KVGA 1KAGA 2ZJBA 3PIRA 4QC2A 2XB4A 1R10A 1QDEA 1F2TB 2QP9X 3EPLA 2WZQA 2OFXA 4KFSA 1DG1G 2OAP1 4KBGA 3U44B 2D7DA 1VCMA 3K9LA 3BORA 3U4QA 2IS1A 1N6HA 3B1YA 1LV7A 4KI0A 5DHAA 4TYNA 4OI0A 1MRNA 3HYTA 1IN7A 1F5NA 2VSOA 5CLLA 1II0A 2ZYWX 1EFUA 2ZI3A 4Q4JA 1ZM9A 2PCJA 4AKEA 4E09A 2XZLA 3CB4A 1CR4A 4JLAA 4YXWD 3TE6A 1QVAA 2JDID 3TW8B 3BE4A 2ZRPA 2PH1A 1OFHA 4A0RA 4JT4A 2IUSA 3IGFA 4JBYA 4US2R 1AA9A 1TF2A 1UPTA 2QMUA 1IN4A 2AWNA 4MRPA 4ESHA 1T4GA 1XTRA 2VHQA 2A30A 2XTMA 1PUJA 3AGQA 4A9AA 4V0OA 3K70C 1AGRA 3K0FB 4EDHA 3MUFA 3DPUA 2K5UA 5JJKA 4NP6A 4UNQA 2XOKA 2GXAA 3AKCA 3N70A 5FH9A 2PEYA 2NQ2C 5KNDA 3BIFA 5EXXA 3ADDA 4F93B 2H57A 2IBMA 4M21A 2KBEA 3IO3A 3AGPA 1WRBA 3FMPB 3IIMA 3L0OA 4BFZA 2GK6A 3ND8A 1JPNA 3PFIA 1P6XA 4WZBE 2ZRJA 2HXYA 1A2BA 1W5SA 3SBEA 2R6AA 5JCPA 4A6XA 1KK2A 2GVZC 2ATXA 5LB2A 2ZJYA 1G1MA 2J0QA 5AK0A 1II9A 3U5ZB 3AV0B 3MWJA 4FD2A 3KJIA 5DLQC 1ZUIA 1E4VA 5KUTA 3PR1A 4BLTA 5AR1A 4HLDA 3TR0A 4RD2A 1D6JA 4O2RA 1E2EA 1G7SA 1HTWA 2HDNB 2V6JA 4D0LB 2NO9A 4FCVA 1VCIA 2G9NA 1JAHA 1UEIA 4TLEA 4W9MC 3OE7D 4DKXA 1N6NA 3TSWA 1A5TA 2ZI5A 4JL6A 2Q9CA 1GNRA 1KMQA 1ZIOA 2QUZA 4TMXA 5IK2A 1KNXA 4EIWA 3CH5A 3PENA 1FQKA 5JRZA 2O8EA 4G5QA 2OHFA 3PXGA 2NZ8A 4MYTA 1XXHA 3AVXA 3CIOA 5JJLA 5CIWA 4G3XA 4Y0AA 1H8ED 2ZVPX 3SI7A 2ERXA 4RVCA 2XTZA 5BYKA 4RKFA 2W6IA 4JBXA 4TTRA 1GL7A 2A5JA 2F1IA 4Q21A 4DLUA 2IWRA 1L7VC 2FFAA 2IYZA 5IF9A 3FTQA 4Q7KA 3NHAA 5DN6A 2NO1A 3KXIA 1W49A 3DO6A 4DEXA 3W3ZB 1P3JA 1MO6A 2ZR7A 4FCWA 1IQPA 2V4ZA 1UKZA 3NTUA 1FPMA 5KYKA 1R0YA 1PJRA 4M8NE 5JWHA 3FPAA 1E9DA 3WXMA 1G4AE 3IDQA 2D7CA 1Z6YA 2V7QA 4QJ4A 2VP0A 3CO5A 5K8LA 2V9PA 4EJSA 1L4YA 1R0XA 1TQ2A 4IEIA 1CRQA 1KK0A 1RFLA 4AKGA 2PZGA 1R6BX 1YZKA 3DEFA 4M2LA 1XMJA 1AM4D 3CRMA 5AJVB 4LJ4A 2WM9B 1N5KA 1Q21A 1YHNA 2PJZA 1EG7A 3Q7QA 4TT3A 3IEVA 1IY1A 3FMOB 1XJCA 4NZYA 3TUJC 4FIDA 4DEYA 2PCLA 1FOEB 1XFAA 4V0ME 3SEAA 2WICA 3E1SA 4TTQA 4RFSA 5JFGA 2ZE7A 3KKMA 3LXXA 5JLJA 1MABB 1TUEA 4JT2A 2ORVA 1SKYE 4CGZA 3T1TA 1Z6GA 5EUMA 1U0LA 4DCTA 1PLKA 2DYKA 4OHXA 2VP4A 2ZEJA 3TR5A 1DO2A 1K8RA 2EYUA 1YR6A 5GADl 3PEUA 4QRHA 4URVR 1S1CA 3P1JA 2H17A 3E70C 1JQLB 3FKSA 1P9WA 2WJIA 3B82A 2HCJB 1N5LA 2D2EA 2PBRA 2Q9AA 2A7QA 3BH6A 3CPJB 5EXSA 2UZ3A 4M4SA 4XWAA 1CJKC 2GEVA 3Q3JB 4Q1EA 4W5JA 3K0EA 4BZPA 1Z29A 5FBRB 4DVGA 1YZUA 1KSGA 4ZDWA 4IXNA 1HURA 2GCOA 2GVIA 1OJLA 1XCGB 2GF0A 2QN6A 3N5CA 4DC9A 4PC1A 4L9SA 4DB4A 1XXHE 3SJBA 3FHTA 2CLDX 2BBWA 1BO6A 1KZGB 2HEIA 1L8QA 4L4UA 1Z08A 1QHHA 4II7A 4JLNA 4K46A 2MMGA 2YOGA 2VQSA 1OB2A 4UJ5A 3B7GA 4BFXA 4YQFA 4GI7A 1E2HA 2LWIA 3K53A 5B57C 1LB1B 1W0KD 1E79D 3QUSA 5J4VA 1XD9A 2G6BA 3RNLA 3R8CA 4JLVA 3L2OB 3RSOA 3DOEA 2CXXA 3L43A 4P4SB 4WXRA 4CZ2A 1ZNWA 1XTJA 4UNNA 4IOJA 1NI3A 2CK3A 3DKVA 3RSLA 3W8RA 4LYHA 1GRQA 3TGPA 3CXLA 1TEXA 2OV2A 2QTFA 3Q8XB 4A0FA 4ASUA 4B73A 3AEZA 4DUGD 4ASUD 5DO9A 3THYB 1XX6A 1Q20A 2FG5A 5BWMA 3EAQA 1NF3A 2ZIAA 1Q57A 2NO6A 2X19A 2WWXA 2OXCA 2XXAB 3Q9LA 2O0JA 4F4JA 1TU4A 2HJGA 3B9QA 3ZQJA 1RYHA 2CCKA 3O8DA 4TSFD 2B8WA 2BVNA 3Q85A 1M6NA 4ZDJA 3SC3A 421PA 3K1JA 4DBLC 3RABA 1DTSA 1OSNA 2WBLC 3BOSA 3PUXA 1N6RA 4AK9A 2VHUA 2F1RA 2ERYA 4L8GA 1US8B 1ZC3A 3BB4A 4JL5A 1U8AA 1YZTA 5DE3A 4M1KA 4QHTA 3REGA 1E0KA 4PHGA 3V4RA 1FP6A 3SS8A 2IL1A 4GOKA 4D4JA 1JI0A 4Z8YA 4Q02A 3EPJA 3ZVNA 1NVUQ 3MWKA 3HYRA 1GM5A 2AWOA 2ZI9A 1U8ZA 4LSGA 2WVJA 4B34A 2IUTA 2ZRKA 1GG2A 3KTAB 2H1LA 3B5JA 3AF2A 3GEIA 3H84A 5CLQA 4D2IA 1R8SA 4EUNA 4B76A 2NGRA 1CR1A 5TXGA 1OFIA 4DDUA 5H1YA 2RGBA 1D9XA 1KI4A 1W4AA 2E9SA 4Q01A 1D5CA 1XDBA 2XZPA 3U3MA 4MDEA 2OBMA 3CWQA 3A58B 2OLKA 4DDWA 4LY6A 2QRZA 4QJ5A 2CL6X 3CR7A 3GFTA 4G5RA 1NIPA 2ZSEA 4TTPA 4W7SA 2F55A 2P6RA 3AM1A 4L5BA 4L9MA 5LD2B 2ZREA 3TAHA 3K0AB 4NL4H 1YZGA 1W5TA 1PVOA 3SJAA 1WA5A 2GTPA 4HI0E 1A82A 1KMHB 4JLBA 4ZIRB 1U99A 5GJVC 2ZPTX 4Z1MD 5CITA 5IRCD 1GDDA 2J59A 3KZ1E 4HLQB 4RFVA 5UKDA 1WF3A 1GNQA 5SZHB 1NG9A 2ZAMA 2JAQA 2YKGA 2JJ1D 1KNQA 2P0EA 2YOFA 5FTKA 3UMSA 3X1WA 4AD8A 1YZQA 4GBMA 4NYJQ 3EZ9A 3P4YA 3IPXA 1OXSC 5ANRB 1J70A 4QBFA 5TARA 4KHZA 1DG3A 1OXXK 1F2UA 1SULA 3P32A 5DYIA 2W58A 2OE2A 1Y3AA 2KI5A 2O0HA 1W46A 1XRJA 4G5GA 4HATA 4TMWA 4JYCA 3ND9A 3QE0A 1JBKA 3LAWA 1XCPA 3BJIC 1HY3A 3ZGXA 2CE7A 4B47A 4MUBA 1CEEA 2F43A 4TL9A 1ZRHA 2FF7A 4NYMQ 5J47A 1NMZA 2ZYVX 5LD2C 2DPXA 4DLTA 4DB2A 4KJZA 1VG9B 5H70A 2IYLD 3WHKA 1YZNA 4XSGA 3UXMA 5JHHB 5TVKA 1NKTA 4C0QC 3SYNA 1JR3D 1W7AA 2VHCA 1P9NA 1Q1QA 2RGNA 3QXXA 4X8MA 4M53A 2QL6A 1XB2A 4MRNA 5CDFA 3J81k 2FX3A 1KI3A 2VP6A 5G3ZA 4TQAA 4Q9JA 1J99A 3I4LA 2C98A 2FGKA 1CJMA 5SZIA 1AK2A 1S4QA 5J4KA 1G8HA 2QMEA 2VEDA 1Z6XA 1NSFA 2OILA 5A4JA 1EFCA 4ERNA 3NHBA 2GXUA 1QG4A 1JECA 3EC1A 3ZQ6A 1DARA 2X8AA 4IJMA 1XCMA 2O8FB 3VFDA 2HT6A 3EX7C 4YC7A 3SNHA 4BUJA 5GJWC 2QT1A 2BCJQ 2OG2A 4HUTA 3QF7A 2IXGA 5DIFA 5JEEA 1GAJA 1UFQA 4IDPA 1F2TA 5C1BA 1UJ2A 4HDQB 1SXJD 5CJPA 2ZR9A 2FMXA 3C14C 5CK5A 3THWB 1LS1A 1XEXB 1AKYA 3DM9B 3U44A 2XAUA 3AF1A 4B3BA 4BFVA 1W48A 4DIEA 1S3GA 1ZCAA 3OEED 3RHFA 2FWRA 1KKLA 4XTRA 1Z06A 2CCJA 2QM7A 4O0MA 4AYTA 2OAQ1 4LJ7A 2V6IA 5JZVA 3LW7A 5DYGA 5EUQB 2IUUA 2IYRA 3AUYA 3RAPR 2AK2A 2E87A 3HU2A 2F1HA 4HB2A 4XD7A 4C7OB 5CB8A 1KGDA 1G291 5FI0B 3KB2A 4JBWA 3UWKA 4B6EA 3ZD6A 1QRAA 1Z6TA 3QKRB 4H1VA 2J9RA 2PLRA 5KPDA 1C4OA 2HLDD 3SOPA 1OIWA 1FL9A 1R0ZA 2CL7X 2ZI4A 4JZKA 4WZAE 4OL0A 1G19A 1MR3F 3VKGA 3L8YA 4MYUA 3U3OA 4ZI2A 4CF7A 4HEJA 1KO1A 3B78A 3L0SA 5EXPA 3UEJA 3A36A 4B3XA 3NVAA 4B44A 4DHEA 1PLJA 4NKRA 3KQUA 1UDWA 2YC2C 4FCTA 2FNFX 2ZRFA 1G3IA 1N25A 1ZVQA 4B43A 2UVQA 2VRWB 8OHMA 2GK7A 1VCOA 4I99A 3SHWA 1UDXA 4NCKA 4MKIA 2EW1A 3VQTA 1A7JA 4CEHA 4US1R 1EX7A 4ON9A 4TL6A 2J87A 3IILA 3EIEA 1E98A 1XEFA 4LDJA 4QG7A 5A5GA 4OHZA 3T1QA 1AS2A 2AHOA 4TLAA 4FMCB 1UKEA 5CDFE 1COWA 4TMTA 4OHYA 2O8DB 3LVRE 1E3MA 2VYFA 4GZLA 2FV8A 1EGAA 1SXJB 3W5JA 1EX6A 3MD0A 1SVWA 2BBTA 2OFWA 5FI1B 2RGXA 5AJXA 1RRCA 1CULC 3QOFA 4GPTA 1E0SA 1SVSA 4GP7A 2XX3A 2QNRA 1R5BA 1GTVA 1XPUA 2UKDA 1FW6A 3LBNA 4B32A 2ONKA 1OPXA 2WKRA 4Q1BA 1XD2B 1VYTA 4PSKA 1U0HC 2XJ9A 1TL7C 2G1JA 4Q1AA 2ZQ5A 2YVUA 1X8KA 3ADKA 4V03A 4YXWA 2IS4A 1LS6A 1WXQA 1GP2A 4Q66C 1RIFA 1XMVA 2QI9C 3LBIA 4MKGA 4BRWA 2C5LA 2DFNA 4KYUA 3UPUA 2OUKA 2B21A 2YWGA 2WJHA 5KNBA 3ZZUA 1RJ9B 3BK7A 4OI1A 1RW4A 4P4TA 3AP1A 2IEYA 2VF7A 3PG5A 1P62B 1WE2A 1DOAA 1NVVQ 2EQBA 1P9RA 2AD1A 3AB3A 1Z0JA 4DZZA 2ZU6A 2C78A 1IN8A 5BYJA 4BGDA 3UGLA 4C0AC 2GCPA 4IOLA 1U0JA 3FFBA 3QBTA 1TQ4A 2CNWA 3EZ2A 3QKTA 1AZTA 5HKKD 1Q12A 4K81B 4MDFA 4FN5A 3QF4B 3MLEA 4D4MA 3HR7A 2WMOB 3NBXX 1Z6AA 3LNCA 2ZXUA 3U6KA 1VG0B 4OI4A 4OQLA 2ZE6A 4IXMA 2FPMA 4TYQA 3WMFA 2GJAA 3B60A 1K5GA 1YU9A 4G5OA 2OCYC 2WWIA 1KJZA 1A1VA 4WIAA 4LYFA 1CR0A 1CJVC 3K70D 3IO5A 1HT2E 2ZI6A 3LLMA 1JNYA 4O2LA 4EPVA 1JAIA 3QVUA 2Z83A 3A6PC 3GLIB 2Z0MA 2P6NA 4BZQA 1P60A 4QOSA 4ILEA 1OFTA 3EWAA 1TQDA 2VPPA 3K9NA 1ZM4A 5EE5B 4EPXA 5JSZB 4JVMA 1WBDA 1DAMA 4MGIR 2QQEA 1AZSC 3RC3A 3FWYA 5CYOA 5F3WB 1J7KA 2N42A 4KXFB 1T91A 2DFLA 2HYDA 2QRNA 3U7EB 4CEIB 4Q7JB 1E94E 5EP2A 2DY1A 3FFAA 3O8CA 2P65A 2JGNA 4NYMR 1ELOA 2HF9A 3U3JA 2EU8A 4CDGA 5FTJA 4A0GA 3X1DA 4DSTA 5DISB 1H8EA 3THXA 2Z5FA 2QAGC 4LHVA 1E96A 4QM6A 3UIEA 1KDRA 1YVDA 5BW8A 1OH8A 1VKJA 621PA 1FNNA 1YRAA 1U9IC 2JLYA 3WYAA 3RS5A 4IDQA 2ODEA 1KDOA 2IYTA 3K9HA 1KSFX 1YRBA 3UATA 2FEOA 2VHTA 2BJVA 5FTMA 2MSCB 4AG5A 4DT1B 1O3YA 2RGEA 3ZYCA 3CZQA 1NKSA 2WJJA 2GZAA 1G9XA 3K8YA 2WMNB 1OH5A 3KQNA 4KYIB 1ZC4A 2A9KA 3JZMA 5AUQA 1XWIA 4LC1A 3RRNA 2OBLA 2VL7A 3ZH9B 4Q03A 2ZS8A 3EPKA 4QNMA 4PC7A 2BHRA 1H65A 3BS4A 3RDPA 3IEUA 3KX2A 4D25A 1NY5A 2FU5C 2FZLA 3CX8A 5M04A 1GIAA 1E9SA 4PAQA 3VHXA 2VBCA 4JMPA 3G82C 5J5CA 3MRSA 1RFHA 1FUKA 1TQ6A 1NBMD 3THYA 2CBZA 2O8CA 3MWYW 3O8RA 2GEDA 3W5IA 2YWEA 3KFXA 3O8BA 4B74A 1E99A 1FFHA 1W36D 4OK6A 5TB5A 4ACBA 5KU1A 4EPYA 1FMJA 2CVFA 5IDVA 2B8TA 1IHUA 3G5UA 2WPDA 3BWDD 3B1VA 4KSCA 4IVPA 1B23P 1S96A 1UBGA 2O8BA 4B71A 2XNDA 4OK5A 1LFDB 2H92A 3QG5A 4A8JC 3QXCA 3OHMA 2OBNA 3MSXA 4DCSA 2GXQA 3CW2A 5AUOB 4P3YA 4ABYA 1D2MA 3EW9A 3BFXA 1GITA 4Q1DA 1T5IA 4HLCA 3WP0A 5KDLA 1WBBA 5D3MA 3IBGA 4M1MA 2C99A 1UBEA 2GJSA 2EFGA 4MA4A 4TLCA 1D9ZA 2NPIA 5FTNA 1S3SA 4RKEA 2P67A 3DM5A 4PTLA 2FE4A 3CNLA 1PUIA 2WOJA 5H8WA 2C2HA 1DBSA 3I1FA 1I4LD 1DAEA 2GAOA 2JIZD 1XPRA 2H18A 4Q00A 2PX3A 4FWTA 3GJ0A 3L82B 5F9HA 1W0KA 1E79A 1JALA 3K09A 2ZS7A 4XOIA 4YMWA 2WSSD 4GOXA 1EWQA 4D6PA 4P33A 3DHWC 1MKYA 1AQYA 2W2VA 4I4LA 4F7WA 1EFRD 3GJ5A 2JLRA 1IJEA 4XVQA 2ENNA 4NE2A 5ELXA 1E0AA 5JRJA 5KDDA 3A37A 5CK4A 5LDDC 4EQ6A 3HWSA 2CJWB 5SZKB 4LJ9A 2ZROA 1IXZA 2VSXA 3MWLA 1CF4A 1FUUA 3GJXC 1NLYA 4BFSA 1IXSB 1J8MF 1BKDR 4HLUC 4ZIRA 1W36B 4HB3A 2FSGA 1E9AA 4BWYA 3GCGA 4DLSA 2V8OA 2WWFA 3UG7A 1KO8A 3FHCB 3LVQE 4B3FX 5LPNA 1G16A 4LBYA 4UNSA 2QMHA 3A1VA 4TSFA 2ELIA 1KY2A 2IEZA 2XSZD 3L0IB 4RD6A 2JLVA 4R71A 1XP8A 1F6BA 1P4SA 2A5DA 4G01B 4TYPA 4UKDA 5FL3A 4RD4A 4HB0A 1IM2A 1NVVR 2W0SA 1DAFA 3U3RA 5JMTA 4LJYA 3OEHA 5JJIA 4BLSA 2ZSFA 1G4UR 1QVRA 4D0GA 1IN6A 3GJ7A 2TMKA 1KDPA 3LD9A 5E7IA 1OV4A 1P2TA 1LNZA 3BH7A 3L8ZA 3NC1C 5KSPA 3TNFA 3Q5EA 5JWOA 3I5YA 2PLFA 4WVFA 5IHPA 1G8YA 4P31A 3UANA 3VR3A 4ZKDA 1SVKA 1E9FA 3C15C 2FPKA 4GP6A 4BQSA 4MKHA 3SFVA 4OQFA 1E9RA 2WOOA 4XVRA 4OQNA 4DDVA 1XA6A 1P2SA 3GLFB 4E07A 4KLZA 3T5DA 3QPUA 2JEOA 3D3QA 3S1AB 2OT3B 1W36C 1E69A 3TQCA 2J7PD 4PO9A 2WJYA 3KXKA 1SKQA 1OH6A 4LHZA 6Q21A 2PJRA 1KI2A 2VA8A 3QVVA 4HYYA 3OAAA 1Z8FA 3GLHB 4NYIR 1N0WA 5KNCA 1E2QA 2KJQA 3QKSA 5IT5A 2R6GA 1SVLA 2MMCA 2QGNA 1ZU5A 3GLGA 2HF8A 3I5XA 1GKIA 4A2WA 2P5SA 3T35A 3AVYA 5GJBA 3B6EA 4A4DA 3EARA 1I2DA 4IEEA 4PPQA 4FXPA 2W2XA 4BEJA 3UKDA 4B2IA 4JLJA 2WKPA 4Q9LA 2JJ2D 3QI2A 2GHIA 3RS2A 4QM7A 2EVWX 1X8JA 2O52A 4KCGA 2ROWA 3BFVA 2GNOA 2DHRA 2VLIA 3M0EA 3QBVA 4MGZR 5DSZA 3RRZA 2QBYA 4HAVA 4E5UA 2A5FA 2VP9A 4OJKA 1TF7A 5L3QB 4RD3A 3OZXA 1NY6A 2ENZA 3WHLA 4F91B 1OT3A 2IT1A 5DGXA 2GWHA 3U2QA 5FOSA 3QEJA 1MRSA 2DB3A 4LJ6A 2CL0X 3SJZA 1SZPA 1OH7A 4CEJB 4C0LA 1E6CA 2RCNA 4GRAA 3KUCA 3IQXA 1N2CE 3O47A 4IDHA 1JXMA 3F8TA 4PC6A 2V3CC 4C7OA 1XTSA 3K0CA 4L16A 2OCAA 2YC4C 4M9QA 1G3UA 1VIAA 4Q4AA 1SVIA 5LB4A 5J4LA 2AR7A 1KJYA 5G40A 1P75A 3QY0A 3AF0A 4MRSA 4OHVA 1JR3A 4NCHA 4NCIA 5BN5A 2MSEB 3BB1A 3ZZTA 3QXJA 2QTVB 4DSOA 5F2EA 5FBWB 4ARZB 1G7TA 4LYAA 4TWZA 2XZOA 2BCGY 3UGDA 1OLOA 4PQRA 1GILA 1GKYA 3A4LA 1L2TA 3AUXA 4ZCMA 5JEDA 4N0DA 2C9CA 4BEBA 3CM0A 1X8LA 1UAAA 1YR7A 3KXLA 2ZUCA 5HE9A 1NN1A 4C0HA 5BXQC 3BAFA 4B75A 2O8DA 4M9ZA 4V0NA 3EC2A 4P4UA 1G8FA 1RKBA 4HAUA 1CKEA 2HT1A 4Q19A 1DAKA 4C3ZA 1SXJA 3OESA 5DI9A 1VYVA 2BJWA 2SHKA 4Q7MB 3G0HA 1Z0IA 221PA 2P5TB 3C5CA 3HDTA 3AKDA 2CHQA 1OYYA 4Q4HB 3OEEA 3GLGE 1IJFA 1Q1EA 2JCSA 3EIHA 4ZDIA 4IW3B 1KI7A 1M7HA 1OF1A 3A8TA 3PV0A 4JLPA 1XD2A 3CH4B 3KKPA 4F92B 1Q3TA 3VNUA 3GQBA 5AJZA 3ICEA 2JLZA 1GOTA 5EP4A 2IYVA 2IYSA 3U4QB 1ZM3A 1DAHA 1H8HD 2QPOA 2F1JA 2IXFA 3R8FA 1E9EA 2YJTD 4JSYA 5IK2D 2HLDA 821PA 2PT7A 3PUVA 5DHFA 3X1YA 2ZUBA 4Q4JB 1DAGA 4OK3A 3GPLA 1ZUHA 2ZTSA 3HJNA 1KK1A 3DOFA 1R4AA 3FVQA 2PZEA 3VX3A 2R6DA 3X2SA 1EXMA 3EIQA 3KJHA 3H2YA 2ZRLA 3LDAA 2I4IA 2QMOA 4U02A 1ZIPA 4QKQA 1NNEA 1DELA 1CLUA 1TNDA 2GA8A 4GSYA 4AIIA 1VECA 4LHWA 1I4DD 4RCZA 2OEPA 3KKNA 3QF4A 4DCUA 3RRMA 2JLQA 5JHGB 1EFHA 3QXSA 5DN6D 1YZLA 2AK3A 2GJKA 5E7MA 3WNDA 4S2EA 2GILA 1E32A 2P2LA 4M22A 1ZM7A 1W4RA 1G8PA 4FWIB 2XB2A 4Q1CA 3W3AA 1JB1A 1ZNZA 2FPLA 1CJTC 1KTVA 3PQCA 4AKIA 3ONWA 1XEWX 2V7QD 4LHYA 3KQLA 3P26A 4HZUA 3LLUA 1VYUA 3CR8A 3QJYA 3BERA 4AURA 4LCBA 1JPJA 2NMVA 3GLIA 3TK1A 5KTYA 4F4CA 2RMKA 1SVMA 3VU9A 2EFHB 4UXHA 2ZI7A 3RC8A 1UADA 2VSFA 3RVBA 3PCRB 2FH5B 4UNRA 3BRWD 4ITRC 2EFDB 1GL6A 1R2QA 4YDHB 2JLWA 5D3QA 2G88A 1SKYB 2C9OA 2WIAA 1F60A 2I3BA 1S9DA 4URUR 1KOFA 1VG8A 4DRZA 1IN5A 1GRRA 4R9UC 4CW7A 4DSNA 3LW8A 1QG2A 2YWFA 3NDPA 4NH0A 3R7WA 2ANCA 3R9IA 2R62A 1M2OB 3FMFA 2HJVA 3OIUA 4OYHA 5DNYB 4TYYA 2VIIA 3VR5A 2F3TA 2RKOA 4JIMA 3OIWA 4B6DA 4B3DA 2IF0A 4DLYA 3QEOA 1JR6A 2WWYA 4QHSA 2QE7A 4WA7A 1NLZA 2AN9A 5EP1A 3TQFA 4LJ5A 4MYCA 2J7KA 1MV5A 1L4UA 5B64A 2ZYUX 5E4FA 1NMXA 2O8EB 2ZRCA 1QF9A 1EESA 2IHYA 1XXHB 4C0KA 4CIDA 5L3SB 4TZ0A 3LA6A 5AUNB 1OHHD 3VAAA 4UQOA 4CT4B 3M4YA 4K8OA 2QG6A 2Y8EA 1FQJA 2ZVQX 2O5VA 3MFYA 4DWJA 1NL3A 4QBHA 5HKKA 1FX0A 3BD9A 3F5FA 3GJ8A 1TTTA 2F9MA 4R98A 1MO4A 5CIQA 1XBTA 1XPOA 4BLQA 3EG5A 1U94A 2RHDA 1W4CA 3QKSB 4F38A 3QIAA 1T6NA 2OM2A 1Z47A 1HQYE 2GCNA 3LRPA 1QHGA 2QEQA 3QPWA 3THOA 2GAAA 4ZV4A 2FNAA 4QGAA 4XSHA 2BC9A 2WTUA 4XH9B 4I1OA 3PUWA 3W90A 2ZSDA 3NBFA 1BMFD 3D8BA 2DWQA 4J0QA 3NIBA 2GZHA 2GVDC 3T06B 1WP9A 5E3HA 5JECA 3QG1A 4RZ2A 4ESVA 1UKYA 3NBZC 1JEDA 3FKQA 1UKVY 4OJQA 5EE3A 4WZ6A 5JI2E 1F3OA 4U00A 4FW9A 5FOVA 5AUPB 3B9PA 4TQ9A 1E2IA 3D31A 2JJ8A 2CMKA 1T5LA 1II8B 3LX5A 3IHWA 5F9FA 4XWKA 4EAQA 5FBVB 1S9HA 3OFND 3NDBB 4KBFA 2OESA 2AFHE 4BECA 3WRXC 2ZRMA 4NCJA 3U6BA 1U90A 4LYJA 1TUIA 3WNBA 3CRQA 2BDTA 3Q7PA 2G3YA 2LKCA 3A4MA 5AJYA 3AKEA 4MQBA 3BXZA 3F0TA 3K0FA 4JVSB 5FFMA 5FL7A 3SN6A 3VX4A 4LGMA 1E2FA 4P0TA 1DO0A 2CLSA 4EJSC 4ZI3A 4EFLA 3M6AA 4GFDA 2J0UB 5BN3A 4G1UC 5J4YA 4JL8A 2G77B 1V43A 2FZ4A 1P61B 1P2VA 2EWWA 3SHFA 4TL7A 5L3VA 3W9YA 1ZAKA 2B7CA 2GCOB 4V02A 5E7JA 1QHXA 1T0JB 2WWGA 4EPRA 2V1XA 4MGKR 3ADBA 1AS0A 1ANKA 1GKUB 1WB9A 2Z4RA 1GNPA 4W5HA 2KB0A 3ZJYA 1XD8A 2IA5A 2BMJA 4URWR 4TYWA 4TMKA 2J1LA 2WJVA 1NBMA 1E1RD 2A5YB 4PQYA 1M7GA 2ZJ5A 2W6JD 2GESA 2QAJA 5L3RA 2OO7A 4JVNA 1T9HA 4PO1A 1BIFA 4QBGB 4NTZA 4RSGA 4DXAA 4M1WA 1Z0KA 2X77A 4H1UA 1VTKA 4X8LA 1R5NA 4FMDF 4PR0A 1HE1C 4QL3A 3WP1B 2DR3A 4YMTA 1EFTA 1DADA 2RGCA 4LC0A 5K8IA 1I2MA 2KWIA 1C1YA 2X2FA 2JDIA 3LFUA 3TKLA 1QHSA 3CONA 3NEYA 1Q1BA 4OI2A 2VHJA 4JLMA 4PO8A 2RGGA 4BFTA 3P20A 4RD0A 4LV8B 1ONBA 3R9XA 3JVVA 4Y0VA 1KI6B 1G8GA 1IAQA 1LF0A 5TY0A 3BB3A 2ZUDA 2REOA 1S1MA 1VIYA 1G17A 1P5ZB 3X1XA 3AQ4A 1M8PA 2ZSBA 4A1FA 3FE2A 1YQTA 2JIZA 5HTKA 3SQXA 4A36A 4XIGS 4RZXA 3DVLA 3GLFA 4WW0A 4HZIA 3IHLA 2QAGB 3I8XA 4HAWA 3CUEF 3S1AA 2WJGA 5H68A 1D8TA 1Z0FA 2BEJA 4OHWA 3VNVA 1KZ7B 2ZAOA 2WSSA 2I1VB 2AXNA 4OQMA 3WMEA 3I73A 1ODFA 3E2IA 1ZD8A 2YINC 1Z3IX 4NDZA 4YMSA 4W5WA 1NJFA 2AKYA 1WCV1 3NKVA 1MH1A 4XVUA 1HV8A 4KLNA 1KBFA 1KAOA 4C0BA 4DLXA 5JWRA 1OW3B 1K6MA 2ZRBA 3P27A 3RLFA 2OZEA 2IYXA 4JSTA 1QZXA 5FOTA 2RHMA 5G53C 1WDTA 1ZNXA 1AIPA 3AVPA 4JJKA 1ZMXA 3A1SA 2Q3MA 3HP1A 3TRFA 5FR2A 3PUYA 4C0JA 4NYIQ 2XSZA 3QQ5A 1NN5A 1X1SA 4U5XA 3OE7A 1MABA 2HYIC 4IDOA 4WOPA 4MGYR 1E1QD 1NBME 3C8UA 3CNOA 1W0JD 4NMMA 2IX3A 3RS3A 3RS7A 4C2TA 3V4FA 2ZRNA 2C03A 4AWXA 1VPLA 2XJ4A 1FAQA 2AL7A 4WXPA 5K8UA 1N0VC 3FB4A 1Q44A 2AD5A 1W2GA 1GRNA 2OFOA 1CRPA 1G41A 2REBA 3U3KA 4PPFA 3RWMB 1KDTA 2F3RA 5AWFC 4IFBA 2ZJZA 4AG6A 1IOZA 2FFQA 3CWZA 4LOAA 4A8JB 1LVGA 4L9WA 2QTHA 1F2UB 2G0NA 2QORA 4R2HA 4A6PA 1OKKD 3SR0A 4ZCIA 1CTQA 4A82A 1ZUNB 1EK0A 4IDNA 3BC1A 4XD7D 2IHBA 4JKIA 4EPTA 5CB6A 3F3YA 2YOHA 1P72A 2J7PA 1OIXA 1VG1A 3QNUA 4P4SA 4GNKA 1CBUA 2YYZA 5DI3B 3EA5A 2F43B 5LBIA 2ZR0A 3OF5A 3I92A 3ZIAD 1M1YE 2IYYA 1E2PA 2BMDA 2ZRDA 1ZINA 4RY2A 3TH5A 3JZAA 4DLRA 3TUZC 4B2LA 2CHGA 2J5XA 3DMDA 1HH4A 4TMZA 1KO4A 1OYWA 1OB5A 4O3MA 4L15A 1RRFA 2HUPA 2ODBA 4C9BA 3Q5DA 3EA0A 1MO5A 2CLCX 4JVLA 5J4HA 2XXAA 3BFKA 2JJ2A 1RC8A 3HPQA 3V9PA 1O87A 4JJZA 1VHLA 2R44A 1T3SA 2FEMA 2CEAA 3KKOA 4JLOA 4Q4HA 4LX0A 4PZLA 4FI3C 1RZ3A 1KHTA 2OSBA 3ZVMA 2ONJA 1COWD 1HEIA 1Q22A 1US8A 2MSDB 1V5WA 1NRJB 1QBKC 1G3RA 2FSIA 5CYPA 4LZZA 1A4RA 3MG9A 4TL8A 3MMPA 3U60B 2BMFA 1XZPA 1NIJA 5GJCA 2Z6VA 3K9GA 1AKEA 1GUAA 3DL0A 1HUQA 3T1OA 4HUQB 5KOYA 4KFRA 5DH9A 4ACAA 1M74A 1QHNA 2BOVA 2C9YA 1U2RA 4Q18A 5EE1A 4POAA 4GDFA 3KB1A 1PTQA 3KTAA 4Q47A 1IXRC 5EP3A 4BASA 2ATVA 2W2TA 2ZE8A 3HR8A 2RGNC 1WQ1R 2WV9A 3VMFA 1QHIA 2O0KA 5G3YA 4Z51A 4TZ6A 1N5JA 2GRJA 4MRRA 4QGHA 2PMKA 2J0VA 2CDNA 3A1UA 3KDSE 1NJGA 2YV5A 3C41J 4KFUA 2BKUA 2DB6A 2B6HA 4YLGA 4BPBA 2XGJA 3BJIA 1DS6A 3CRW1 4RD1A 2GETA 5HE8A 3LX8A 1P2UA 3SQWA 1E4YA 4KAXA 4TMVA 4DUGA 3EXAA 1N0UA 2C77A 3PEYA 5FPYA 2R65A 2OCPA 3K0AA 1ZD9A 2D4HA 1J2JA 1YE8A 5TV2A 1Y63A 1KMHA 2CNWD 2WWHA 3B1ZA 3B85A 4HDOB 1G3MA 3V00A 4B35A 4LJ8A 1DPFA 4CEHB 4ZCLA 1SHKA 3JVUA 4V0MA 1Z5ZA 1F48A 1R0WA 3ZS9A 3KJEA 3IKJA 1KKMA 3FOZA 4DLVA 4RCYA 1Z83A 4A0HA 1JJVA 3NH6A 1DEKA 3I3SR 1Z2CA 2J46A 3Q72A 5F98A 2BMEA 3SJCA 1KI1A 5HZKA 1XMIA 3C7KA 3FHOA 3KFVA 2NOAA 1M34E 3W8NA 4C2UA 4FINA 2ZRAA 4PQFA 3RS4A 1OIVA 3EZ7A 3I72A 2V54A 2JA1A 3T15A 1W47A 4ZKEA 2IF2A 4Q9IA 2R6CA 2NTYC 2WWWA 3OIYA 1H8HA 1S0UA 4BRUA 2RGDA 5BQ5A 4BZXA 4QGFA 3X1ZA 5FOXA 3RANA 5FPSA 2DWOA 2F7SA 4R7ZA 3NG1A 2PEZA 1R8QA 5FUWA 2XTNA 2DCUA 4PPNA 4LPSA 2QROA 5L3SA 2AX4A 4DLZA 2V55B 4PSVA 4KV9A 4GL2A 2VP2A 2WAXA 1PLLA 3LQQA 4IVRA 1G18A 2BEKA 2REXB 2IWHA 2DWPA 1TEVA 4D4KA 3N2IA 1BYUA 2R6FA 4O25A 4BFUA 3PITA 4N0EA 2GBLA 4JYBA 3CRVA 2DBYA 4TQUS 3BGWA 1D2NA 3AP2A 4AC9A 5C2JB 1XTQA 2FFHA 4PZZA 3TSOA 3I61A 4UJ3A 1G3QA 4ZPXA 2O8FA 4M0LA 4B33A 2EFEB 4Z1MA 3KQHA 2FFBA 2IXEA 1TBNA 3ZVRA 1GWNA 1BOFA 3AVOA 1UM8A 2YWHA 4KODA 2P3SA 2YUUA 2QSZA 1Z63A 3KY9A 1KY3A 2JJ1A 3THWA 3NC0C 1T8UA 1XEXA 3U7HB 4Q9KA 3ETLA 4PC2A 5KDOA 3R9WA 2D2FA 4BFWA 4D4LA 2AXPA 1R79A 2YHSA 1B0UA 1G6OA 3UEYA 4AI6A 3WBJA 1BYIA 1XU4A 2IYUA 2RB4A 5FPHA 1E2GA 4I81A 3U61B 1XJQA 4P32A 1JQJC 1II8A 1U8YA 2C8VA 721PA 3H4MA 4DSUA 1K5DA 1E0JA 1ZYUA 1RVDA 1W1WA 4YMUA 2WPDD 3AH8A 3WNCA 3AF4A 1XZQA 2XNDD 4AYWA 2YZ2A 5B2ZA 1ZJ6A 3QKRA 1TBOA 5SZJA 1GL9B 2FDCA 2B7BA 2Q0HA 3DDCA 3ASZA 4RZUA 3T5GA 3UMFA 3RYTC 4LI0A 3P4XA 2WAYA 1OHHA 3VR2A 2X1VA 3THXB 5B30A 4E22A 2D3WA 2C95A 1Q3HA 4A92A 3HU1A 3NH9A 4Q7LA 1OXVA 2J0UA 5E95A 3IQWA 2W0MA 3OIVA 2VP5A 1E2NA 5HCIA 5FUVA 1DAIA 1CXZA 2OCBA 1E2KA 2UZIR 2VRWA 2E73A 1CR2A 1I4TD 4AKHA 3CF2A 3GJ4A 3SZRA 4CT5A 1TAGA 1FARA 1XTIA 3GEHA 4LV6A 4JLDA 1R7RA 2BWJA 3EASA 4KO8A 2XOKD 5JS7A 3VKHA 1Z07A 4I1UA 4PANA 2JLXA 1P73A 2CE2X 3CPEA 4WAUA 1ZP6A 2ODNA 4DLWA 3W6OA 5EE0A 3H86A 1BMFA 5KSZA 2C04A 4OQXA 2CHVA 1ZU4A 4XWOA 4B3GA 1N6LA 2GDJA 1KO5A 4YDSA 5TDHA 4NCNA 1G5PA 2QA5A 1LY1A 2H7VA 4Z8XA 3IPYA 2A2ZA 5HR5A 2FGJA 2O8CB 1G7RA 4ZO4A 1NN3A 4M1SA 4GT1A 5C46F 1R5OA 1SHZA 3KUDA 4GOJA 3B1WA 4LV5B 3OFNA 1U98A 2BIFA 1FMLA 3FMIA 4Q9HA 2NPFA 1Q0UA 3AVUA 2PT5A 2O8BB 1AN0A 2VTKA 2L0XA 4IKEA 3LXRA 3AVQA 1KI6A 3VTKA 1RJ9A 2ASEA 2NO0A 4CVNA 1CU1A 1X86B 3PEWA 1RE0A 3AP3A 1AS3A 3A4NA 4HSEA 2ZU0C 2GEUA 4N3NA 1W4BA 2J45A 3LY5A 3OEHD 4ZDKA 2ZANA 2XITA 5D3MB 4G0NA 1IY0A 5CM8B 3KKQA 3TAUA 2W6ID 2PZFA 1HYQA 1N6OA 2QAGA 1NMYA 4UNPA 3UGIA 2ZRHA 2GKSA 3FGNA 3PUZA 1N6IA 1U9IA 2CCGA 1E9BA 2QM8A 4DCNA 4D82A 1SVOA 2QSYA 4BLRA 3C16C 3PEVA 3MJRA 4HDCA 1CIPA 1JR3E 3VHLB 5JS8A 1XF9A 2RH5A 3SYLA 1FZQA 4EFNA 1YR9A 3TJZA 4BLOA 5FOWA 1AJEA 4URXR 3T34A 2GF9A 4HAXA 1E1RA 3W34A 3QKUA 4QXAA 3TVTA 1PV4A 2VO1A 2W6JA 1G64A 1NLFA 4KFTA 5JSZA 2J0SA 3LO5A 1Y8FA 1ZBDA 4CYMA 2GXSA 3TBKA 3RWOA 3AVWA 1NN0A 3OAAD 2GJ8A 1KBEA 4IHQA 4EQ6B 1UEJA 4PHFA 3ASYA 1E2LA 4TT3D 3RS0A 3GD7A 4CEIA 1T3HA 4LK2A 2QU8A 1SXJE 2KE5A 5EZ6B 4IFEA 3EPHA 2OXRA 4KU4A 1MO3A 4DJTA 3ZD7A 5C18A 2IK8A 1D2EA 2AFIE 4M9XA 3CZPA 1TPZA 4JKYA 2ZS9A 5JCZA 1G6HA 5EZ5A 4XJXA 5EQTA 4EPWA 3I8SA 4C0SA 4FKDA 2BBSA 1SGWA 3CX7A 2J41A 2XEXA 3H1TA 2G0TA 2Q9BA 4MYHA 3T61A 1UBFA 2VF8A 3SU8A 4CRWB 3ECCA 5HCNA 4QFMA 4A8JA 5EJEA 3FKSD 5EXTA 2ZJ2A 5KSOA 4M1OA 4X8HA 3UG6A 2B92A 2QT0A 3B13B 4HB4A 2FN4A 5CJ2A 2H5EA 1JXOA 3K09C 4QGGA 2NZJA 4MRVA 4DT1A 2QP4A 4URZR 1AQUA 3DMNA 2QENA 1ESMA 1HQCA 4G5SA 3IBYA 3EZFA 2WKQA 3UK6A 3TVDA 3AVVA 3T1VA 3TMKA 3W6NA 2QPAA 1J8YF 1Z28A 2HCBA 4M1TA 1ZM2A 2D62A 4OBEA 3L0PA 5DI3A 3LH5A 3VKWA 1HE8B 1YJ5A 4B2PA 3VR4A 2QPTA 4LRWA 3U7GA 3AF3A 5KO2A 4NONA 3PJRA 1XMSA 5FUYA 2ZJOA 1N5IA 2D06A 4EJSB 5KSYA 3UFFA 2R8RA 4N1AA 4Q5IA 3I62A 2HV8A 2IS2A 1IBRA 2GJ9A 2QGZA 5C4MA 3GP8A 3TUIC 2NIPA 3CF6R 1WMSA 2CK3D 2OLJA 2WSMA 2ZITA 4TLDA 4YONB 5FR1A 4PHHA 3ZS8A 2ZE5A 1G5RA
chains in the Genus database with same CATH superfamily
2CSUA 4JSRA 4HQOA 2CFIA 4GM0A 3DZDA 3WK8A 4N41A 4D96A 2IYQA 1W0JA 3M7IA 1Z2AA 3UKOA 2HO5A 3GLIE 4Q48A 1JHMA 1TVMA 4UUBA 3ZY4A 4LVNA 1B8UA 2W2NA 3RU2A 3WBBA 2Q1TA 2YHIA 3DKPA 3A05A 5LLDA 4EG1A 4H9GA 4HLUA 5DX1A 3G8DA 2XT6A 2A9RA 5KAPA 3WGNA 3OPQA 4AMGA 1PSDA 2QQDA 1ZI6A 5EOVA 3TJQA 3ESZA 2J09A 3L7JA 4BVHA 1BEUB 4RZIA 4ZYYA 3TECE 4EMSA 4BB9A 4HGQA 5FDFA 4C4PA 2V6GA 5H5JA 1ESNA 1H6CA 3VDRA 2FJUA 4XQEA 1EVEA 5ALTA 3CE6A 5FJIA 5DGCA 3PGXA 4DC0A 2FA9A 4GG1A 5JAUA 4D9GA 1JDBB 2R6HA 3JQ7A 1XJ0A 3EVFA 5AJWA 1RYFA 3WWDA 3SBXA 1HO3A 1JHDA 2UXDB 4LUCA 5JD6A 2BFWA 2BGNA 3H2GA 4GMXA 5DYWA 4PAOA 1IBCA 4MKFA 1NVXQ 1QRSA 3SC6A 1CZUA 1YJXA 2SGQI 1FPQA 2WW8A 1ZOIA 2COEA 3C6BA 4EEZA 1E1DA 1HQDA 4Q4AB 3IUSA 3GEDA 5HBGA 1KIMA 1KO7A 2PTGA 3AO0B 3O21A 4IILA 1VDZA 2IRWA 1QHHB 1WGTA 1Z68A 3ZWYA 1YK1A 3BDIA 2ZRGA 4KWHA 4LHXA 2APJA 4W7HA 5DLEA 4ZXPA 5BWBA 4GKJB 1DE0A 4XDHA 1X87A 1ZW1A 3X43A 2JFQA 3CUVA 4DBLE 1JG7A 3CLVA 4IZIA 2LNDA 4WNCA 2XCRB 1CS4C 4R2JA 3HB7A 3BWMA 3WL8A 1PZMA 1I51A 1KS9A 1P2GA 3GFOA 4K9KA 4LWZA 2P1RA 2OBXA 4DBVO 1N2JA 3FSXA 4O2AA 3S40A 2A5GA 4FDAA 1YD7A 3A9TA 4ZAGA 5DNCA 1QOQB 4NULA 5DNVA 1TA0A 4HFMA 5LQSA 3JAMA 2ZTLA 1GAXA 1JSRA 1Y4SA 4AM8A 1VMEA 1WXXA 5FFFA 1FYWA 2P4QA 1P17A 4LOKA 2I9PA 4C7BA 5KTNA 1FC0A 1ZD1A 2BM1A 2Q46A 2VC2B 1SZDA 2IZZA 3PNVA 1MC4A 3E59A 1Y1SA 1NU8A 1TX4B 1UBKS 3UEOA 4IYRA 4XTCS 3NEJA 1AGPA 2PMDA 2M6SA 3ZX5A 3WGGA 3DTVD 1OU0A 3JQ9A 2INGX 4IZHA 1BXRA 2RGWA 1U3CA 4CUKA 4R2IA 3O38A 5I4CA 3EZYA 2N1BA 2BTQB 2W6QA 4OATA 1SC9A 5DRYA 4AW9A 2JHPA 3UBTA 3JARA 3AHEA 3LECA 4NHOA 4O1IA 3UGTA 2GN6A 2B8NA 1UBCA 2OP1A 3I9JA 1XO1A 3OTHA 4X8OA 2XB8A 3KQKA 3WL5A 1NDUA 4L8VA 4D81A 2O7SA 3FETA 4XB2A 4MITA 4O4HB 2C20A 1T3LA 2JFFA 3O4RA 5BQFA 2ORWA 4LBZA 1C9NA 2XHEA 4TVBA 1JZTA 2P2DA 5SY9A 1M9NA 1FE8A 4KGZA 1XRLA 4B3CA 1W44A 1JKFA 1MOZA 3MBOA 3RYHA 1H4VB 5C7IO 4JS0A 1P74A 3DAPA 3LQYA 1JVSA 4OD0A 1TADA 5FUXA 2B4AA 2FXIA 2YVLA 3CVOA 4Z99A 3E9NA 1X1RA 2HA5A 4HWTA 3ZDQA 1W88B 2QE7D 5JQGF 5L8VA 2ZW9A 5GVRA 4NBSA 4QU5A 3RUDA 4HNGA 5U9CA 1TCCA 5LKAA 1X13A 4MUHA 1Q7EA 3ICQB 1OBOA 2R9VA 2WHXA 3NCTA 2NO7A 1WOYA 3LOPA 5B58C 4UXIA 1BS1A 1T9KA 1WB4A 4Z54A 2QI9F 3MA0A 4CF4A 3FRJA 1E5TA 3GLHA 1XLWA 2QW1A 1FP7A 3D6TB 2NSLA 2V8BA 1O4VA 5F1KA 4O1HA 4I1VA 4OB6A 2E55A 4NH4A 4BMYA 3OZFA 3LSYA 4UCFA 4F2HA 4B80A 1LD3A 1NVWQ 2WTNA 3Q3EA 5BW6B 1EEHA 4NZPA 3NHJA 3K16A 2W83A 3NB0A 4OSOA 1ISIA 4KVAA 4QEZA 4RDCA 3ZY3A 4AECA 5DOVA 1P7CA 2YY6A 3ECSA 5FPTA 1PVVA 1KI8A 5JADA 2P9CA 1U8FO 3IERA 2EFCB 1NZDA 1R0LA 3KOUA 1RAHA 3HY3A 3IUYA 4IS3A 1PD1A 2V0NA 4LXQA 4M0UA 2JI6A 5A0FA 1YR8A 3G8CA 5TVGA 4GZMA 3UC5A 2GERA 3F5QA 2MR6A 4H31A 4MUAA 2UZ4A 2HPHA 1MJGM 2QRVA 2Q4TA 2D74A 3LDHA 4YTEA 5HZHA 2AOUB 2Q7XA 4RZ3A 3MJCA 4TTSA 3T9DA 5AD1A 3QXHA 5L3QA 1YAJA 3BMNB 4TXMA 3DG9A 1XE3A 2VK1A 3GROA 4IOKA 4KXXA 4Q4LA 1ZOSA 2G1UA 1N6PA 1OXUA 2EERA 4IRUB 2KSQA 4I8IA 4LYYA 4XDZA 3UT6A 5CVTA 5IWAB 3ZH2A 2Z3WA 3HHEA 3U7FB 1NFRA 2EZ8A 5IVDA 3PP8A 3I32A 2C7RA 1FYFA 1VZ2A 3F49S 3N8KA 1A9QA 3EQ9A 3WGTA 5IYZB 3GZNA 5C4GB 2UUCB 1IHXA 4D8YA 1Z0DA 1ZW6A 2LKDA 2WSYB 1T5BA 2V3WA 3ACBA 3CN9A 2KMOA 3CMMA 5BWLA 2NP6A 3K4HA 4F3KA 3EFEA 1F9EA 1GZ3A 1QK3A 5I7EA 5FOUA 1PK9A 1LLFA 3KR2A 3RR2A 3QTLD 1EBBA 4ZOCA 1FRVA 1CY4A 2WYWA 5BRJA 5KJ6A 3WYGA 4F3YA 4WTOA 1OFGA 5DBEX 3BGOS 2HWKA 1G7CA 1DV2A 1NQ5A 1XCBA 3GUCA 1H3NA 3H18A 3U81A 4U7DA 4B5LA 1N6KA 5EIWA 1ETHA 1DHRA 1A3CA 4OXXA 1IPFA 1X39A 3LDUA 3GFPA 4XOUA 3ZQUA 1FTNA 3FNRA 3HJFA 1F0YA 1PNRA 3HZOA 1IZ9A 3KCQA 1LLUA 4RLQA 1NG1A 5HOEA 1P8AA 1X7WB 2YZNA 3M4JA 5EA2A 1CY1A 1JG3A 5FL7D 1XN1A 3FWPA 3V8EA 4OQ4A 1M1ZA 3ED1A 1N3BA 4PHTA 3HU3A 3QV1A 1FX0B 1ZIDA 4Q1FA 4EENA 2KM1A 3WB9A 4V0KA 2ZB3A 3C4JA 5CFMA 4A15A 3FYHA 4LJLA 2WAMA 3DZ8A 3MB5A 4ZQHA 1KSHA 2ESRA 1R4NA 1P31A 3JSAA 4E30A 5C8XA 1QB7A 4O5OA 5AHRA 2P62A 2QVLA 1WJGA 1XRRA 1R0RI 1R6DA 1XNHA 2WM2A 2ZRIA 4TXLA 3UOEA 5E8JA 1AK9A 3B2NA 4MR8B 4ZT3A 4BYMA 2AEEA 5JBQA 4G0MA 5E8RA 1MT0A 2A78A 2VDNB 4UDNA 2I76A 1QIMA 3H5NA 3E22B 2A14A 3G7UA 4S35A 5FKJA 3V8VA 4C4SA 5E1BA 4BAGA 4MO2A 4WECA 3V8MA 4OKSA 2QX6A 4KVGA 1NW7A 2P1ZA 4QC2A 4BE9A 3KU4A 2XB4A 3CCBA 1F2TB 2HA3A 3G7NA 4GGOA 4XRRA 1J2TA 3PD0A 3PZBA 3MELA 1R1DA 1JEJA 3COJA 3UWDA 2BD0A 4S04A 3BORA 4Z3DA 2L7XA 2IV7A 3HN2A 3V48A 3U4QA 4EJ2A 1JEYA 1G8JA 3M2TA 1S3IA 4KI0A 5DHAA 3CF4G 4OI0A 4FPXA 1MRNA 2VYNA 3VO8A 1C9JA 1F8FA 1GKLA 2FW6A 2I2DA 4WCFC 4YYEA 1J2RA 1II0A 1BD4A 3NM6B 3JQDA 1M2GA 1U7PA 1ZM9A 2PCJA 4HGOA 1AKUA 4HRVA 4BDTA 4E09A 4YXWD 2XZLA 2ZSHA 4D9EA 5KQRA 1NYRA 1B0AA 4IPTA 1A5AB 5F5NA 5TT1A 3BG5A 1KFCB 4I50B 5AVKA 1C8LA 3WLIA 3QX3A 5B1HA 2XOEA 3I42A 4D45A 1FXWA 1M0WA 1TF2A 1EE2A 1H2BA 1UPTA 2CJYA 3YASA 2P3QA 3TZKA 4X61A 4N4AA 1O7JA 3SX2A 4JA2A 1K63A 2JAUA 4AJ1A 4EGQA 1K6EA 3QWPA 3DEIA 3PDWA 2PMFA 3BL5A 4PLWA 4YWHA 1A4XA 4V0SA 4AMLA 4EMBA 1EA7A 2OCDA 3RS9A 1OAOC 4A9AA 1HTTA 1YB4A 4JMLA 4EDHA 1VHJA 3KV1A 2ERWA 3WSWA 1PTJC 5JJKA 3IURA 3VYVA 2RCYA 3D3WA 3QVLA 1HSZA 4GZ6A 4DL9A 2F8MA 5IKEA 2GXAA 3HCAA 1VPWA 2K6GA 4E2YA 3MSCA 4JJFA 5KNDA 3WLAA 2IBMA 2Q07A 2YH2A 3VH4A 3R0XA 3ZE2B 1T9CA 3OKCA 1UXJA 1P2FA 3LQ4A 1TIHA 1IOVA 3RFTA 4EUSA 1YI8A 2J3KA 1QR6A 1Z7YA 4ETIA 3WYEA 1SZCA 5EX0A 3CLRC 4RF5A 1VM6A 2X76A 3JYPA 4LOJA 4FYPA 4QXMA 5KX5F 3AEUB 1W5SA 1B3RA 3NWOA 3W5SA 2PLAA 3PX2A 4UHFA 4KX3A 4XLTA 1C8VB 3SC2B 4KVZA 2ZJYA 2H2GA 1G1MA 3RUIA 5BNFA 4B8YA 1JJBA 1II9A 1PFUA 3MWJA 1X14A 2P35A 3ITEA 1ZUIA 2C3PA 4A8HA 1E4VA 4CG2A 5FWNA 5KUTA 3DKIA 5AR1A 2XUAA 3O8QA 4YJ3B 1M2OA 4EG6A 1TA9A 4BN0A 1V47A 3AKZA 1HDEA 2FDXA 1F6WA 1MFPA 1SZJG 2FRDA 3E3OA 3PUHA 4JYMA 1J56A 1M73E 2EX1A 5JD4A 1N78A 1ECGA 4YV0A 1URPA 5LOVB 4UEJA 3ZBPA 1YUNA 3UGJA 1XMOB 4M76B 1TGSI 2ZJFA 2N1MA 1ZIOA 3WR5A 1RYZA 2DFDA 2M2IA 3CH5A 1XTUA 3PENA 2XBLA 3EZNA 4N12A 4ALNA 3CJQA 4FHZA 5ES4B 2G71A 1A9ZA 4DANA 4FN4A 1XXHA 3AVXA 2FUCA 3BMOA 4TSRA 3VA7A 3O4IA 3NOOA 2ERXA 3UICA 5BYKA 4OBXA 1O8CA 2Z9DA 4OP1A 5IBPA 3LC1O 3TQIA 2XRCA 4FYVA 4R8KA 1R8XA 5AP9A 3M6IA 2A5JA 2H1CA 1SQSA 4C21A 1ULUA 1HYHA 3UV7A 2IWRA 3L3BA 2DWUA 2H1IA 4MEJA 3WRXA 1VSUA 3KYDA 3UHPA 4ID3A 4JWTA 4DEXA 1W49A 3DO6A 4L1KA 3PDIB 2FPIA 1MO6A 3QSGA 2ZR7A 1MAVA 3OCXA 1HDXA 1IPEA 1Y5NA 4QELA 1XELA 1J0XO 1ML4A 1PJRA 2BH9A 5IBRA 1XYVA 2WAAA 4MVYA 4RJKA 1G4AE 2JIOA 4QJ4A 9ATCA 2IH2A 5BNIA 1SOVA 4KUGA 3WKEA 2LCQA 2PN1A 1L4YA 1R0XA 1TQ2A 1CRQA 3TOXA 5JH7F 3DXFA 5LBUA 3I8OA 5BOSA 2IIBA 4I3HA 1RFLA 1YDWA 5EHZA 1TTPB 1HNNA 4YN3A 2XUKA 1E1LA 3QZUA 5KZMB 5HILA 4M2LA 4ZEOA 1CJSA 4MULA 4Z4HA 1EVZA 2YQPA 2PD3A 5IU6A 1UT8A 2M6KA 4EABA 3Q7QA 2O1EA 4YJHA 1T2FA 3R3XA 5T64A 1NJ2A 3VSDA 1J5PA 1FS4A 1WXIA 3FMOB 1GUBA 3R76A 2H5IA 1EX1A 4NZYA 3DMTA 3P52A 4FIDA 4C20A 4DEYA 1V8ZA 2QVXX 3EZLA 2WICA 3E1SA 1I0IA 4RFSA 1X1BA 1MC8A 2EXXA 2ZE7A 3V2IA 3F7MA 5JLJA 3QH4A 3P0FA 3V1LA 1V48A 2I6TA 2WA2A 4G8BA 4PZAA 5EFZA 2F67A 2QN2A 1DTWB 1SKYE 4IDGA 3U3ZA 3CNQS 1U0LA 4DCTA 1PLKA 4OHXA 5I9IA 2Q2OA 1R12A 2VP4A 2CFTA 3DLPX 1FDWA 1SR8A 5KKAA 1K8RA 3TR5A 4BRZA 3PEUA 4QRHA 3BE5A 1T43A 4URVR 2F3UA 2H17A 1NAIA 2QUBA 4C4ZA 1CQJA 1P9WA 4J1TC 5IZCC 2YMLA 4KTVE 4GYYA 1B74A 2CHUA 2PBRA 2Q9AA 3ILHA 2PD6A 3CPJB 5E2AA 5EXSA 1SH7A 1UDAA 2LUYA 5A1TA 3VNRA 2ZVJA 1C7RA 1H2EA 1T36A 2CD9A 4IUDS 2NU6A 4RPKA 4UCWA 4BEVA 4Q1EA 2JA2A 2PSEA 5FBRB 4DVGA 3UOWA 1KSGA 2IDJA 2HA4A 2GVIA 1OJLA 1DQRA 2GCOA 2GF0A 3L93A 4INOA 4OUKX 3T5MA 4L9SA 1YDHA 2FOIA 3CEHA 4YT2A 1KZGB 3A27A 1L8QA 4X1KA 3S5UA 4II7A 1XC7A 4GXQA 3EUAA 4MUEA 4A6DA 4XCVA 2DLCX 4KGVA 3B7GA 1ZWLA 1NOJA 2OCLA 4BFXA 2QJRA 3MEKA 4LTDA 4AJPA 2LWIA 3K53A 2KMRA 2WIFA 4JC5A 4MCAA 4MW0A 3F6CA 1E79D 4KE7A 1YA4A 2G6BA 5IP5A 3R8CA 3HXOA 4K6CA 1MOQA 3DOEA 4B85A 4P4SB 3L43A 4L78A 2B36A 4WXRA 4EO7A 1WW8A 2I2CA 1XTJA 3BMQA 4UNNA 4IOJA 5DMXA 3RSLA 1ODLA 3W8RA 1ZI9A 1EXVA 4AS1A 5D84A 2OR3A 3TGPA 2YR0A 2O5EA 2OV2A 3Q8XB 4U2GA 4ASUA 1YQDA 4YPVA 5I5EA 2KW5A 1DX4A 4DUGD 3PNOA 3M3DA 1N2BA 4DABA 2OCXA 3THYB 5ICFA 4FQ8A 1Q20A 1VSVA 1YRYE 3TRIA 1AHPA 2Y67A 4JY7A 2FG5A 1TYAE 3NO4A 1H9CA 4P98A 4FFSA 1N2GA 1UZLA 3DFIA 1B26A 4J2HA 1LUAA 3STXA 2ZIAA 1XLVA 1Q57A 3FG9A 5AXAA 1M34B 4DYDA 2XXAB 4ISCA 3OQHA 5JBIA 2W48A 3Q9LA 4F4JA 3B9QA 3A9UA 4F5DA 3I01M 5CB0A 2BVNA 3FPKA 3Q85A 4KPEC 3KUUA 1M6NA 1Z17A 3IP7A 1JA1A 5EESA 3T1NA 1A8HA 4Z7QB 1TK9A 1YI1A 3ZU2A 4AMYA 4BU0A 4O4LF 1OSNA 3BOSA 1JFVA 3P9SA 4AK9A 4CG1A 3EG9A 1ZC3A 3WKAA 4L8YA 2B3DA 2WFLA 1F1JA 1CJCA 1BROA 3KWFA 3MOSA 3LIIA 4M1KA 1J8VA 3SQNA 5EIEA 3MPUA 1RWPA 4PHGA 4WESB 4W5QA 1PTKA 1VI2A 1HXHA 4D4JA 1IVYA 2X5JO 1YJCA 1JI0A 1ID1A 4UM8B 3GK3A 3ZVNA 3MWKA 2BFOA 4ZZ0A 1X42A 3HYRA 1XRPA 4B0PA 3ZU3A 3AR4A 4EL5A 1N2IA 3JAKA 1JHQA 4HX2A 1F9AA 2EF0A 1O77A 2V59A 2ZI9A 1KVUA 1JLSA 2CBXA 4NG5A 3MMZA 2WTAA 3O5AA 4BLWA 1X1QA 2H1LA 3B5JA 3AF2A 3MC1A 3X1MA 4DG5A 2RI1A 1R8SA 3IIIA 3C1OA 3N39C 2YFQA 3QYJA 5ER6A 2J6CA 1OX5A 1MAAA 2ID7A 1CR1A 2NGRA 5FT9A 4OJYA 4B76A 4OUDA 5H1YA 1GU0A 3VSEA 3LFTA 1R15A 2E9SA 3HJAA 2OP0A 3C74A 4OQPA 4BVFA 4L4XA 2OBMA 2QQ5A 4G25A 4R1UA 1LQTA 1JIXA 1RI2A 1F8UA 1E9VA 3MBKA 2B1GA 4H7JA 4QYSA 5GOZA 3M2PA 3CR7A 4ZAWA 5HUQA 1NUSA 1U1GA 1UMDA 4TTPA 4W7SA 1NF2A 1L5WA 1OC2A 4L9MA 1TTHA 3GRRA 4FGZA 4L5BA 1KZHA 3VU1A 3ZHXA 1LBEA 5FAKA 2QZSA 4IIEA 3IQEA 3K0AB 4NL4H 1W5FA 1DQZA 3AFGA 3HNRA 3PGVA 3DHVA 1WQ3A 3QE4A 1V71A 1X94A 4FDVA 4R8RA 4CM3A 3R5DA 1A82A 1T2AA 1GCIA 3EQ8A 4JLBA 2WFAA 1OD6A 1TO6A 4TOIA 4Z1MD 5CITA 3DTVA 4TMYA 2M98A 1PQYA 3UTDA 2O2HA 3R5CA 1L8XA 2BZSA 1STOA 4HGZA 1VP9A 1WF3A 5UKDA 1PEAA 2PWZA 2VWQA 1RQ7A 1UJ5A 2WC1A 3CUWA 1TI7A 4B7CA 1KNQA 2P0EA 2YOFA 4KDRA 4PQGA 5FTKA 2ZB4A 4ARUA 1TVCA 5LUBA 1LH0A 4QU9A 2W6PA 1E18A 3PDCA 4KAFA 3N7UA 1E5LA 4R1TA 1WKVA 2P9ZA 3EZ9A 2Z1MA 3CURA 1GTRA 8MHTA 1OLUA 2W2LD 1RAEA 4JOBA 2HTEA 4HWPA 1DG3A 1SULA 5DYIA 4TQGA 1L5RA 5ILOA 5AMXA 2OE2A 3JQ8A 1NR7A 4HATA 3UJAA 1ZISA 5GV7A 5JALA 1W1UA 1JLHA 1HLGA 1E3JA 1H22A 4OF4A 1U8XX 2H85A 4F5ZA 1XCPA 2RHLA 3FAKA 3PRJA 4DAOA 4AP9A 3O4VA 1NVAA 3FAZA 3H42B 4FJ0A 3FHLA 1I4OA 4NYMQ 2B2NA 4ZOQI 1J5XA 2NYRA 4LZNA 2ZYVX 2VJAA 1JDTA 5EMKA 4KJZA 3N8DA 2V65A 3LWBA 5H70A 2IYLD 3UJNA 1UODA 2R84A 1JHZA 4XSGA 3AESB 3RIMA 5IUKC 5JHHB 4LCEA 3ECAA 5TVKA 2V6MA 1RHUA 1W7AA 4TLMB 4EJ0A 5ICSA 3IT1A 1MTZA 2DETA 3EXFB 3GLVA 1NF8A 5CDFA 2QL6A 2Z8YM 1V8FA 3IOMA 3OF2A 3PX3A 1KI3A 3J81k 4TQAA 4Q9JA 1P3Y1 3KZKA 1CZLA 2Q1UA 1S4QA 1PR2A 3AY6A 4RIEA 2QMEA 4RQUA 2VEDA 4XD2A 5JO0A 3BRCA 1PFQA 5A4JA 4JH0A 1EFCA 1WM1A 4ERNA 2C2ZA 3NHBA 5THXA 5J63A 1QG4A 1QCDA 4FE4A 2TMYA 1JPVA 1NFQA 1PJBA 4UOQA 3ZQ6A 2X8AA 3EFOA 4IJMA 5DNEA 3ETNA 4B8WA 1CY2A 3VFDA 1H5QA 2A20A 5IXSA 4YC7A 2YXLA 2R8PA 1AURA 3W5HA 2BCJQ 1E1YA 1C9YA 1LTKA 2OG2A 2VUIB 4WUVA 3ZE1B 3MCUA 3L1HA 1VI5A 4FGLA 5C1BA 3E7PA 5CJPA 4H4CA 1QYVA 2FMXA 3C14C 3CS3A 5CK5A 2FQWA 1LS1A 4MCHA 1TKAA 3EXG1 3NHUA 1ZAYA 3CVYA 2CHFA 1D2AA 3AF1A 4RAQA 1W48A 3ER6A 3OEED 3KZXA 4BX8A 2J3JA 2FWRA 4Y9TA 1Y8ZA 3H97A 4TWBA 1PE0A 1U3TA 2ZYSA 3JPYA 2Q8NA 1DIGA 1XTPA 1YJ8A 2O3TA 3F6EX 2QXUA 4I9FA 1ZFNA 3PGJA 4M7RA 3BXOA 4O0MA 3UO8B 5DW0A 4D5EA 2OAQ1 3WB2A 4G09A 3VHQA 4BBPA 1U0GA 1E60A 3DWIA 1U7DA 5G4LA 3WTBA 3K92A 5I5GA 3LW7A 3W7AA 4DIOA 2P2SA 5AW5A 5JZOA 5K6RA 3AUYA 5IJ0A 2IP2A 5A7GA 5GZ3A 3RAPR 3KE9A 2AK2A 1LV8A 3HU2A 4MI6A 1EIWA 4D9BA 4HB2A 4XD7A 3QW2A 1KGDA 3FOAA 1H2RS 4I9GA 2VNIA 4MA5A 4N7BA 3RRJA 2DVMA 1ZMBA 3UWKA 1VBNA 3N8HA 3PUIA 4M7PA 2G06A 1W93A 1XZHA 1Z6TA 4X7MA 4QUEA 5E9JA 1DQYA 1UM9B 5JJ5A 2PLRA 5KPDA 4BNFA 4WZAE 4REMA 2PKRA 4JZKA 1SG0A 1WZNA 1EG2A 3B5IA 5AVJA 2DR2A 8ATCA 4ZI2A 4DAEA 2OMKA 4MWTA 4CF7A 3I1JA 1KO1A 3B78A 4LSMA 3L0SA 4C7VA 2BFAA 2BFFA 2RHRA 2XUQA 1PLJA 2YFKA 4NKRA 1UDWA 3ZHUA 4BJ3A 5FV7A 5CFOA 1ZVQA 4B43A 5TQ0A 4MMXB 4GLJA 2BFCB 3O3CA 5ISMA 2UVQA 4G5XA 4KIFA 1YQWA 1YTPA 1WCWA 1AKVA 1VCOA 2C31A 1HFKA 2MYUA 3ADOA 5FWYA 3BILA 3NVDA 1RIIA 4MKIA 2FPUA 1MA3A 1DS2I 3U26A 1BU5A 2GBGA 1QVVA 4ON9A 4PZ9A 4X7PA 1FBTA 3IILA 4DMCA 3NJ4A 5J2TB 6ABPA 4Q0MA 5C5CA 5K99A 4G0PA 3T1QA 4EECA 3DE4X 5JY1A 5KOIA 4TLAA 1UKEA 1IDN1 2ISQA 3N74A 1ULNA 1VDMA 3FMGA 4ZT7A 5U4QA 4CLOA 5HQ3A 4OHYA 1LJUA 1E3MA 2QAIA 4GZLA 2E0IA 2FV8A 1EGAA 1H6BA 1SXJB 1Y1TA 2LGJA 4G85A 5BSUA 3W5JA 4Y18A 1EX6A 3DAFA 3MD0A 2RGXA 1ESCA 2XB9A 2RC4A 1KHHA 3FKJA 3PRYA 4QJIA 1M54A 4AF6A 3TB6A 3QOFA 1TXGA 2J0EA 2Y0MA 4GPTA 5JG7A 4C14A 3ZWBA 4MWEA 4N54A 1T2VA 4KXUA 1JHOA 4E5SA 4Q1BA 4E6EA 1QH8B 4W1QA 3TDKA 3OWXA 5A7HA 1S7GA 3N2KB 4DJDC 4V03A 2SECE 4YXWA 2GD6A 1WTAA 2DU8A 5ALNA 2KLBA 1EIZA 1XZDA 3BXEA 3DJYA 3WNZA 3LBIA 4MKGA 5LYYA 4BRWA 1E7QA 2C97A 3SG0A 2I8CA 1EE1A 3K3PA 3UPUA 5K6TA 5FWXA 2A92A 2JZMA 3A7DA 1KPGA 3N2NA 4G9GA 3CLKA 1VL6A 3CLTD 3L0DA 3PL5A 4X3CA 4P3NA 3QMVA 1UWKA 4P4TA 1K4KA 2O1SA 2VF7A 3OQ1A 2VSYA 3HBNA 4BO9A 4BFCA 3KB8A 2XV1A 3HFGA 2J4CA 3TOAA 3GQVA 5GV8A 1K08A 1UP4A 2C78A 1IN8A 1XZFA 5FHRA 5BW4A 5K0CA 4V24A 4EI9A 4IOLA 4M0CA 2C88A 3EEYA 2WTBA 3PPIA 4RKYA 3RM3A 2CNWA 5IJXA 2ERCA 2Z8XA 4AJNA 4BMCA 1U5KA 2FWNA 2F48A 3AUKA 3QF4B 2JGEA 2ORYA 4KWIA 3UQZA 4B3IA 1PFGA 2VLBA 2WMOB 3LNCA 2LRHA 3O3OB 4PNPA 3SC4A 5KBYA 2ZXUA 2QOEA 2H7CA 3DVRX 1HZJA 4M60A 2C2XA 3AIOA 4EHJA 2J07A 2GEJA 3B60A 3NFRA 4YS6A 4QDXA 4C5AA 4ROTA 3B7WA 4P53A 2P75A 1TCBA 3U1VA 3WWZA 3GGOA 5J58A 3OQNA 4LYFA 1CR0A 1HT2E 4D0RA 3OZTA 3ZHBA 4DBZA 5C8YF 4D4HA 4OO3A 4PZPA 1F2VA 3OUTA 4F4HA 3E3NA 5BYAA 1AQIA 1KAEA 1BDBA 1JAIA 3R3JA 4J0GA 2Z83A 4X91A 3IFSA 4LZJA 4DCCA 4I5EA 4NMWA 2AXEA 3HP7A 1P60A 4PZDA 2VNSA 4EPXA 2IHUA 3FIUA 2B99A 1B6GA 1FX1A 3GT0A 3OOJA 5A0VA 1DAMA 3B4VC 5F3WB 4KXFB 4YR7A 1J7JA 5JCJA 1SOAA 2V5VA 2QRNA 4PLZA 3U7EB 1MQAA 2WD8A 5E3JA 3TNDA 3GVXA 2ZXEA 2DY1A 4JNKA 3FFAA 5AKYA 3ZD9A 4NYMR 3DZGA 1ELOA 1I7DA 2XNJA 2CUTA 5A2GA 3U3JA 2VCHA 3D7SA 1FMFA 1K5HA 4P3XA 4QM6A 2HKIA 4RPJA 1OTXA 1T1IA 1E4EB 4TTTS 4D79A 1KEEB 1YVDA 3INNA 5BW8A 2W90A 3ZD8A 4QOEA 621PA 1FNNA 1FP1D 1RXIA 1YRAA 2NSJA 4RSRA 1GY8A 1Y4DE 3U9TA 3TIGA 3ASVA 4PFKA 4Y2XA 1KRHA 4ZAXA 4KC0A 2XVYA 3AL3A 2IYTA 3WV5A 4V1CB 5KNBH 1H3FA 4B40A 1KSFX 3FX2A 4TKZA 3GAZA 1CSOI 4RAOA 1I3CA 3UATA 2VHTA 5FTMA 2MSCB 2H9YA 4OV6B 4DA0A 2I1LA 2F8TA 4AF8A 4ZVRA 3KOZA 1JQBA 1QIEA 3AI3A 5CURA 5K51A 3U31A 3ZYCA 4DV2B 3MHTA 1CY6A 3QX8A 4J07A 5CAEB 3FDZA 4M1QA 4MZXA 1EINA 1TUGA 2W6ZA 5IUJC 4H7PA 5CPBA 3GOXA 1ZC4A 2A9KA 3B70A 3G0HA 2XMBA 3GG9A 4CM8A 4D9JA 3U7QA 2QSUA 4H7DA 2W2QA 2XCUA 3RRNA 1PR5A 1NRIA 2B1RA 3JY6A 1YVUA 1O97C 1JDNA 2ZS8A 4BCDA 3IEUA 1KWKA 4D25A 3QGMA 4EKGA 3DGEC 4KMOA 1NY5A 1VL2A 2PX2A 2PU5A 3A0UA 4TKVB 2I66A 4R0VA 4NOJA 1KDVA 4HDRB 3VHXA 3ZI7A 3G82C 3Q9SA 4DWOA 1RFHA 1TQ6A 2G4VA 1NBMD 2CBZA 3I9V1 4I1IA 2H06A 3PHCA 4JUFA 4WN3A 4GXRA 2NM0A 2FSVC 4IIYA 4RHUA 3O8BA 4H6XA 1E99A 3QVTA 4FP9A 4FLFA 1F38A 3LWDA 2PO5A 3MBIA 3ET5A 1C4KA 2H8GA 4OK6A 5TB5A 4CMAA 2WWRA 3EDMA 4EPYA 2B8TA 4E2ZA 1I7SB 2J9FA 1RAGA 3BXXA 4KSCA 4YY3B 4E3ZA 1X4SA 5KS2A 4KK4A 1UBGA 4ZC8A 4B71A 1U63A 4OK5A 5FEMA 2GUGA 3LUAA 2VBFA 4I19A 4A8JC 3QXCA 2ZUSA 1DKUA 2LIPA 2WFMA 1KXJA 1BXGB 1SB9A 4KQGA 3D0KA 3IPAA 3OHSX 4IQ0A 1GG5A 4XCQA 1J42A 3EW9A 2C3UA 3EF1A 1DWOA 2VVTA 3OXGA 4WUTA 5ER9A 4A8PA 5CVVA 4HGRA 5DRTA 1WBBA 1RU3A 4RY9A 1UFKA 2GJSA 4IGIA 1TVKA 2F64A 2HPZA 3K6JA 2NPIA 4KSYA 4WXYB 5FTNA 5C3UA 4F9FA 2C9BA 3ZLUA 5CBPA 3OD1A 3C8HA 4YAEA 4PRLA 2F3SA 2X4GA 2W2OA 3GOHA 3M5DA 4WEOA 3DMHA 4GOOD 5KCMA 4QDUA 2EX0A 2XYGA 3I2GA 1NXUA 4PTLA 5F12A 3SLRA 1Q15A 1ND6A 2FE4A 2PSFA 4ZV9A 2PKQP 5AHXA 2C2HA 1DBSA 2W4MA 1I4LD 1GVHA 1NWCA 3G9ZA 3I5AA 4K6OA 4EHIA 2JANA 1A96A 4Q00A 4E12A 1PR1A 1DXOA 3Q0IA 4M87A 1MVOA 5HKLA 4DGSA 5BN3B 4EUEA 5F9HA 1A5BB 5G02A 3QWAA 4KPUA 4YWJA 4D5GA 4BPRA 2ZJ4A 1E79A 1VPDA 3K09A 3ERCA 3M34A 4F3NA 3KQMA 4PF1A 4UAJA 2WSSD 1HC7A 4GOXA 4PO3X 4PG4A 3DHWC 3QPAA 3KYCB 2YZGA 4JCCA 2VR1A 5HMMA 5L9AA 1PR4A 2W2VA 4R6XA 1J2YA 1EFRD 2JLRA 4XVQA 1RBQA 2VPYA 3DR3A 2ENNA 3TZLA 3VJKA 2JD0A 1YAHA 5AM5A 4JNCA 3LMKA 3OT4A 3A37A 5E2BA 3HWSA 2CJWB 1VB5A 2NV6A 2XWBF 3FTNA 4O3FA 1WLSA 2PRJA 4XZ3A 2WG2A 4AUKA 4YAWA 3HQ4O 4LJ9A 5EKXA 4CV3A 3LGAA 3BWXA 3GJXC 4N9QA 1BKDR 2G9VA 4HLUC 4ZIRA 2E4YA 1W36B 1TB4A 2P1DA 4HB3A 5JUWA 3JYLA 4PYIA 2NZVG 3PDJA 3PPXA 4EKYA 1RI5A 4DA9A 3SQDA 2WWFA 3ZCQA 3UG7A 1KO8A 4YRMA 2OGZA 3ZDAA 4EA7A 1RXSA 2POQX 2PUDA 1KY2A 2XSZD 5LYJA 3VDUA 1RHRA 4UQLA 2G63A 4MJXA 3FW1A 2FG6C 5I45A 4HBGA 3NBAA 5JD5A 2B0UC 2RIJA 4H7HA 4R71A 5DNUA 1RM0A 2XGOA 1YR1A 2PGDA 3FZEA 4FNMA 3BD8A 4G01B 4TYPA 4KDEA 4R41A 1RM5A 4JBIA 4J3FA 1IM2A 1T13A 4PCVA 4RD4A 5AK5A 4WHMA 3ZDEA 3ZE8A 1Y9DA 3E7WA 4I2NA 1WUTA 1YJQA 4RVGA 5JMPA 5JJIA 4D0GA 3TRJA 1EM8A 1L7NA 5TQVA 4KQ9A 4NRDA 4KNYA 2B8EA 3QE3A 4HKTA 5E7IA 4MYRA 4ZALA 3FI9A 4WLVA 3HWWA 5KSPA 4WKBA 1CP3A 4KMRA 2HHAA 4WVFA 2E3JA 1DBWA 4ES6A 1LSJA 4RGBA 4NEQA 4MVWA 3UANA 3VR3A 5CDGA 5KOJA 1NPDA 4MV9A 5ARDA 2FPKA 4GP6A 3B1KA 4MKHA 2DTXA 1V4BA 3AINA 3LRTA 3WLFA 4XVRA 3EDRA 4HXFB 1XA6A 3D6UA 4RANA 4E07A 3FXAA 4F97A 5AI5A 5CB4F 4OXIA 2NSDA 3NT2A 2G76A 1TLLA 1UL1X 3DPSA 3MN1A 4NZ9A 2PK3A 5JZ9A 1N2ZA 1V1IA 5ALXA 2WJYA 4UOEA 5A6VA 2G9UA 4C6TA 5CT5A 4JP1A 1OH6A 2PJRA 3CUUA 2VA8A 3W06A 3L4JA 4MVJD 2RAUA 4HNUA 4KZKA 5ED4A 1BHQ1 2DG2A 2XUIA 5CXQA 3IA2A 3OLWA 3ZDRA 3CH6A 3LO8A 2EKDA 4NYIR 5FULA 3ZGVA 4PTYA 2OQIA 1YRLA 1QRDA 4CM9A 2CXSA 1L5QA 2AEJA 1SBTA 2R6GA 3JZFA 3PQ6A 5IT5A 1P1HA 1CRLA 1ZU5A 2P2YA 3EDQA 3EY9A 4AZ0B 1TJNA 1Y98A 3JQ9C 1SGQI 1G21B 1I5RA 3AVYA 5GJBA 4DR6B 1DRVA 4IEEA 3DBHA 1GZUA 5DBGA 4A4DA 4YDQA 1QP4A 1T4BA 3DMGA 3UKDA 1UOPA 1BCSB 2FX2A 2H2WA 3G2JA 4JLJA 4NZNA 1ECJA 1BQ3A 4OG2A 2EDCA 5I7FA 3PC6A 3DEKA 5BR8B 4HH4A 3FNGA 5EMMA 1ZLYA 4J0HA 4YT5A 3ZPXA 3PIDA 5DSZA 2NTEA 4DG9A 2QRGA 3R09A 4J1NA 5CT6A 4YP6A 4E5UA 2PKWA 2P9JA 2VP9A 2HMYB 3DDSA 3G2IA 4FFDA