1IW4A

Solution structure of ascidian trypsin inhibitor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
AHMDCTEFNPLCRCNKMLGDLICAVIGDAKEEHRNMCALCCEHPGGFEYSNGPCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords trypsin inhibitor
publication title Solution structure of ascidian trypsin inhibitor determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2002-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1iw4A00
1NUBA 1CSOI 1OMUA 2SGFI 2SGDI 2NU2I 1SGQI 1TUSA 1SGPI 1TGSI 2WCYA 1DS3I 1N13A 1OMTA 2JZMA 1BUSA 1YU6C 2JXDA 2NU1I 1M8BA 2N52A 1FYBA 2N71A 2V53A 1LR8A 4HGUA 2NU0I 2F3CI 4SGBI 2LEOA 2SGPI 3SGQI 1CT2I 2SGEI 2N17A 3B4VC 1PPFI 5JHWC 2XRCA 2BUSA 1HJAI 2P6AC 1PCEA 1UVFA 1SGYI 1OYVI 1LR7A 1CGJI 4OVOA 1PJUA 2NU3I 2JYYA 1SGRI 4GI3C 2M5XA 1Y1BA 2OVOA 1HPTA 1UUCA 1TIHA 1CGII 2QQCA 1IY5A 1YTPA 2SGQI 1M8CA 2B0UC 2ERWA 5DAEA 2GKRI 1Z7KB 2KMQA 1LR9A 1Y1CA 1R0RI 2GKTI 1TBQR 3TJQA 1SGNI 1CE3A 2QQDA 1CT0I 1IY6A 3SEKC 1TURA 2KCXA 2NU4I 1CT4I 1BMOA 1HDLA 2KMPA 3QTLD 1H0ZA 3SGBI 1UVGA 1SGDI 1MT1A 2KMRA 3HH2C 3OVOA 1CHOI 1IW4A 1KMAA 1OVOA 1SGEI 2KMOA 1AN1I 2ARPF 1TBRR 1DS2I 2GKVA
chains in the Genus database with same CATH superfamily
1U5KA 4L9MA 1NUBA 1W3SA 1CSOI 2FNFX 2ROWA 1OMUA 2SGFI 2QPOA 3OXGA 2SGDI 2NU2I 1FY7A 3UOEA 1SGQI 5HI7A 3UGIA 1WKXA 1TBNA 2QQEA 1TUSA 1SGPI 1TGSI 3R5CA 2WCYA 3OXLA 1DS3I 1N13A 4UXHA 2Y0MA 2YQPA 1OMTA 2JZMA 1BUSA 4UXJA 1YU6C 2J87A 1UHAA 2JXDA 2NU1I 2V1CA 2A20A 3BJIA 5FUYA 3OL0A 3FC3A 1M8BA 4MPIA 2N52A 4A24A 1FYBA 1W4RA 1K7VA 1WGTA 2N71A 2UVOA 1MJBA 2V53A 1LR8A 3QWPA 2OZUA 3UGDA 4HGUA 5EX0A 2NU0I 2CWHA 3UFFA 2F3CI 1ULKA 1WTJA 3QAHA 4SGBI 2LEOA 2J9RA 2SGPI 3SGQI 2GKVA 5HQ8A 5FUWA 1CT2I 2X52A 3R5AA 5FUXA 4E1RA 1KBFA 2SGEI 2LB7A 1PTQA 2N17A 2N1AB 3B4VC 2V1CC 1PPFI 5JHWC 2XRCA 1MJAA 2BUSA 2DKVA 5CCLA 1K7TA 1Y8FA 5E3RA 4DNCA 3FSYA 1HJAI 2CWFA 4WP4A 2P6AC 2DB6A 1PCEA 2WGCA 3OXFA 3GOXA 1UVFA 1SGYI 2W0TA 1OYVI 1LR7A 2YUUA 1HEVA 1TBOA 1VDDA 1CGJI 2OU2A 4OVOA 3TO6A 1PJUA 2DIPA 1NXUA 1PTRA 3RU0A 1FAQA 2JA1A 5J8FA 5FUVA 2QQ0A 2ELIA 2NU3I 3UEJA 2JYYA 1SGRI 4GI3C 2M5XA 1V1HA 4B6DA 1Y1BA 2OVOA 2CWGA 5E3PA 1V1IA 1HPTA 1X74A 1UUCA 1TIHA 1K7UA 3UEYA 1Q9BA 5CCMA 1CGII 2QQCA 5E3QA 1YTPA 1IY5A 2E73A 2K9HA 3VDUA 2VRWB 4AMLA 2RC4A 1P9GA 2OD1A 2L7XA 1M8CA 2B0UC 2ERWA 1R79A 2ORWA 2SGQI 1RFHA 2GKRI 3CXLA 2ORVA 4UXIA 5DAEA 1Z7KB 2CJSC 3VE5A 2KMQA 3D00A 2B8TA 2ENZA 1XX6A 1ULNA 2GVIA 3R5DA 1LR9A 3UGLA 1Y1CA 1R0RI 4JCVE 2UZ3A 3E2IA 1S20A 3KY9A 2E5RA 4FKDA 3R5BA 1MJ9A 2GKTI 1TBQR 3TJQA 1KBEA 2RIJA 1SGNI 3E59A 3TOBA 1CE3A 7WGAA 5J8CA 5EX3A 2QQDA 3FSXA 1CT0I 1IY6A 1ULMA 3SEKC 1TURA 3MEKA 2KCXA 1XBTA 2NU4I 1CT4I 2PQ8A 3VDPA 1BMOA 2L8EA 1HDLA 2X3TA 9WGAA 2KMPA 3QTLD 2LUYA 1H0ZA 1Z2IA 3SGBI 1UVGA 3TOAA 4E1PA 1SGDI 1MT1A 1TOTA 2ENNA 2KMRA 3HH2C 3OVOA 1CHOI 3PDNA 1IW4A 1KMAA 1XA6A 3TO9A 2WVJA 3TO7A 1X4SA 1WGCA 1FARA 1OVOA 2JW6A 1P9ZA 1SGEI 2KMOA 2ODDA 1AN1I 2ARPF 1TBRR 1DS2I 2GIVA
chains in the Genus database with same CATH topology
1U5KA 4L9MA 1NUBA 1W3SA 1CSOI 2FNFX 2ROWA 1OMUA 2SGFI 2QPOA 3OXGA 2SGDI 2NU2I 1SGQI 5HI7A 3UGIA 2QQEA 1TBNA 1TUSA 1SGPI 1TGSI 2WCYA 3OXLA 1DS3I 1N13A 4UXHA 2YQPA 1OMTA 2JZMA 1BUSA 4UXJA 1YU6C 2J87A 2JXDA 2NU1I 2V1CA 2A20A 3BJIA 5FUYA 3OL0A 3FC3A 1M8BA 2N52A 4A24A 1FYBA 1W4RA 2N71A 2V53A 1LR8A 3QWPA 3UGDA 4HGUA 5EX0A 2NU0I 3UFFA 2F3CI 4SGBI 2LEOA 2J9RA 2SGPI 3SGQI 5HQ8A 5FUWA 1CT2I 4E1RA 5FUXA 1KBFA 2SGEI 1PTQA 2N17A 2N1AB 3B4VC 2V1CC 1PPFI 5JHWC 2XRCA 2BUSA 5CCLA 1Y8FA 1HJAI 2P6AC 2DB6A 1PCEA 3GOXA 3OXFA 1UVFA 1SGYI 2W0TA 1OYVI 1LR7A 2YUUA 1TBOA 1VDDA 1CGJI 4OVOA 1PJUA 2DIPA 1PTRA 3RU0A 1FAQA 2JA1A 5FUVA 2QQ0A 2ELIA 2NU3I 3UEJA 2JYYA 1SGRI 4GI3C 2M5XA 1V1HA 4B6DA 1Y1BA 2OVOA 1V1IA 1HPTA 1X74A 1UUCA 1TIHA 3UEYA 5CCMA 1CGII 2QQCA 1IY5A 1YTPA 2E73A 2K9HA 3VDUA 2VRWB 2OD1A 2L7XA 1M8CA 2B0UC 2ERWA 1R79A 2ORWA 2SGQI 1RFHA 2GKRI 3CXLA 2ORVA 4UXIA 5DAEA 1Z7KB 2CJSC 3VE5A 2KMQA 3D00A 2B8TA 2ENZA 1XX6A 2GVIA 1LR9A 3UGLA 1Y1CA 1R0RI 4JCVE 2UZ3A 3E2IA 3KY9A 2E5RA 4FKDA 2GKTI 1TBQR 3TJQA 1KBEA 3E59A 1SGNI 1CE3A 5EX3A 2QQDA 1CT0I 1IY6A 3SEKC 1TURA 3MEKA 2KCXA 1XBTA 2NU4I 1CT4I 3VDPA 1BMOA 2L8EA 1HDLA 2KMPA 3QTLD 2LUYA 1H0ZA 3SGBI 1UVGA 4E1PA 1SGDI 1MT1A 1TOTA 2ENNA 2KMRA 3HH2C 3OVOA 1CHOI 3PDNA 1IW4A 1KMAA 1XA6A 2WVJA 1X4SA 1FARA 1OVOA 2JW6A 1SGEI 2KMOA 2ODDA 1AN1I 2ARPF 1TBRR 1DS2I 2GKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUB A;  1CSO I;  1OMU A;  2SGF I;  2SGD I;  2NU2 I;  1SGQ I;  1TUS A;  1SGP I;  1TGS I;  2WCY A;  1DS3 I;  1N13 A;  1OMT A;  2JZM A;  1BUS A;  1YU6 C;  2JXD A;  2NU1 I;  1M8B A;  2N52 A;  1FYB A;  2N71 A;  2V53 A;  1LR8 A;  4HGU A;  2NU0 I;  2F3C I;  4SGB I;  2LEO A;  2SGP I;  3SGQ I;  1CT2 I;  2SGE I;  2N17 A;  3B4V C;  1PPF I;  5JHW C;  2XRC A;  2BUS A;  1HJA I;  2P6A C;  1PCE A;  1UVF A;  1SGY I;  1OYV I;  1LR7 A;  1CGJ I;  4OVO A;  1PJU A;  2NU3 I;  2JYY A;  1SGR I;  4GI3 C;  2M5X A;  1Y1B A;  2OVO A;  1HPT A;  1UUC A;  1TIH A;  1CGI I;  2QQC A;  1IY5 A;  1YTP A;  2SGQ I;  1M8C A;  2B0U C;  2ERW A;  5DAE A;  2GKR I;  1Z7K B;  2KMQ A;  1LR9 A;  1Y1C A;  1R0R I;  2GKT I;  1TBQ R;  3TJQ A;  1SGN I;  1CE3 A;  2QQD A;  1CT0 I;  1IY6 A;  3SEK C;  1TUR A;  2KCX A;  2NU4 I;  1CT4 I;  1BMO A;  1HDL A;  2KMP A;  3QTL D;  1H0Z A;  3SGB I;  1UVG A;  1SGD I;  1MT1 A;  2KMR A;  3HH2 C;  3OVO A;  1CHO I;  1IW4 A;  1KMA A;  1OVO A;  1SGE I;  2KMO A;  1AN1 I;  2ARP F;  1TBR R;  1DS2 I;  2GKV A; 
#chains in the Genus database with same CATH topology
 1U5K A;  4L9M A;  1NUB A;  1W3S A;  1CSO I;  2FNF X;  2ROW A;  1OMU A;  2SGF I;  2QPO A;  3OXG A;  2SGD I;  2NU2 I;  1FY7 A;  3UOE A;  1SGQ I;  5HI7 A;  3UGI A;  1WKX A;  1TBN A;  2QQE A;  1TUS A;  1SGP I;  1TGS I;  3R5C A;  2WCY A;  3OXL A;  1DS3 I;  1N13 A;  4UXH A;  2Y0M A;  2YQP A;  1OMT A;  2JZM A;  1BUS A;  4UXJ A;  1YU6 C;  2J87 A;  1UHA A;  2JXD A;  2NU1 I;  2V1C A;  2A20 A;  3BJI A;  5FUY A;  3OL0 A;  3FC3 A;  1M8B A;  4MPI A;  2N52 A;  4A24 A;  1FYB A;  1W4R A;  1K7V A;  1WGT A;  2N71 A;  2UVO A;  1MJB A;  2V53 A;  1LR8 A;  3QWP A;  2OZU A;  3UGD A;  4HGU A;  5EX0 A;  2NU0 I;  2CWH A;  3UFF A;  2F3C I;  1ULK A;  1WTJ A;  3QAH A;  4SGB I;  2LEO A;  2J9R A;  2SGP I;  3SGQ I;  2GKV A;  5HQ8 A;  5FUW A;  1CT2 I;  2X52 A;  3R5A A;  5FUX A;  4E1R A;  1KBF A;  2SGE I;  2LB7 A;  1PTQ A;  2N17 A;  2N1A B;  3B4V C;  2V1C C;  1PPF I;  5JHW C;  2XRC A;  1MJA A;  2BUS A;  2DKV A;  5CCL A;  1K7T A;  1Y8F A;  5E3R A;  4DNC A;  3FSY A;  1HJA I;  2CWF A;  4WP4 A;  2P6A C;  2DB6 A;  1PCE A;  2WGC A;  3OXF A;  3GOX A;  1UVF A;  1SGY I;  2W0T A;  1OYV I;  1LR7 A;  2YUU A;  1HEV A;  1TBO A;  1VDD A;  1CGJ I;  2OU2 A;  4OVO A;  3TO6 A;  1PJU A;  2DIP A;  1NXU A;  1PTR A;  3RU0 A;  1FAQ A;  2JA1 A;  5J8F A;  5FUV A;  2QQ0 A;  2ELI A;  2NU3 I;  3UEJ A;  2JYY A;  1SGR I;  4GI3 C;  2M5X A;  1V1H A;  4B6D A;  1Y1B A;  2OVO A;  2CWG A;  5E3P A;  1V1I A;  1HPT A;  1X74 A;  1UUC A;  1TIH A;  1K7U A;  3UEY A;  1Q9B A;  5CCM A;  1CGI I;  2QQC A;  5E3Q A;  1YTP A;  1IY5 A;  2E73 A;  2K9H A;  3VDU A;  2VRW B;  4AML A;  2RC4 A;  1P9G A;  2OD1 A;  2L7X A;  1M8C A;  2B0U C;  2ERW A;  1R79 A;  2ORW A;  2SGQ I;  1RFH A;  2GKR I;  3CXL A;  2ORV A;  4UXI A;  5DAE A;  1Z7K B;  2CJS C;  3VE5 A;  2KMQ A;  3D00 A;  2B8T A;  2ENZ A;  1XX6 A;  1ULN A;  2GVI A;  3R5D A;  1LR9 A;  3UGL A;  1Y1C A;  1R0R I;  4JCV E;  2UZ3 A;  3E2I A;  1S20 A;  3KY9 A;  2E5R A;  4FKD A;  3R5B A;  1MJ9 A;  2GKT I;  1TBQ R;  3TJQ A;  1KBE A;  2RIJ A;  1SGN I;  3E59 A;  3TOB A;  1CE3 A;  7WGA A;  5J8C A;  5EX3 A;  2QQD A;  3FSX A;  1CT0 I;  1IY6 A;  1ULM A;  3SEK C;  1TUR A;  3MEK A;  2KCX A;  1XBT A;  2NU4 I;  1CT4 I;  2PQ8 A;  3VDP A;  1BMO A;  2L8E A;  1HDL A;  2X3T A;  9WGA A;  2KMP A;  3QTL D;  2LUY A;  1H0Z A;  1Z2I A;  3SGB I;  1UVG A;  3TOA A;  4E1P A;  1SGD I;  1MT1 A;  1TOT A;  2ENN A;  2KMR A;  3HH2 C;  3OVO A;  1CHO I;  3PDN A;  1IW4 A;  1KMA A;  1XA6 A;  3TO9 A;  2WVJ A;  3TO7 A;  1X4S A;  1WGC A;  1FAR A;  1OVO A;  2JW6 A;  1P9Z A;  1SGE I;  2KMO A;  2ODD A;  1AN1 I;  2ARP F;  1TBR R;  1DS2 I;  2GIV A; 
#chains in the Genus database with same CATH homology
 1U5K A;  4L9M A;  1NUB A;  1W3S A;  1CSO I;  2FNF X;  2ROW A;  1OMU A;  2SGF I;  2QPO A;  3OXG A;  2SGD I;  2NU2 I;  1SGQ I;  5HI7 A;  3UGI A;  2QQE A;  1TBN A;  1TUS A;  1SGP I;  1TGS I;  2WCY A;  3OXL A;  1DS3 I;  1N13 A;  4UXH A;  2YQP A;  1OMT A;  2JZM A;  1BUS A;  4UXJ A;  1YU6 C;  2J87 A;  2JXD A;  2NU1 I;  2V1C A;  2A20 A;  3BJI A;  5FUY A;  3OL0 A;  3FC3 A;  1M8B A;  2N52 A;  4A24 A;  1FYB A;  1W4R A;  2N71 A;  2V53 A;  1LR8 A;  3QWP A;  3UGD A;  4HGU A;  5EX0 A;  2NU0 I;  3UFF A;  2F3C I;  4SGB I;  2LEO A;  2J9R A;  2SGP I;  3SGQ I;  5HQ8 A;  5FUW A;  1CT2 I;  4E1R A;  5FUX A;  1KBF A;  2SGE I;  1PTQ A;  2N17 A;  2N1A B;  3B4V C;  2V1C C;  1PPF I;  5JHW C;  2XRC A;  2BUS A;  5CCL A;  1Y8F A;  1HJA I;  2P6A C;  2DB6 A;  1PCE A;  3GOX A;  3OXF A;  1UVF A;  1SGY I;  2W0T A;  1OYV I;  1LR7 A;  2YUU A;  1TBO A;  1VDD A;  1CGJ I;  4OVO A;  1PJU A;  2DIP A;  1PTR A;  3RU0 A;  1FAQ A;  2JA1 A;  5FUV A;  2QQ0 A;  2ELI A;  2NU3 I;  3UEJ A;  2JYY A;  1SGR I;  4GI3 C;  2M5X A;  1V1H A;  4B6D A;  1Y1B A;  2OVO A;  1V1I A;  1HPT A;  1X74 A;  1UUC A;  1TIH A;  3UEY A;  5CCM A;  1CGI I;  2QQC A;  1IY5 A;  1YTP A;  2E73 A;  2K9H A;  3VDU A;  2VRW B;  2OD1 A;  2L7X A;  1M8C A;  2B0U C;  2ERW A;  1R79 A;  2ORW A;  2SGQ I;  1RFH A;  2GKR I;  3CXL A;  2ORV A;  4UXI A;  5DAE A;  1Z7K B;  2CJS C;  3VE5 A;  2KMQ A;  3D00 A;  2B8T A;  2ENZ A;  1XX6 A;  2GVI A;  1LR9 A;  3UGL A;  1Y1C A;  1R0R I;  4JCV E;  2UZ3 A;  3E2I A;  3KY9 A;  2E5R A;  4FKD A;  2GKT I;  1TBQ R;  3TJQ A;  1KBE A;  3E59 A;  1SGN I;  1CE3 A;  5EX3 A;  2QQD A;  1CT0 I;  1IY6 A;  3SEK C;  1TUR A;  3MEK A;  2KCX A;  1XBT A;  2NU4 I;  1CT4 I;  3VDP A;  1BMO A;  2L8E A;  1HDL A;  2KMP A;  3QTL D;  2LUY A;  1H0Z A;  3SGB I;  1UVG A;  4E1P A;  1SGD I;  1MT1 A;  1TOT A;  2ENN A;  2KMR A;  3HH2 C;  3OVO A;  1CHO I;  3PDN A;  1IW4 A;  1KMA A;  1XA6 A;  2WVJ A;  1X4S A;  1FAR A;  1OVO A;  2JW6 A;  1SGE I;  2KMO A;  2ODD A;  1AN1 I;  2ARP F;  1TBR R;  1DS2 I;  2GKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...