1IW4A

Solution structure of ascidian trypsin inhibitor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
AHMDCTEFNPLCRCNKMLGDLICAVIGDAKEEHRNMCALCCEHPGGFEYSNGPCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords trypsin inhibitor
publication title Solution structure of ascidian trypsin inhibitor determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
molecule tags Protein binding
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2002-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1iw4A00
1PJUA 2NU2I 1N13A 2NU4I 1TBQR 2B0UC 2GKVA 1KMAA 3SGQI 1M8BA 1R0RI 1DS3I 1TGSI 1PPFI 1CT0I 4GI3C 1HJAI 2SGFI 2GKTI 2SGDI 1UVFA 1H0ZA 2NU3I 1M8CA 4HGUA 1UUCA 4OVOA 1YU6C 2N17A 2KCXA 2QQCA 2N52A 3B4VC 1SGPI 1TUSA 2F3CI 1BMOA 2NU1I 1SGNI 1HDLA 2GKRI 1OVOA 1TIHA 2LEOA 2KMOA 2P6AC 1CT4I 2M5XA 2QQDA 1TURA 2SGEI 2JYYA 1SGEI 4SGBI 2SGQI 2V53A 2XRCA 1CT2I 1Z7KB 3OVOA 5DAEA 1OYVI 1PCEA 2NU0I 2OVOA 2N71A 2WCYA 1IW4A 1UVGA 1CGJI 1OMUA 3TJQA 1SGQI 1AN1I 1MT1A 2KMPA 2JXDA 1LR8A 2SGPI 1HPTA 2JZMA 3QTLD 1BUSA 1CGII 1DS2I 1Y1BA 1FYBA 1LR9A 2ARPF 1CSOI 2BUSA 1LR7A 1CE3A 1SGDI 1OMTA 3SGBI 5JHWC 1SGRI 1TBRR 2KMRA 1CHOI 2ERWA 2KMQA 3SEKC 1SGYI 3HH2C 1IY6A 1YTPA 1Y1CA 1IY5A 1NUBA
chains in the Genus database with same CATH superfamily
1PJUA 1KBEA 2NU2I 1MJ9A 9WGAA 1N13A 2NU4I 5HQ8A 1TBQR 2B0UC 2X52A 1X74A 2GKVA 3UOEA 5FUYA 2JW6A 3SGQI 1KMAA 3OL0A 1M8BA 1R0RI 3VDUA 1DS3I 2ROWA 4UXIA 1TGSI 3PDNA 3OXLA 1PPFI 1CT0I 2B8TA 2E73A 2DKVA 1HJAI 1UHAA 4GI3C 1K7TA 3FSXA 4UXJA 1ULKA 4JCVE 2SGFI 3VE5A 2GKTI 2ORVA 7WGAA 2DB6A 3TOAA 2OU2A 2SGDI 1UVFA 2ORWA 2X3TA 5CCMA 1H0ZA 2NU3I 1WKXA 1M8CA 1RFHA 1ULNA 2ELIA 2LB7A 5J8FA 4HGUA 1VDDA 3UFFA 1UUCA 4OVOA 2E5RA 2JA1A 2QQEA 1YU6C 3KY9A 2N17A 2W0TA 2PQ8A 5EX3A 2GVIA 2KCXA 1FARA 1Q9BA 2N52A 2QQCA 1WGTA 1SGPI 1TBOA 2RIJA 2V1CC 3B4VC 1Z2IA 3E2IA 1TUSA 2A20A 2F3CI 1BMOA 3CXLA 3MEKA 1P9GA 1TOTA 2NU1I 1SGNI 2OD1A 2GKRI 2UVOA 1HDLA 1OVOA 1TIHA 2LEOA 2KMOA 2P6AC 1P9ZA 1CT4I 2CWGA 2WGCA 2M5XA 4FKDA 2QQDA 3UEJA 1TURA 1U5KA 2SGEI 2JYYA 2RC4A 3GOXA 2ENZA 4E1PA 3QWPA 3D00A 1PTRA 1SGEI 1WTJA 2CWHA 1WGCA 4A24A 1XX6A 2VRWB 2K9HA 4SGBI 2SGQI 2FNFX 2V53A 5E3QA 1HEVA 3TO6A 1S20A 2XRCA 2ENNA 3R5CA 1CT2I 2CJSC 2GIVA 3UGIA 1Z7KB 4E1RA 3OVOA 5DAEA 2WVJA 5E3RA 3TOBA 1OYVI 5FUVA 1PCEA 2NU0I 5EX0A 1FAQA 2J9RA 2OVOA 2DIPA 5J8CA 3UGLA 2J87A 2N71A 4DNCA 2WCYA 1IW4A 1XA6A 1KBFA 1UVGA 5CCLA 1CGJI 1OMUA 1XBTA 2YUUA 5FUXA 3TJQA 4B6DA 3UEYA 3TO7A 1SGQI 2V1CA 5E3PA 1AN1I 2L7XA 2UZ3A 3OXGA 3R5BA 1MT1A 1ULMA 2KMPA 4L9MA 2JXDA 3OXFA 1LR8A 2SGPI 3FC3A 1NXUA 1HPTA 1X4SA 1K7UA 2JZMA 1CGII 3QTLD 1BUSA 2N1AB 2QQ0A 1Y8FA 2CWFA 1DS2I 1Y1BA 3BJIA 1FYBA 1V1HA 1LR9A 1R79A 5FUWA 1W3SA 2ARPF 1CSOI 1K7VA 2L8EA 2BUSA 2Y0MA 1LR7A 1CE3A 1PTQA 3R5DA 1SGDI 2LUYA 1OMTA 2YQPA 3SGBI 5JHWC 4AMLA 1SGRI 1FY7A 1TBRR 1MJAA 2KMRA 3FSYA 1CHOI 2ERWA 2KMQA 2QPOA 5HI7A 3SEKC 1TBNA 1MJBA 4UXHA 3UGDA 1W4RA 1SGYI 3HH2C 3TO9A 3RU0A 1IY6A 2OZUA 1V1IA 3QAHA 3R5AA 2ODDA 3E59A 1YTPA 4MPIA 3VDPA 1Y1CA 4WP4A 1IY5A 1NUBA
chains in the Genus database with same CATH topology
1PJUA 1KBEA 2NU2I 1N13A 2NU4I 5HQ8A 1TBQR 2B0UC 1X74A 2GKVA 5FUYA 2JW6A 3SGQI 1KMAA 3OL0A 1M8BA 1R0RI 3VDUA 1DS3I 2ROWA 4UXIA 1TGSI 3PDNA 3OXLA 1PPFI 1CT0I 2B8TA 2E73A 4GI3C 1HJAI 4UXJA 4JCVE 2SGFI 2GKTI 2ORVA 2DB6A 2SGDI 1UVFA 2ORWA 5CCMA 1H0ZA 2NU3I 1M8CA 1RFHA 2ELIA 4HGUA 1VDDA 3UFFA 1UUCA 4OVOA 2E5RA 2JA1A 2QQEA 1YU6C 3KY9A 2N17A 2W0TA 5EX3A 3GOXA 2GVIA 2KCXA 1FARA 2N52A 2QQCA 2V1CC 3B4VC 1SGPI 1TBOA 3E2IA 1TUSA 2A20A 2F3CI 1BMOA 3CXLA 3MEKA 1TOTA 2NU1I 1SGNI 2OD1A 2GKRI 1HDLA 1OVOA 1TIHA 2LEOA 2KMOA 2P6AC 1CT4I 2M5XA 4FKDA 2QQDA 3UEJA 1TURA 1U5KA 2SGEI 2JYYA 2ENZA 4E1PA 3QWPA 3D00A 1PTRA 1SGEI 4A24A 1XX6A 2VRWB 2K9HA 4SGBI 2SGQI 2FNFX 2V53A 2XRCA 2ENNA 1CT2I 2CJSC 3UGIA 1Z7KB 4E1RA 3OVOA 5DAEA 2WVJA 1OYVI 5FUVA 1PCEA 2NU0I 5EX0A 1FAQA 2J9RA 2OVOA 2DIPA 3UGLA 2J87A 2N71A 1KBFA 2WCYA 1IW4A 1XA6A 1UVGA 5CCLA 1CGJI 1OMUA 1XBTA 2YUUA 5FUXA 3TJQA 4B6DA 3UEYA 1SGQI 2V1CA 1AN1I 2L7XA 2UZ3A 3OXGA 3VE5A 1MT1A 4L9MA 2KMPA 2JXDA 3OXFA 1LR8A 2SGPI 3FC3A 1HPTA 1X4SA 2JZMA 3QTLD 1CGII 1BUSA 2N1AB 2QQ0A 1Y8FA 1DS2I 1Y1BA 3BJIA 1FYBA 1V1HA 1LR9A 1R79A 5FUWA 1W3SA 2ARPF 1CSOI 2L8EA 2BUSA 1LR7A 1CE3A 1PTQA 1SGDI 2LUYA 1OMTA 2YQPA 3SGBI 5JHWC 1SGRI 1TBRR 2KMRA 1CHOI 2ERWA 2KMQA 2QPOA 5HI7A 3SEKC 1TBNA 4UXHA 3UGDA 1W4RA 1SGYI 3HH2C 3RU0A 1IY6A 1V1IA 2ODDA 3E59A 1YTPA 3VDPA 1Y1CA 1IY5A 1NUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJU A;  2NU2 I;  1N13 A;  2NU4 I;  1TBQ R;  2B0U C;  2GKV A;  1KMA A;  3SGQ I;  1M8B A;  1R0R I;  1DS3 I;  1TGS I;  1PPF I;  1CT0 I;  4GI3 C;  1HJA I;  2SGF I;  2GKT I;  2SGD I;  1UVF A;  1H0Z A;  2NU3 I;  1M8C A;  4HGU A;  1UUC A;  4OVO A;  1YU6 C;  2N17 A;  2KCX A;  2QQC A;  2N52 A;  3B4V C;  1SGP I;  1TUS A;  2F3C I;  1BMO A;  2NU1 I;  1SGN I;  1HDL A;  2GKR I;  1OVO A;  1TIH A;  2LEO A;  2KMO A;  2P6A C;  1CT4 I;  2M5X A;  2QQD A;  1TUR A;  2SGE I;  2JYY A;  1SGE I;  4SGB I;  2SGQ I;  2V53 A;  2XRC A;  1CT2 I;  1Z7K B;  3OVO A;  5DAE A;  1OYV I;  1PCE A;  2NU0 I;  2OVO A;  2N71 A;  2WCY A;  1IW4 A;  1UVG A;  1CGJ I;  1OMU A;  3TJQ A;  1SGQ I;  1AN1 I;  1MT1 A;  2KMP A;  2JXD A;  1LR8 A;  2SGP I;  1HPT A;  2JZM A;  3QTL D;  1BUS A;  1CGI I;  1DS2 I;  1Y1B A;  1FYB A;  1LR9 A;  2ARP F;  1CSO I;  2BUS A;  1LR7 A;  1CE3 A;  1SGD I;  1OMT A;  3SGB I;  5JHW C;  1SGR I;  1TBR R;  2KMR A;  1CHO I;  2ERW A;  2KMQ A;  3SEK C;  1SGY I;  3HH2 C;  1IY6 A;  1YTP A;  1Y1C A;  1IY5 A;  1NUB A; 
#chains in the Genus database with same CATH topology
 1PJU A;  1KBE A;  2NU2 I;  1MJ9 A;  9WGA A;  1N13 A;  2NU4 I;  5HQ8 A;  1TBQ R;  2B0U C;  2X52 A;  1X74 A;  2GKV A;  3UOE A;  5FUY A;  2JW6 A;  3SGQ I;  1KMA A;  3OL0 A;  1M8B A;  1R0R I;  3VDU A;  1DS3 I;  2ROW A;  4UXI A;  1TGS I;  3PDN A;  3OXL A;  1PPF I;  1CT0 I;  2B8T A;  2E73 A;  2DKV A;  1HJA I;  1UHA A;  4GI3 C;  1K7T A;  3FSX A;  4UXJ A;  1ULK A;  4JCV E;  2SGF I;  3VE5 A;  2GKT I;  2ORV A;  7WGA A;  2DB6 A;  3TOA A;  2OU2 A;  2SGD I;  1UVF A;  2ORW A;  2X3T A;  5CCM A;  1H0Z A;  2NU3 I;  1WKX A;  1M8C A;  1RFH A;  1ULN A;  2ELI A;  2LB7 A;  5J8F A;  4HGU A;  1VDD A;  3UFF A;  1UUC A;  4OVO A;  2E5R A;  2JA1 A;  2QQE A;  1YU6 C;  3KY9 A;  2N17 A;  2W0T A;  2PQ8 A;  5EX3 A;  2GVI A;  2KCX A;  1FAR A;  1Q9B A;  2N52 A;  2QQC A;  1WGT A;  1SGP I;  1TBO A;  2RIJ A;  2V1C C;  3B4V C;  1Z2I A;  3E2I A;  1TUS A;  2A20 A;  2F3C I;  1BMO A;  3CXL A;  3MEK A;  1P9G A;  1TOT A;  2NU1 I;  1SGN I;  2OD1 A;  2GKR I;  2UVO A;  1HDL A;  1OVO A;  1TIH A;  2LEO A;  2KMO A;  2P6A C;  1P9Z A;  1CT4 I;  2CWG A;  2WGC A;  2M5X A;  4FKD A;  2QQD A;  3UEJ A;  1TUR A;  1U5K A;  2SGE I;  2JYY A;  2RC4 A;  3GOX A;  2ENZ A;  4E1P A;  3QWP A;  3D00 A;  1PTR A;  1SGE I;  1WTJ A;  2CWH A;  1WGC A;  4A24 A;  1XX6 A;  2VRW B;  2K9H A;  4SGB I;  2SGQ I;  2FNF X;  2V53 A;  5E3Q A;  1HEV A;  3TO6 A;  1S20 A;  2XRC A;  2ENN A;  3R5C A;  1CT2 I;  2CJS C;  2GIV A;  3UGI A;  1Z7K B;  4E1R A;  3OVO A;  5DAE A;  2WVJ A;  5E3R A;  3TOB A;  1OYV I;  5FUV A;  1PCE A;  2NU0 I;  5EX0 A;  1FAQ A;  2J9R A;  2OVO A;  2DIP A;  5J8C A;  3UGL A;  2J87 A;  2N71 A;  4DNC A;  2WCY A;  1IW4 A;  1XA6 A;  1KBF A;  1UVG A;  5CCL A;  1CGJ I;  1OMU A;  1XBT A;  2YUU A;  5FUX A;  3TJQ A;  4B6D A;  3UEY A;  3TO7 A;  1SGQ I;  2V1C A;  5E3P A;  1AN1 I;  2L7X A;  2UZ3 A;  3OXG A;  3R5B A;  1MT1 A;  1ULM A;  2KMP A;  4L9M A;  2JXD A;  3OXF A;  1LR8 A;  2SGP I;  3FC3 A;  1NXU A;  1HPT A;  1X4S A;  1K7U A;  2JZM A;  1CGI I;  3QTL D;  1BUS A;  2N1A B;  2QQ0 A;  1Y8F A;  2CWF A;  1DS2 I;  1Y1B A;  3BJI A;  1FYB A;  1V1H A;  1LR9 A;  1R79 A;  5FUW A;  1W3S A;  2ARP F;  1CSO I;  1K7V A;  2L8E A;  2BUS A;  2Y0M A;  1LR7 A;  1CE3 A;  1PTQ A;  3R5D A;  1SGD I;  2LUY A;  1OMT A;  2YQP A;  3SGB I;  5JHW C;  4AML A;  1SGR I;  1FY7 A;  1TBR R;  1MJA A;  2KMR A;  3FSY A;  1CHO I;  2ERW A;  2KMQ A;  2QPO A;  5HI7 A;  3SEK C;  1TBN A;  1MJB A;  4UXH A;  3UGD A;  1W4R A;  1SGY I;  3HH2 C;  3TO9 A;  3RU0 A;  1IY6 A;  2OZU A;  1V1I A;  3QAH A;  3R5A A;  2ODD A;  3E59 A;  1YTP A;  4MPI A;  3VDP A;  1Y1C A;  4WP4 A;  1IY5 A;  1NUB A; 
#chains in the Genus database with same CATH homology
 1PJU A;  1KBE A;  2NU2 I;  1N13 A;  2NU4 I;  5HQ8 A;  1TBQ R;  2B0U C;  1X74 A;  2GKV A;  5FUY A;  2JW6 A;  3SGQ I;  1KMA A;  3OL0 A;  1M8B A;  1R0R I;  3VDU A;  1DS3 I;  2ROW A;  4UXI A;  1TGS I;  3PDN A;  3OXL A;  1PPF I;  1CT0 I;  2B8T A;  2E73 A;  4GI3 C;  1HJA I;  4UXJ A;  4JCV E;  2SGF I;  2GKT I;  2ORV A;  2DB6 A;  2SGD I;  1UVF A;  2ORW A;  5CCM A;  1H0Z A;  2NU3 I;  1M8C A;  1RFH A;  2ELI A;  4HGU A;  1VDD A;  3UFF A;  1UUC A;  4OVO A;  2E5R A;  2JA1 A;  2QQE A;  1YU6 C;  3KY9 A;  2N17 A;  2W0T A;  5EX3 A;  3GOX A;  2GVI A;  2KCX A;  1FAR A;  2N52 A;  2QQC A;  2V1C C;  3B4V C;  1SGP I;  1TBO A;  3E2I A;  1TUS A;  2A20 A;  2F3C I;  1BMO A;  3CXL A;  3MEK A;  1TOT A;  2NU1 I;  1SGN I;  2OD1 A;  2GKR I;  1HDL A;  1OVO A;  1TIH A;  2LEO A;  2KMO A;  2P6A C;  1CT4 I;  2M5X A;  4FKD A;  2QQD A;  3UEJ A;  1TUR A;  1U5K A;  2SGE I;  2JYY A;  2ENZ A;  4E1P A;  3QWP A;  3D00 A;  1PTR A;  1SGE I;  4A24 A;  1XX6 A;  2VRW B;  2K9H A;  4SGB I;  2SGQ I;  2FNF X;  2V53 A;  2XRC A;  2ENN A;  1CT2 I;  2CJS C;  3UGI A;  1Z7K B;  4E1R A;  3OVO A;  5DAE A;  2WVJ A;  1OYV I;  5FUV A;  1PCE A;  2NU0 I;  5EX0 A;  1FAQ A;  2J9R A;  2OVO A;  2DIP A;  3UGL A;  2J87 A;  2N71 A;  1KBF A;  2WCY A;  1IW4 A;  1XA6 A;  1UVG A;  5CCL A;  1CGJ I;  1OMU A;  1XBT A;  2YUU A;  5FUX A;  3TJQ A;  4B6D A;  3UEY A;  1SGQ I;  2V1C A;  1AN1 I;  2L7X A;  2UZ3 A;  3OXG A;  3VE5 A;  1MT1 A;  4L9M A;  2KMP A;  2JXD A;  3OXF A;  1LR8 A;  2SGP I;  3FC3 A;  1HPT A;  1X4S A;  2JZM A;  3QTL D;  1CGI I;  1BUS A;  2N1A B;  2QQ0 A;  1Y8F A;  1DS2 I;  1Y1B A;  3BJI A;  1FYB A;  1V1H A;  1LR9 A;  1R79 A;  5FUW A;  1W3S A;  2ARP F;  1CSO I;  2L8E A;  2BUS A;  1LR7 A;  1CE3 A;  1PTQ A;  1SGD I;  2LUY A;  1OMT A;  2YQP A;  3SGB I;  5JHW C;  1SGR I;  1TBR R;  2KMR A;  1CHO I;  2ERW A;  2KMQ A;  2QPO A;  5HI7 A;  3SEK C;  1TBN A;  4UXH A;  3UGD A;  1W4R A;  1SGY I;  3HH2 C;  3RU0 A;  1IY6 A;  1V1I A;  2ODD A;  3E59 A;  1YTP A;  3VDP A;  1Y1C A;  1IY5 A;  1NUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...