1TBQR

Crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
EGGEPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQECDGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (serine protease/inhibitor)
molecule keywords THROMBIN
publication title Two heads are better than one: crystal structure of the insect derived double domain Kazal inhibitor rhodniin in complex with thrombin.
pubmed rcsb
source organism Rhodnius prolixus
total genus 24
structure length 103
sequence length 103
chains with identical sequence S
ec nomenclature
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
R PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbqR02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tbqR01
4GI3C 2P6AC 1CSOI 2LEOA 1OMUA 2N52A 2NU3I 2NU4I 2V53A 4OVOA 3HH2C 1CHOI 1CT4I 1IY5A 1TGSI 2N17A 1LR7A 2QQCA 2SGDI 3QTLD 1TUSA 1OVOA 1HJAI 4SGBI 2GKTI 1UUCA 1Y1BA 2NU0I 1Z7KB 3B4VC 2XRCA 1UVFA 1CGJI 1CT2I 3SGQI 1SGDI 2KMPA 1R0RI 1M8CA 2B0UC 1TIHA 1TBRR 1LR9A 2KMQA 2ARPF 1LR8A 2WCYA 2SGFI 1PPFI 1SGNI 2SGEI 2JZMA 2NU2I 1PJUA 1SGRI 2BUSA 3SGBI 1AN1I 1OYVI 2ERWA 1YU6C 1FYBA 3TJQA 2KCXA 1SGYI 5JHWC 2M5XA 2F3CI 1SGPI 1KMAA 1HPTA 1OMTA 1YTPA 1DS3I 2OVOA 1PCEA 2SGPI 2JXDA 1H0ZA 2GKVA 1IW4A 1UVGA 1M8BA 1Y1CA 2NU1I 5DAEA 4HGUA 1SGEI 1BMOA 2N71A 3OVOA 1IY6A 1CE3A 1SGQI 2KMRA 2KMOA 1DS2I 2SGQI 2QQDA 1NUBA 3SEKC 2JYYA 1CT0I 1TBQR 1CGII 1BUSA 1HDLA 1N13A 2GKRI 1TURA 1MT1A
chains in the Genus database with same CATH superfamily
2RC4A 2P6AC 4GI3C 1CSOI 7WGAA 2E5RA 1XBTA 2LEOA 2A20A 2DKVA 1OMUA 1MJAA 1X4SA 2N52A 2NU3I 2NU4I 3VDUA 2JW6A 1ULKA 2V53A 1XX6A 1TOTA 2ENNA 2LUYA 4OVOA 2J9RA 3HH2C 1K7TA 1CHOI 1CT4I 4UXJA 1IY5A 1U5KA 1TGSI 5CCLA 2N17A 1LR7A 2QQCA 1K7UA 2SGDI 3QTLD 1PTRA 2X52A 5FUWA 1TUSA 3TO9A 5HQ8A 3BJIA 3E2IA 1OVOA 1HJAI 4SGBI 5J8FA 2GKTI 2OD1A 5FUYA 4UXIA 3QWPA 1UUCA 1Y1BA 2NU0I 3KY9A 1Z7KB 3R5CA 3B4VC 2XRCA 1UVFA 1VDDA 1WTJA 1CGJI 1KBEA 2LB7A 2ORWA 1CT2I 1Z2IA 3SGQI 1SGDI 4FKDA 2KMPA 1R0RI 1M8CA 2B0UC 1FY7A 2N1AB 5EX3A 5CCMA 1WKXA 1XA6A 5EX0A 5J8CA 1TIHA 1TBOA 1TBRR 2OZUA 1LR9A 3MEKA 3PDNA 1MJBA 2KMQA 2ARPF 1LR8A 1R79A 2ORVA 1FAQA 1ULMA 2CWGA 3TOBA 2ENZA 2WCYA 5E3PA 4UXHA 5E3QA 2SGFI 1Q9BA 1PPFI 2JA1A 1SGNI 2SGEI 2JZMA 2NU2I 3R5BA 1PJUA 1SGRI 1Y8FA 2CWFA 3VE5A 2BUSA 3SGBI 3TO7A 1AN1I 2PQ8A 1W4RA 2V1CA 1OYVI 1WGCA 1W3SA 2ERWA 2YUUA 1YU6C 1NXUA 3FSYA 4MPIA 1K7VA 3UGIA 2DIPA 4AMLA 1FYBA 3TJQA 1V1IA 2KCXA 2QPOA 2VRWB 1SGYI 1X74A 2W0TA 5JHWC 2M5XA 9WGAA 2F3CI 1SGPI 1FARA 4L9MA 3TO6A 3E59A 1P9ZA 1HPTA 1OMTA 1KMAA 2Y0MA 1YTPA 1DS3I 2B8TA 2OVOA 4E1RA 1PCEA 2SGPI 2JXDA 2CJSC 2UVOA 2L8EA 2L7XA 3UEYA 1H0ZA 1S20A 2GKVA 3UOEA 5E3RA 3OXFA 1IW4A 3VDPA 5FUVA 2J87A 4JCVE 1UVGA 1M8BA 2RIJA 3FSXA 1P9GA 1RFHA 2GIVA 2V1CC 3D00A 2OU2A 3R5DA 1KBFA 1Y1CA 4B6DA 3GOXA 2NU1I 5DAEA 5HI7A 3UGLA 4HGUA 2FNFX 3UEJA 2QQEA 1TBNA 1WGTA 1SGEI 1BMOA 4A24A 2N71A 3OVOA 1ULNA 1HEVA 2WGCA 1IY6A 2K9HA 2WVJA 2DB6A 1SGQI 1CE3A 3OXLA 1UHAA 2YQPA 4E1PA 4DNCA 3OXGA 1V1HA 2KMRA 2KMOA 1DS2I 2SGQI 3FC3A 2QQDA 3UGDA 1NUBA 3CXLA 5FUXA 3RU0A 3SEKC 1MJ9A 2JYYA 2ODDA 2ROWA 1CT0I 2QQ0A 1PTQA 2CWHA 3QAHA 3R5AA 3UFFA 3TOAA 4WP4A 2GVIA 2ELIA 2X3TA 1TBQR 1CGII 2E73A 1BUSA 2UZ3A 1HDLA 1N13A 3OL0A 2GKRI 1TURA 1MT1A
chains in the Genus database with same CATH topology
4GI3C 2P6AC 1CSOI 2E5RA 1XBTA 2LEOA 2A20A 1OMUA 2N52A 1X4SA 2NU3I 2NU4I 2JW6A 2V53A 1XX6A 1TOTA 2ENNA 2LUYA 4OVOA 2J9RA 3HH2C 1CHOI 1CT4I 4UXJA 1IY5A 1U5KA 1TGSI 5CCLA 2N17A 1LR7A 2QQCA 2SGDI 3QTLD 3UFFA 1PTRA 5HQ8A 5FUWA 1TUSA 3BJIA 3E2IA 1OVOA 1HJAI 4SGBI 2GKTI 2OD1A 5FUYA 4UXIA 3QWPA 1UUCA 1Y1BA 2NU0I 3KY9A 1Z7KB 3B4VC 2XRCA 1UVFA 1VDDA 1CGJI 1KBEA 2ORWA 1CT2I 3SGQI 1SGDI 4FKDA 2KMPA 1R0RI 1M8CA 2B0UC 2N1AB 5EX3A 5CCMA 1XA6A 5EX0A 1TIHA 1TBOA 1TBRR 1LR9A 3MEKA 3PDNA 2KMQA 2ARPF 1LR8A 1R79A 2ORVA 1FAQA 2ENZA 2WCYA 4UXHA 2SGFI 1PPFI 2JA1A 1SGNI 2SGEI 2JZMA 2NU2I 1PJUA 1SGRI 1Y8FA 3VE5A 2BUSA 3SGBI 1AN1I 1W4RA 2V1CA 1OYVI 3VDUA 1W3SA 2ERWA 2YUUA 1YU6C 1FYBA 3UGIA 2DIPA 3TJQA 1V1IA 2KCXA 2QPOA 2VRWB 1SGYI 1X74A 2W0TA 5JHWC 2M5XA 2F3CI 1SGPI 1FARA 4L9MA 3E59A 1KMAA 1HPTA 1OMTA 2B8TA 1DS3I 1YTPA 2OVOA 4E1RA 1PCEA 2SGPI 2JXDA 2CJSC 1H0ZA 2L8EA 2L7XA 3UEYA 2GKVA 1IW4A 3OXFA 3VDPA 5FUVA 2J87A 4JCVE 1UVGA 1M8BA 1RFHA 2V1CC 3D00A 1KBFA 1Y1CA 4B6DA 3GOXA 2NU1I 5DAEA 5HI7A 3UGLA 4HGUA 2FNFX 3UEJA 2QQEA 1TBNA 1SGEI 1BMOA 4A24A 2N71A 3OVOA 1IY6A 2K9HA 2WVJA 2DB6A 1SGQI 1CE3A 3OXLA 2YQPA 4E1PA 3OXGA 1V1HA 2KMRA 2KMOA 1DS2I 2SGQI 3FC3A 2QQDA 3UGDA 1NUBA 3CXLA 5FUXA 3RU0A 3SEKC 2JYYA 2ODDA 2ROWA 1CT0I 2QQ0A 1PTQA 2GVIA 2ELIA 1TBQR 1CGII 2E73A 1BUSA 2UZ3A 1HDLA 1N13A 3OL0A 2GKRI 1TURA 1MT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GI3 C;  2P6A C;  1CSO I;  2LEO A;  1OMU A;  2N52 A;  2NU3 I;  2NU4 I;  2V53 A;  4OVO A;  3HH2 C;  1CHO I;  1CT4 I;  1IY5 A;  1TGS I;  2N17 A;  1LR7 A;  2QQC A;  2SGD I;  3QTL D;  1TUS A;  1OVO A;  1HJA I;  4SGB I;  2GKT I;  1UUC A;  1Y1B A;  2NU0 I;  1Z7K B;  3B4V C;  2XRC A;  1UVF A;  1CGJ I;  1CT2 I;  3SGQ I;  1SGD I;  2KMP A;  1R0R I;  1M8C A;  2B0U C;  1TIH A;  1TBR R;  1LR9 A;  2KMQ A;  2ARP F;  1LR8 A;  2WCY A;  2SGF I;  1PPF I;  1SGN I;  2SGE I;  2JZM A;  2NU2 I;  1PJU A;  1SGR I;  2BUS A;  3SGB I;  1AN1 I;  1OYV I;  2ERW A;  1YU6 C;  1FYB A;  3TJQ A;  2KCX A;  1SGY I;  5JHW C;  2M5X A;  2F3C I;  1SGP I;  1KMA A;  1HPT A;  1OMT A;  1YTP A;  1DS3 I;  2OVO A;  1PCE A;  2SGP I;  2JXD A;  1H0Z A;  2GKV A;  1IW4 A;  1UVG A;  1M8B A;  1Y1C A;  2NU1 I;  5DAE A;  4HGU A;  1SGE I;  1BMO A;  2N71 A;  3OVO A;  1IY6 A;  1CE3 A;  1SGQ I;  2KMR A;  2KMO A;  1DS2 I;  2SGQ I;  2QQD A;  1NUB A;  3SEK C;  2JYY A;  1CT0 I;  1TBQ R;  1CGI I;  1BUS A;  1HDL A;  1N13 A;  2GKR I;  1TUR A;  1MT1 A; 
#chains in the Genus database with same CATH topology
 2RC4 A;  2P6A C;  4GI3 C;  1CSO I;  7WGA A;  2E5R A;  1XBT A;  2LEO A;  2A20 A;  2DKV A;  1OMU A;  1MJA A;  1X4S A;  2N52 A;  2NU3 I;  2NU4 I;  3VDU A;  2JW6 A;  1ULK A;  2V53 A;  1XX6 A;  1TOT A;  2ENN A;  2LUY A;  4OVO A;  2J9R A;  3HH2 C;  1K7T A;  1CHO I;  1CT4 I;  4UXJ A;  1IY5 A;  1U5K A;  1TGS I;  5CCL A;  2N17 A;  1LR7 A;  2QQC A;  1K7U A;  2SGD I;  3QTL D;  1PTR A;  2X52 A;  5FUW A;  1TUS A;  3TO9 A;  5HQ8 A;  3BJI A;  3E2I A;  1OVO A;  1HJA I;  4SGB I;  5J8F A;  2GKT I;  2OD1 A;  5FUY A;  4UXI A;  3QWP A;  1UUC A;  1Y1B A;  2NU0 I;  3KY9 A;  1Z7K B;  3R5C A;  3B4V C;  2XRC A;  1UVF A;  1VDD A;  1WTJ A;  1CGJ I;  1KBE A;  2LB7 A;  2ORW A;  1CT2 I;  1Z2I A;  3SGQ I;  1SGD I;  4FKD A;  2KMP A;  1R0R I;  1M8C A;  2B0U C;  1FY7 A;  2N1A B;  5EX3 A;  5CCM A;  1WKX A;  1XA6 A;  5EX0 A;  5J8C A;  1TIH A;  1TBO A;  1TBR R;  2OZU A;  1LR9 A;  3MEK A;  3PDN A;  1MJB A;  2KMQ A;  2ARP F;  1LR8 A;  1R79 A;  2ORV A;  1FAQ A;  1ULM A;  2CWG A;  3TOB A;  2ENZ A;  2WCY A;  5E3P A;  4UXH A;  5E3Q A;  2SGF I;  1Q9B A;  1PPF I;  2JA1 A;  1SGN I;  2SGE I;  2JZM A;  2NU2 I;  3R5B A;  1PJU A;  1SGR I;  1Y8F A;  2CWF A;  3VE5 A;  2BUS A;  3SGB I;  3TO7 A;  1AN1 I;  2PQ8 A;  1W4R A;  2V1C A;  1OYV I;  1WGC A;  1W3S A;  2ERW A;  2YUU A;  1YU6 C;  1NXU A;  3FSY A;  4MPI A;  1K7V A;  3UGI A;  2DIP A;  4AML A;  1FYB A;  3TJQ A;  1V1I A;  2KCX A;  2QPO A;  2VRW B;  1SGY I;  1X74 A;  2W0T A;  5JHW C;  2M5X A;  9WGA A;  2F3C I;  1SGP I;  1FAR A;  4L9M A;  3TO6 A;  3E59 A;  1P9Z A;  1HPT A;  1OMT A;  1KMA A;  2Y0M A;  1YTP A;  1DS3 I;  2B8T A;  2OVO A;  4E1R A;  1PCE A;  2SGP I;  2JXD A;  2CJS C;  2UVO A;  2L8E A;  2L7X A;  3UEY A;  1H0Z A;  1S20 A;  2GKV A;  3UOE A;  5E3R A;  3OXF A;  1IW4 A;  3VDP A;  5FUV A;  2J87 A;  4JCV E;  1UVG A;  1M8B A;  2RIJ A;  3FSX A;  1P9G A;  1RFH A;  2GIV A;  2V1C C;  3D00 A;  2OU2 A;  3R5D A;  1KBF A;  1Y1C A;  4B6D A;  3GOX A;  2NU1 I;  5DAE A;  5HI7 A;  3UGL A;  4HGU A;  2FNF X;  3UEJ A;  2QQE A;  1TBN A;  1WGT A;  1SGE I;  1BMO A;  4A24 A;  2N71 A;  3OVO A;  1ULN A;  1HEV A;  2WGC A;  1IY6 A;  2K9H A;  2WVJ A;  2DB6 A;  1SGQ I;  1CE3 A;  3OXL A;  1UHA A;  2YQP A;  4E1P A;  4DNC A;  3OXG A;  1V1H A;  2KMR A;  2KMO A;  1DS2 I;  2SGQ I;  3FC3 A;  2QQD A;  3UGD A;  1NUB A;  3CXL A;  5FUX A;  3RU0 A;  3SEK C;  1MJ9 A;  2JYY A;  2ODD A;  2ROW A;  1CT0 I;  2QQ0 A;  1PTQ A;  2CWH A;  3QAH A;  3R5A A;  3UFF A;  3TOA A;  4WP4 A;  2GVI A;  2ELI A;  2X3T A;  1TBQ R;  1CGI I;  2E73 A;  1BUS A;  2UZ3 A;  1HDL A;  1N13 A;  3OL0 A;  2GKR I;  1TUR A;  1MT1 A; 
#chains in the Genus database with same CATH homology
 4GI3 C;  2P6A C;  1CSO I;  2E5R A;  1XBT A;  2LEO A;  2A20 A;  1OMU A;  2N52 A;  1X4S A;  2NU3 I;  2NU4 I;  2JW6 A;  2V53 A;  1XX6 A;  1TOT A;  2ENN A;  2LUY A;  4OVO A;  2J9R A;  3HH2 C;  1CHO I;  1CT4 I;  4UXJ A;  1IY5 A;  1U5K A;  1TGS I;  5CCL A;  2N17 A;  1LR7 A;  2QQC A;  2SGD I;  3QTL D;  3UFF A;  1PTR A;  5HQ8 A;  5FUW A;  1TUS A;  3BJI A;  3E2I A;  1OVO A;  1HJA I;  4SGB I;  2GKT I;  2OD1 A;  5FUY A;  4UXI A;  3QWP A;  1UUC A;  1Y1B A;  2NU0 I;  3KY9 A;  1Z7K B;  3B4V C;  2XRC A;  1UVF A;  1VDD A;  1CGJ I;  1KBE A;  2ORW A;  1CT2 I;  3SGQ I;  1SGD I;  4FKD A;  2KMP A;  1R0R I;  1M8C A;  2B0U C;  2N1A B;  5EX3 A;  5CCM A;  1XA6 A;  5EX0 A;  1TIH A;  1TBO A;  1TBR R;  1LR9 A;  3MEK A;  3PDN A;  2KMQ A;  2ARP F;  1LR8 A;  1R79 A;  2ORV A;  1FAQ A;  2ENZ A;  2WCY A;  4UXH A;  2SGF I;  1PPF I;  2JA1 A;  1SGN I;  2SGE I;  2JZM A;  2NU2 I;  1PJU A;  1SGR I;  1Y8F A;  3VE5 A;  2BUS A;  3SGB I;  1AN1 I;  1W4R A;  2V1C A;  1OYV I;  3VDU A;  1W3S A;  2ERW A;  2YUU A;  1YU6 C;  1FYB A;  3UGI A;  2DIP A;  3TJQ A;  1V1I A;  2KCX A;  2QPO A;  2VRW B;  1SGY I;  1X74 A;  2W0T A;  5JHW C;  2M5X A;  2F3C I;  1SGP I;  1FAR A;  4L9M A;  3E59 A;  1KMA A;  1HPT A;  1OMT A;  2B8T A;  1DS3 I;  1YTP A;  2OVO A;  4E1R A;  1PCE A;  2SGP I;  2JXD A;  2CJS C;  1H0Z A;  2L8E A;  2L7X A;  3UEY A;  2GKV A;  1IW4 A;  3OXF A;  3VDP A;  5FUV A;  2J87 A;  4JCV E;  1UVG A;  1M8B A;  1RFH A;  2V1C C;  3D00 A;  1KBF A;  1Y1C A;  4B6D A;  3GOX A;  2NU1 I;  5DAE A;  5HI7 A;  3UGL A;  4HGU A;  2FNF X;  3UEJ A;  2QQE A;  1TBN A;  1SGE I;  1BMO A;  4A24 A;  2N71 A;  3OVO A;  1IY6 A;  2K9H A;  2WVJ A;  2DB6 A;  1SGQ I;  1CE3 A;  3OXL A;  2YQP A;  4E1P A;  3OXG A;  1V1H A;  2KMR A;  2KMO A;  1DS2 I;  2SGQ I;  3FC3 A;  2QQD A;  3UGD A;  1NUB A;  3CXL A;  5FUX A;  3RU0 A;  3SEK C;  2JYY A;  2ODD A;  2ROW A;  1CT0 I;  2QQ0 A;  1PTQ A;  2GVI A;  2ELI A;  1TBQ R;  1CGI I;  2E73 A;  1BUS A;  2UZ3 A;  1HDL A;  1N13 A;  3OL0 A;  2GKR I;  1TUR A;  1MT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...