1TBQR

Crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
EGGEPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQECDGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THROMBIN
publication title Two heads are better than one: crystal structure of the insect derived double domain Kazal inhibitor rhodniin in complex with thrombin.
pubmed rcsb
source organism Rhodnius prolixus
molecule tags Complex (serine protease/inhibitor)
total genus 24
structure length 103
sequence length 103
chains with identical sequence S
ec nomenclature
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
R PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbqR02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbqR01
2QQCA 1IY5A 2SGPI 1FYBA 1DS3I 1IY6A 1TUSA 3TJQA 2F3CI 2SGFI 1CSOI 1TURA 1PJUA 1OMUA 1PPFI 2NU2I 2JYYA 1TBRR 1LR9A 1SGYI 3QTLD 2GKTI 1AN1I 1LR7A 1IW4A 2NU0I 2ARPF 2N71A 1M8CA 1Y1CA 2M5XA 2SGQI 1CHOI 1TBQR 1UUCA 2QQDA 2BUSA 1CGII 1CT4I 2ERWA 1HPTA 5JHWC 1BMOA 1PCEA 1BUSA 1YTPA 1OVOA 2OVOA 2GKRI 2NU3I 2SGDI 2KCXA 5DAEA 3SEKC 1TIHA 1SGRI 1TGSI 2KMPA 1CT2I 2P6AC 3B4VC 1SGEI 1KMAA 2KMQA 1SGPI 3OVOA 2XRCA 1DS2I 2B0UC 4HGUA 2KMOA 2NU1I 3SGBI 3HH2C 1H0ZA 1SGDI 1N13A 1CT0I 1Y1BA 2NU4I 1UVGA 1M8BA 2GKVA 3SGQI 2WCYA 2LEOA 1SGQI 2SGEI 1MT1A 1SGNI 1HDLA 4OVOA 1CGJI 2KMRA 1NUBA 1Z7KB 4GI3C 1LR8A 2V53A 1HJAI 2JXDA 1OMTA 1R0RI 1UVFA 4SGBI 1CE3A 1OYVI 2N17A 2JZMA 2N52A 1YU6C
chains in the Genus database with same CATH superfamily
2QQCA 1ULKA 2LB7A 1IY5A 2WGCA 2GVIA 2SGPI 3VE5A 1FYBA 2WVJA 1DS3I 1K7UA 1U5KA 1IY6A 1FAQA 1P9ZA 1TUSA 5EX3A 5FUVA 1NXUA 1ULNA 3TJQA 2F3CI 3GOXA 2SGFI 1CSOI 1TURA 4E1RA 3UFFA 2V1CC 1Z2IA 2OZUA 1PTQA 1ULMA 3UGDA 2DIPA 2V1CA 1K7VA 1PJUA 1OMUA 1S20A 2GIVA 2OD1A 1PPFI 2NU2I 2JYYA 2CWGA 2X3TA 3FSXA 3FSYA 1MJBA 3OXFA 1X4SA 3R5BA 1TBRR 2LUYA 4UXJA 1LR9A 9WGAA 2QQEA 4AMLA 1SGYI 3QTLD 2L7XA 5J8CA 2GKTI 1AN1I 1LR7A 3FC3A 4A24A 1IW4A 3TO7A 2NU0I 3UEYA 1P9GA 2ARPF 2N71A 2X52A 1M8CA 1Y1CA 2JW6A 2M5XA 2SGQI 1CHOI 2YQPA 1Y8FA 3PDNA 1XBTA 1TBQR 1UUCA 2QQDA 1HEVA 4B6DA 1FY7A 2BUSA 1CGII 1PTRA 3KY9A 1CT4I 2DKVA 2ERWA 1HPTA 1RFHA 5EX0A 1MJ9A 1BMOA 1PCEA 2ORVA 3RU0A 5JHWC 1BUSA 1YTPA 1OVOA 2FNFX 2OVOA 2QPOA 5E3QA 2GKRI 1X74A 1WKXA 2NU3I 1FARA 2KCXA 2SGDI 3TO6A 5DAEA 1XA6A 2YUUA 3SEKC 3OXLA 2CWHA 2RC4A 5J8FA 1TIHA 3VDUA 1UHAA 1SGRI 1V1IA 1VDDA 3R5AA 1TGSI 3E59A 2E73A 2CWFA 1CT2I 2KMPA 2PQ8A 1KBFA 2W0TA 3R5DA 2P6AC 2UZ3A 2K9HA 3B4VC 3QWPA 2E5RA 2UVOA 1SGEI 1KMAA 2KMQA 2B8TA 1SGPI 1WTJA 2ENZA 2XRCA 1DS2I 3OVOA 4E1PA 2B0UC 5CCLA 5FUXA 2QQ0A 4HGUA 4WP4A 2DB6A 2J9RA 3MEKA 1TBOA 2ROWA 2ENNA 5FUYA 2KMOA 2CJSC 2NU1I 3SGBI 3OXGA 1MJAA 3HH2C 4UXIA 2Y0MA 5HQ8A 1H0ZA 1SGDI 3TOBA 1K7TA 3QAHA 4JCVE 1TBNA 1N13A 2VRWB 3UGLA 3UGIA 5HI7A 1CT0I 1Y1BA 3UOEA 3TOAA 3BJIA 7WGAA 2A20A 2NU4I 1UVGA 1M8BA 1R79A 2GKVA 5FUWA 2WCYA 3SGQI 1V1HA 2LEOA 1SGQI 2SGEI 2L8EA 1WGCA 4FKDA 1TOTA 1MT1A 2RIJA 2JA1A 1SGNI 1W4RA 1WGTA 5E3PA 1Q9BA 1HDLA 2OU2A 3E2IA 4OVOA 1CGJI 3R5CA 2KMRA 3OL0A 1NUBA 2ELIA 1Z7KB 2ODDA 4GI3C 5E3RA 4L9MA 2ORWA 1LR8A 2V53A 1HJAI 4UXHA 2JXDA 1OMTA 1R0RI 3UEJA 1UVFA 5CCMA 1XX6A 4MPIA 2N1AB 4SGBI 2J87A 1KBEA 4DNCA 3CXLA 1OYVI 1W3SA 2N17A 3D00A 2JZMA 2N52A 3VDPA 1CE3A 1YU6C 3TO9A
chains in the Genus database with same CATH topology
2QQCA 1IY5A 2GVIA 2SGPI 3VE5A 1FYBA 2WVJA 1DS3I 1IY6A 1U5KA 1FAQA 1TUSA 5EX3A 5FUVA 3TJQA 2F3CI 3GOXA 2SGFI 1CSOI 1TURA 4E1RA 3UFFA 2V1CC 3UGDA 1PTQA 2DIPA 2V1CA 1PJUA 1OMUA 2OD1A 1PPFI 2NU2I 2JYYA 3UGLA 3OXFA 1X4SA 4UXJA 1TBRR 2LUYA 1LR9A 2QQEA 1SGYI 3QTLD 2L7XA 2GKTI 1AN1I 1LR7A 3FC3A 4A24A 1IW4A 2NU0I 3UEYA 2ARPF 2N71A 2YQPA 1M8CA 1Y1CA 2JW6A 2M5XA 2SGQI 1CHOI 3PDNA 1Y8FA 1XBTA 1TBQR 1UUCA 2QQDA 4B6DA 2BUSA 1CGII 1PTRA 3KY9A 1CT4I 2ERWA 1HPTA 1RFHA 5EX0A 2ORVA 1BMOA 1PCEA 3RU0A 5JHWC 1BUSA 1YTPA 1OVOA 2FNFX 2OVOA 2QPOA 2GKRI 1X74A 2NU3I 2SGDI 1FARA 2KCXA 5DAEA 1XA6A 2YUUA 3SEKC 3OXLA 1TIHA 3VDUA 1SGRI 1V1IA 1VDDA 1TGSI 3E59A 2E73A 2KMPA 1CT2I 1KBFA 2W0TA 2P6AC 2UZ3A 2K9HA 3B4VC 3QWPA 2E5RA 1SGEI 1KMAA 2KMQA 2B8TA 1SGPI 2ENZA 2XRCA 3OVOA 1DS2I 5CCLA 4E1PA 2B0UC 5FUXA 2QQ0A 4HGUA 2DB6A 2J9RA 3MEKA 1TBOA 2ROWA 2ENNA 5FUYA 2KMOA 2CJSC 2NU1I 3SGBI 3OXGA 4UXIA 3HH2C 5HQ8A 1H0ZA 1SGDI 4JCVE 1TBNA 1N13A 2VRWB 3UGIA 5HI7A 1CT0I 1Y1BA 3BJIA 2A20A 2NU4I 1UVGA 1M8BA 1R79A 2GKVA 5FUWA 2WCYA 3SGQI 1V1HA 2LEOA 1SGQI 2SGEI 2L8EA 4FKDA 1TOTA 1MT1A 2JA1A 1SGNI 1W4RA 1HDLA 3E2IA 4OVOA 1CGJI 2KMRA 3OL0A 1NUBA 2ELIA 1Z7KB 2ODDA 4GI3C 4L9MA 2ORWA 1LR8A 2V53A 1HJAI 4UXHA 2JXDA 1OMTA 1R0RI 3UEJA 1UVFA 5CCMA 1XX6A 2N1AB 4SGBI 2J87A 1KBEA 3CXLA 1OYVI 1W3SA 2N17A 3D00A 2JZMA 2N52A 3VDPA 1CE3A 1YU6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQC A;  1IY5 A;  2SGP I;  1FYB A;  1DS3 I;  1IY6 A;  1TUS A;  3TJQ A;  2F3C I;  2SGF I;  1CSO I;  1TUR A;  1PJU A;  1OMU A;  1PPF I;  2NU2 I;  2JYY A;  1TBR R;  1LR9 A;  1SGY I;  3QTL D;  2GKT I;  1AN1 I;  1LR7 A;  1IW4 A;  2NU0 I;  2ARP F;  2N71 A;  1M8C A;  1Y1C A;  2M5X A;  2SGQ I;  1CHO I;  1TBQ R;  1UUC A;  2QQD A;  2BUS A;  1CGI I;  1CT4 I;  2ERW A;  1HPT A;  5JHW C;  1BMO A;  1PCE A;  1BUS A;  1YTP A;  1OVO A;  2OVO A;  2GKR I;  2NU3 I;  2SGD I;  2KCX A;  5DAE A;  3SEK C;  1TIH A;  1SGR I;  1TGS I;  2KMP A;  1CT2 I;  2P6A C;  3B4V C;  1SGE I;  1KMA A;  2KMQ A;  1SGP I;  3OVO A;  2XRC A;  1DS2 I;  2B0U C;  4HGU A;  2KMO A;  2NU1 I;  3SGB I;  3HH2 C;  1H0Z A;  1SGD I;  1N13 A;  1CT0 I;  1Y1B A;  2NU4 I;  1UVG A;  1M8B A;  2GKV A;  3SGQ I;  2WCY A;  2LEO A;  1SGQ I;  2SGE I;  1MT1 A;  1SGN I;  1HDL A;  4OVO A;  1CGJ I;  2KMR A;  1NUB A;  1Z7K B;  4GI3 C;  1LR8 A;  2V53 A;  1HJA I;  2JXD A;  1OMT A;  1R0R I;  1UVF A;  4SGB I;  1CE3 A;  1OYV I;  2N17 A;  2JZM A;  2N52 A;  1YU6 C; 
#chains in the Genus database with same CATH topology
 2QQC A;  1ULK A;  2LB7 A;  1IY5 A;  2WGC A;  2GVI A;  2SGP I;  3VE5 A;  1FYB A;  2WVJ A;  1DS3 I;  1K7U A;  1U5K A;  1IY6 A;  1FAQ A;  1P9Z A;  1TUS A;  5EX3 A;  5FUV A;  1NXU A;  1ULN A;  3TJQ A;  2F3C I;  3GOX A;  2SGF I;  1CSO I;  1TUR A;  4E1R A;  3UFF A;  2V1C C;  1Z2I A;  2OZU A;  1PTQ A;  1ULM A;  3UGD A;  2DIP A;  2V1C A;  1K7V A;  1PJU A;  1OMU A;  1S20 A;  2GIV A;  2OD1 A;  1PPF I;  2NU2 I;  2JYY A;  2CWG A;  2X3T A;  3FSX A;  3FSY A;  1MJB A;  3OXF A;  1X4S A;  3R5B A;  1TBR R;  2LUY A;  4UXJ A;  1LR9 A;  9WGA A;  2QQE A;  4AML A;  1SGY I;  3QTL D;  2L7X A;  5J8C A;  2GKT I;  1AN1 I;  1LR7 A;  3FC3 A;  4A24 A;  1IW4 A;  3TO7 A;  2NU0 I;  3UEY A;  1P9G A;  2ARP F;  2N71 A;  2X52 A;  1M8C A;  1Y1C A;  2JW6 A;  2M5X A;  2SGQ I;  1CHO I;  2YQP A;  1Y8F A;  3PDN A;  1XBT A;  1TBQ R;  1UUC A;  2QQD A;  1HEV A;  4B6D A;  1FY7 A;  2BUS A;  1CGI I;  1PTR A;  3KY9 A;  1CT4 I;  2DKV A;  2ERW A;  1HPT A;  1RFH A;  5EX0 A;  1MJ9 A;  1BMO A;  1PCE A;  2ORV A;  3RU0 A;  5JHW C;  1BUS A;  1YTP A;  1OVO A;  2FNF X;  2OVO A;  2QPO A;  5E3Q A;  2GKR I;  1X74 A;  1WKX A;  2NU3 I;  1FAR A;  2KCX A;  2SGD I;  3TO6 A;  5DAE A;  1XA6 A;  2YUU A;  3SEK C;  3OXL A;  2CWH A;  2RC4 A;  5J8F A;  1TIH A;  3VDU A;  1UHA A;  1SGR I;  1V1I A;  1VDD A;  3R5A A;  1TGS I;  3E59 A;  2E73 A;  2CWF A;  1CT2 I;  2KMP A;  2PQ8 A;  1KBF A;  2W0T A;  3R5D A;  2P6A C;  2UZ3 A;  2K9H A;  3B4V C;  3QWP A;  2E5R A;  2UVO A;  1SGE I;  1KMA A;  2KMQ A;  2B8T A;  1SGP I;  1WTJ A;  2ENZ A;  2XRC A;  1DS2 I;  3OVO A;  4E1P A;  2B0U C;  5CCL A;  5FUX A;  2QQ0 A;  4HGU A;  4WP4 A;  2DB6 A;  2J9R A;  3MEK A;  1TBO A;  2ROW A;  2ENN A;  5FUY A;  2KMO A;  2CJS C;  2NU1 I;  3SGB I;  3OXG A;  1MJA A;  3HH2 C;  4UXI A;  2Y0M A;  5HQ8 A;  1H0Z A;  1SGD I;  3TOB A;  1K7T A;  3QAH A;  4JCV E;  1TBN A;  1N13 A;  2VRW B;  3UGL A;  3UGI A;  5HI7 A;  1CT0 I;  1Y1B A;  3UOE A;  3TOA A;  3BJI A;  7WGA A;  2A20 A;  2NU4 I;  1UVG A;  1M8B A;  1R79 A;  2GKV A;  5FUW A;  2WCY A;  3SGQ I;  1V1H A;  2LEO A;  1SGQ I;  2SGE I;  2L8E A;  1WGC A;  4FKD A;  1TOT A;  1MT1 A;  2RIJ A;  2JA1 A;  1SGN I;  1W4R A;  1WGT A;  5E3P A;  1Q9B A;  1HDL A;  2OU2 A;  3E2I A;  4OVO A;  1CGJ I;  3R5C A;  2KMR A;  3OL0 A;  1NUB A;  2ELI A;  1Z7K B;  2ODD A;  4GI3 C;  5E3R A;  4L9M A;  2ORW A;  1LR8 A;  2V53 A;  1HJA I;  4UXH A;  2JXD A;  1OMT A;  1R0R I;  3UEJ A;  1UVF A;  5CCM A;  1XX6 A;  4MPI A;  2N1A B;  4SGB I;  2J87 A;  1KBE A;  4DNC A;  3CXL A;  1OYV I;  1W3S A;  2N17 A;  3D00 A;  2JZM A;  2N52 A;  3VDP A;  1CE3 A;  1YU6 C;  3TO9 A; 
#chains in the Genus database with same CATH homology
 2QQC A;  1IY5 A;  2GVI A;  2SGP I;  3VE5 A;  1FYB A;  2WVJ A;  1DS3 I;  1IY6 A;  1U5K A;  1FAQ A;  1TUS A;  5EX3 A;  5FUV A;  3TJQ A;  2F3C I;  3GOX A;  2SGF I;  1CSO I;  1TUR A;  4E1R A;  3UFF A;  2V1C C;  3UGD A;  1PTQ A;  2DIP A;  2V1C A;  1PJU A;  1OMU A;  2OD1 A;  1PPF I;  2NU2 I;  2JYY A;  3UGL A;  3OXF A;  1X4S A;  4UXJ A;  1TBR R;  2LUY A;  1LR9 A;  2QQE A;  1SGY I;  3QTL D;  2L7X A;  2GKT I;  1AN1 I;  1LR7 A;  3FC3 A;  4A24 A;  1IW4 A;  2NU0 I;  3UEY A;  2ARP F;  2N71 A;  2YQP A;  1M8C A;  1Y1C A;  2JW6 A;  2M5X A;  2SGQ I;  1CHO I;  3PDN A;  1Y8F A;  1XBT A;  1TBQ R;  1UUC A;  2QQD A;  4B6D A;  2BUS A;  1CGI I;  1PTR A;  3KY9 A;  1CT4 I;  2ERW A;  1HPT A;  1RFH A;  5EX0 A;  2ORV A;  1BMO A;  1PCE A;  3RU0 A;  5JHW C;  1BUS A;  1YTP A;  1OVO A;  2FNF X;  2OVO A;  2QPO A;  2GKR I;  1X74 A;  2NU3 I;  2SGD I;  1FAR A;  2KCX A;  5DAE A;  1XA6 A;  2YUU A;  3SEK C;  3OXL A;  1TIH A;  3VDU A;  1SGR I;  1V1I A;  1VDD A;  1TGS I;  3E59 A;  2E73 A;  2KMP A;  1CT2 I;  1KBF A;  2W0T A;  2P6A C;  2UZ3 A;  2K9H A;  3B4V C;  3QWP A;  2E5R A;  1SGE I;  1KMA A;  2KMQ A;  2B8T A;  1SGP I;  2ENZ A;  2XRC A;  3OVO A;  1DS2 I;  5CCL A;  4E1P A;  2B0U C;  5FUX A;  2QQ0 A;  4HGU A;  2DB6 A;  2J9R A;  3MEK A;  1TBO A;  2ROW A;  2ENN A;  5FUY A;  2KMO A;  2CJS C;  2NU1 I;  3SGB I;  3OXG A;  4UXI A;  3HH2 C;  5HQ8 A;  1H0Z A;  1SGD I;  4JCV E;  1TBN A;  1N13 A;  2VRW B;  3UGI A;  5HI7 A;  1CT0 I;  1Y1B A;  3BJI A;  2A20 A;  2NU4 I;  1UVG A;  1M8B A;  1R79 A;  2GKV A;  5FUW A;  2WCY A;  3SGQ I;  1V1H A;  2LEO A;  1SGQ I;  2SGE I;  2L8E A;  4FKD A;  1TOT A;  1MT1 A;  2JA1 A;  1SGN I;  1W4R A;  1HDL A;  3E2I A;  4OVO A;  1CGJ I;  2KMR A;  3OL0 A;  1NUB A;  2ELI A;  1Z7K B;  2ODD A;  4GI3 C;  4L9M A;  2ORW A;  1LR8 A;  2V53 A;  1HJA I;  4UXH A;  2JXD A;  1OMT A;  1R0R I;  3UEJ A;  1UVF A;  5CCM A;  1XX6 A;  2N1A B;  4SGB I;  2J87 A;  1KBE A;  3CXL A;  1OYV I;  1W3S A;  2N17 A;  3D00 A;  2JZM A;  2N52 A;  3VDP A;  1CE3 A;  1YU6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...