1FY7A

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
273
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESA1 HISTONE ACETYLTRANSFERASE
publication title Crystal structure of yeast Esa1 suggests a unified mechanism for catalysis and substrate binding by histone acetyltransferases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 81
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fy7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1fy7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1fy7A02
3F8NA 1Q2CA 2D4OA 3FMQA 3SXYA 2EV0A 1I5ZA 2HQRA 5CNPA 1DUXC 3K1NA 1BBYA 4FX0A 1PDNC 3QOPA 3BOQA 3PQKA 1TQMA 2R1IA 4ZYHA 2QYOA 4BHPA 4Y17A 1S5KA 3TOBA 4RGUA 3HOTA 2Z5UA 3LWFA 1KQ8A 1TLHB 3U9GA 4LG0A 3IL2A 2Y0MA 4I7HA 3QP5A 4G7ZF 3ECOA 2VZZA 1ONVA 2LSOA 1YFHA 3FHZA 1P92A 2YX4A 4I2OA 2HOEA 4LUAA 4I01A 2DK5A 3IWFA 2JT1A 4FD5A 2JZYA 3P2HA 2XRNA 3I5UA 2E1NA 1IRGA 5HS7A 4IF4A 1S7AA 3VB2A 2KIFA 3LFKA 2HQNA 4KOTA 5ICFA 4G6QA 3TDUC 3QPHA 1QQIA 2VZYA 1F5TA 4BMHA 1FX7A 2RNJA 4CYDA 1H0MA 5HMNA 4EM2A 3I53A 5IT9Z 4JXRA 1TBXA 5FB2A 3KLNA 3FBUA 2H6BA 3SFZA 1W5SA 2RGVA 4F7ZA 1G4DA 4F0YA 4KIBA 4B09A 1YLEA 3ZN1A 2GWRA 1QGPA 3F8KA 1EV7A 4CS0B 2P7VB 2JRTA 2CO5A 4EGYA 4H0EA 2V79A 2XAGA 5EBVA 2DO7A 2O61A 2J5PA 1BOBA 3RTRA 1KU7A 3P9IA 4WK8F 1XGNA 5CVIA 3LODA 1Z9UA 3U1DA 2VXZA 2EV6A 2BEOA 4HX7A 4M9XA 3C7JA 1S3JA 3FNCA 1T6SA 1R00A 4KUAA 2IJLA 4L9JA 3HTSB 2WPXA 2IW5A 4EJTA 4KFCA 2CFXA 3FXUA 2P6FA 1ZREA 2FQ3A 1V3FA 2B5GA 1GHCA 3I54A 1NE9A 3CXQA 2FIWA 5D5WB 5CJ9A 4HDUA 3R1KA 1S7LA 4U9ZA 1QO0D 2A4NA 5KK1A 3NEUA 3BP8A 2PBIA 3IC7A 1HSTA 4Y49C 3J80Z 3VFZA 1F1ZA 5FLXK 5FFZA 5J8CA 4CAXA 3KEQA 3EXNA 4EMSA 3JSPA 2BBYA 1LDKB 3E97A 4LLGF 5HDKA 2IP2A 1Z9CA 3B8GA 3B02A 4G7HF 1RIOH 4PGHA 3DV8A 2EUIA 5KTDA 4CGZA 2J8MA 5JR3A 2BEIA 5LLQA 3SHFA 4PSXA 3E5UA 1IN8A 1P2FA 3ISPA 1NMTA 1HSJA 5LHHA 1KQ9A 3IRRA 1WWZA 1SD6A 5IB0A 4G8XA 4IHSA 3S6GA 4NSQA 3T5XA 5E8IA 2QIRA 5LEJA 3T9YA 2MC3A 4Y15A 4AVPA 1ZRFA 3C3WA 4HLXA 2ADUA 4UVCA 5K5OA 4R1HA 3K9UA 1P4XA 4AIKA 3HSEA 4FX4A 1XD7A 4L8AA 4FD4A 4HX4A 1Z4RA 2E7XA 3KP7A 3WTWC 2J8RA 2Q7BA 5K1YA 4M9ZA 4MGRA 2D2WA 4RAZA 2GXBA 3CXSA 4LLLA 4HQMA 1C0WA 3BDDA 2VBXA 2AXLA 2VBWA 2E1CA 4CICA 3CUQB 1YVKA 2R98A 5H6QA 3TOAA 1BIBA 2D1VA 2CYYA 4WXDA 3RKXA 4KNYA 4RGSA 4KVME 1LNWA 2P7CB 4EVIA 1U5TB 5AIPA 1KA8A 3HSFA 1HKSA 3M8EA 2VQYA 4M9SA 4NF1A 2DK8A 3GYAA 1IXCA 4UNOA 4AG9A 1Z1DA 2X4HA 1W7PD 3R6SA 4CAWA 3HRSA 1U6MA 5ISVA 1J2XA 4UVBA 2OAZA 1MZBA 4RAYA 3KP4A 3EY5A 2XVCA 1KU2A 4AG7A 2PG4A 4OADA 4R8HA 1J0RA 4LFUA 3FB3A 3D5LA 4HNWB 1G3WA 2NS0A 2ZW7A 3BJAA 4N9IA 3FX3A 1S7KA 3DEUA 1WSUA 1BI2A 1FSEA 2OA4A 3VEPA 3BPXA 3GYHX 1WQ2A 4U7DA 3PQJA 2VXKA 1EH8A 3M8FA 1CF7B 1I1GA 2Q0YA 1MDMB 2W84A 1BI3A 1S7NA 2PSWA 3H3UA 2EK5A 4HV5A 2PN6A 1OYYA 2L02A 3TTHA 2O3FA 2C6YA 5DWMA 2VBYA 3S6KA 3TCVA 3F72A 4YFJA 1IRFA 1AWCA 1Q2YA 3ABTA 5HDGA 2PQ8A 3HSRA 2L01A 2VC1A 2XHKA 4M71A 3NE7A 2FCKA 2PR8A 2DTRA 3BROA 2DU9A 1MKMA 3SXOA 2ZJ2A 3BJ7A 2NNNA 3JVNA 2UXNA 5E17F 1YQAA 3BLNA 2L4MA 4QVTA 4UA3A 2FRHA 4BAYA 2Z11A 2D1HA 2OZGA 2B0LA 2B4BA 1HXDA 2A69F 4B8XA 1G3YA 2RDPA 2KKOA 3R95A 4H6ZA 2ZNZA 4OOIA 2HKOA 4IRGA 4JWPA 4ESJA 3B73A 1V4RA 4H6UA 5D5VB 3TGNA 1SFUA 2O0YA 3WU0A 4L18B 2ACJA 1O3SA 4ZYGA 5FLXZ 3G73A 1XF8A 3M1EA 3S6HA 5D5XB 3CUOA 5D5UB 2CGPA 2V1UA 2JPCA 3ZMUA 1K78A 3LAJA 2OB0A 3FMSA 2STTA 2HDCA 2V1DA 2BYVE 3RKWA 2FMYA 1QSRA 2F5EA 1EH6A 4UV9A 1NSLA 5DD4A 2MA3A 4BXUA 4JJXA 1IICA 1S60A 1Q1HA 1TQIA 4XSZF 3WTTC 3T8RA 2HR3A 5E18F 3WG9A 5L3FA 3R0JA 2EA2A 3V8LA 1ZGAA 2F5FA 4MY0A 5C88A 3L7WA 3BWGA 4HKFA 4AVCA 2QWWA 3FM5A 3O6BB 2B4DB 4RB1A 2DI3A 2EFQA 4ZYDA 3WE3A 4A0ZA 2XAFA 1KU3A 3QPTA 3GKRA 2PEXA 5CVRA 5LHGA 4ESFA 2HFHA 3QB8A 1ZYRF 3PZJA 4IJAA 3I64A 1PUEE 5E1WA 4B5PB 3GLXA 4CRYB 4A6DA 5K5RA 1CM0A 1LB2A 1PP8F 2G0BA 5HH1A 1M4GA 3E6CC 2REEA 5ILSA 4G6DA 1T39A 4GGGA 3HYIA 1LRZA 3V8IA 4TV7A 4EJOA 4Q48A 1S8NA 3I4PA 1SMYF 1SD4A 3I3GA 2M1BA 2BSWA 2CWEA 3CO6C 4HDVA 1ODDA 1YLFA 4A6EA 3J81K 3F3XA 3RIRA 1WI9A 2HTSA 3ZQ7A 5JHUA 4BH9A 2P0WA 3F8CA 3SZPA 3LD2A 4A0YA 4QWQA 1YW7A 3T0YA 5HVQC 4XNHB 1K6OA 1HW2A 3FM3A 3P2FA 2OD5A 1G6NA 1E17A 3CUQC 5D8LB 4AD9A 1ZG1A 1G3TA 1R5GA 4XBFA 4N0BA 1QZZA 1O7LA 2ETHA 3MQ0A 4JLYA 1ZRCA 1U5TC 2H94A 5I0CA 2W57A 4LJZF 1LDJA 4LX9A 5BOXA 5LEKA 4ENMA 4OINF 2Z0ZA 2HS5A 3KETA 1DPRA 2A3SA 1USTA 4HQEA 2HWVA 2X0LA 2AJ6A 1W7PA 5H20A 3NRVA 3E0KA 1OYIA 3S6FA 3CO7C 4QUSA 1Z7UA 4UHTA 3TO6A 4EVYA 3SZTA 3ML6A 1TTYA 2XROA 3DQVC 3TQNA 1ZHFA 2EV5A 2CG4A 1ULYA 1BJAA 2EFWA 1XMKA 3W6KB 3R61A 3JUWA 2IA0A 1XDUA 3KZZA 3HTUA 1FOKA 4ESBA 3WU1B 4UUVA 2GANA 2IA2A 1E2XA 1S7OA 1DDNA 1M4IA 4F6AA 4I98B 4EJWA 4KA4A 3DKWA 2ISYA 2RQPA 1XB4A 2PI0A 1YR0A 2VE9A 2NRAC 1AOYA 4S04A 1I21A 1FP1D 4FD6A 4MTEA 5K5QA 4KLWA 2L4AA 4HF2A 3WTXC 2YU3A 2I79A 3WODF 3F22A 4OAEA 1YYVA 3R9EA 1XEBA 2RC4A 4JD6A 5HLGA 4KOVA 2W25A 1BOAA 1B87A 2F2EA 4EM0B 1B4AA 4MQVA 5DYMA 1W7PB 4OMZA 4NB5A 3V4GA 4QB9A 4WCGA 5F48A 2FNPA 3KE2A 3F8MA 4IVNA 4HV6A 2YSRA 2HZTA 3QRFF 5DEQA 2XAHA 3WR7A 4XPLA 1FZPB 5EC4A 4GS4A 4LG0B 1R36A 4ASNA 4AWXB 2EJRA 4XPKA 3GFLA 5C82A 1YS6A 5IV0A 1B6BA 1IXRC 4YRHA 4EQQA 5ILUA 1BN5A 1OYWA 5ERIA 2F5CA 3ZMTA 3ZPLA 4HBLA 1IYKA 1B6AA 2JLMA 5DV5A 3ECHA 5IT3A 4P5OA 2FSWA 4ON0A 4KORA 1XDSA 5CYVA 3O3KA 1O3TA 1QBJA 4Q47A 3HRTA 2W24A 1YO5C 4PDKA 4IRIA 1CJWA 1D8KA 4ZH4F 2VEZA 4CAVA 1FC3A 1TNTA 3ZMZA 1DP7P 4R3LA 1KYWA 1WK4A 2O28A 4MEXF 2ZKZA 2CW0F 2A61A 3F23A 4ZZDA 3J81Z 3I58A 2F5IA 1UFHA 3KLOA 4G94A 2A6EF 2ARHA 3GFJA 2H27A 4AIJA 4X5KA 3KFWX 1MGTA 3F21A 2G3TA 3WE2A 3GX4X 3RDIA 1SD5A 2DXQA 3D2MA 1YIOA 1MD0A 4I02A 3F6VA 4M6YA 3KKWA 4NXYA 1B9NA 3I0TA 4O3MA 4NQWA 1BI1A 1J59A 3IHUA 4MEYF 3FF5A 1R23A 5F49A 3RPQA 4Z2YA 2JEVA 3HIFA 2Z9OA 1JHHA 1BC7C 3J7AO 1TW2A 2XAQA 4OLLA 5FVJA 4UWJA 2DQRA 1UCRA 1WWXA 2ZMEA 2B5GB 3IWGA 4YG2F 4U0VA 2V1XA 4KT5C 2FSRA 4R79A 2CNSA 4B5OA 5HLIA 4P96A 1Y9KA 3HRUA 4RGRA 4MQ9F 2VBZA 4KOXA 1RUNA 1KQ0A 4XNHC 4E70A 3QAHA 2F5DA 4RGXA 5DCMA 5D4RA 2VT3A 5E1XA 2H5MA 1MJAA 3ZMSA 4AVAA 4IXAA 3QU6A 1LDDA 4U88A 2O8XA 5LRRA 1YREA 5ICCA 1T2KA 2ESHA 2VC0A 4GYGA 4DNCA 2GXGA 4KOWA 2PMHA 2WWYA 3ERED 2Z33A 2B58A 4L5JA 1U2WA 3DP7A 2UWMA 1R1UA 1IAWA 4GCVA 1RUOA 4ONUA 2ELHA 4KMFA 2BL1A 3WTYC 2FNAA 4CO8A 2CNMA 5LHIA 3GZ6A 1ZN2A 3KP2A 5H6RA 2QBYA 4ENKA 2O03A 4YFXF 3I59A 1I6XA 1IUYA 2B3UA 4XLPF 4HNXB 4XPDB 2RKHA 1QSTA 2G7HA 4IUSA 4XLNF 1FT9A 3BJ6A 1R5HA 1HQCA 3RKYA 4KIGA 3V7RA 5H86A 1L3LA 5CVVA 1ON2A 3GW2A 5HOOA 3DR6A 4U9YA 2FXAA 1L0OC 3H3ZA 3W6XA 2L3DA 5D8KB 2VBQA 3GEZA 2Q0OA 3K9TA 1XGMA 1GXPA 2EWNA 4G9YA 1F9NA 3D2PA 4E2AA 3KP6A 1IF1A 1RI7A 2QLZA 5L3DA 2EA4A 2DQLA 5AONA 5DUIA 3E6DA 1K79A 1G3SA 3WTSC 1KZFA 2V6CA 3VOEA 2B3VA 2O6GE 2ZCWA 3HUGA 1VTNC 1YTYA 5TJJA 1SMTA 2ZNYA 4AB7A 4JBAA 4OIRF 1YS7A 2AS5F 2NAZA 1ZGJA 3N4MA 2YX7A 4GXOA 1KGSA 2XKOA 2PRBA 1EH7A 3E6BA 3R4KA 1JE8A 1XGSA 2PDOA 4LGWA 1P0HA 3L9FA 4HZFA 2X7BA 3D8PA 1OMIA 2PJPA 3C1DA 3RYOA 1I1SA 1Z05A 1LJ9A 1IB1E 2BGCA 1RNLA 1UHWA 3F0AA 1QPMA 1HW5A 5E96A 3EO4A 5CVJA 3MCZA 4EV0A 4WXHA 1JXSA 5LBQA 2NMTA 3FWEA 2HUZA 4LMYA 2NNYA 3VWDA 5JQ4A 4IF5A 3F5BA 1B9MA 2E7WA 4OIOF 2M5WA 2P4WA 2FE3A 1Z6TA 3F6OA 2OH1A 4KYWA 3JTHA 5GCNA 3EUHA 1J7KA 1M44A 2D4PA 1CGPA 4FT8A 3K0LA 3AAFA 3PP9A 3I71A 1R58A 4KN4X 5FGMA 2OQRA 3LQRA 1SFXA 1HKTA 2P6EA 4MBUA 2EFNA 5IX3A 1ZG5A 1H9GA 2HTJA 1Y7RA 1F4KA 1TQPA 2XKPA 1GXQA 3G3ZA 5TRDA 3K2ZA 2W85A 4JK1X 4K2EA 2Z10A 2KIMA 5BMZA 2FXFA 4N9HA 2RV8A 3R0AA 2G7UA 4RS8A 2Q2EA 4R3KA 5F1RA 1ON0A 1L0CA 3V8JA 3EQLF 3R60A 5D6EA 3FXQA 5BPIA 1P4WA 2K4JA 1IN7A 1KU9A 4CXFA 3ZP5A 1I12A 4ZZLA 4PZJA 4L9TA 3L00A 2GA2A 1XE4A 3M9AA 3FMRA 1K78B 5HLHA 1OKRA 2QVOA 3ZMVA 4MI4A 1PUAA 1R1VA 4S05A 1P6RA 2P6GA 2JTVA 2K4BA 1ZRDA 2XGXA 1HW1A 1FWZA 5JPHA 1FBUA 4RB2C 5ICGA 4MTDA 4P55A 4UV8A 5E8GA 3C26A 4YIIA 3KCCA 2KJBA 2IPQX 3LA7A 1FSHA 3KP3A 2P8TA 2Q4VA 4U5YA 4M6XA 3TT2A 3WTUC 1D3YA 4M72A 4BNCA 3TO9A 1K4JA 2STWA 3P9CA 5BS6A 4QBJA 4WF2A 4EM1A 4HW0A 3OWCA 2EVNA 1FYMA 1BM9A 4ETSA 1BI0A 2Q44A 3WGIA 3SXNA 5E1ZB 4HA8A 4U0YA 4G7OF 5L3BA 5LGUA 1T0FA 4KUBA 1WRJA 1B1BA 1W4MA 4ZBGA 1KUYA 1UFMA 3VWEA 2V9VA 5EEHA 4KZTA 1R57A 2IL4A 4Y13A 4KICA 2ZPAA 1BO4A 1I1DA 2Q8KA 5FO5A 1H9TA 2MLKA 1NHAA 4GO1A 2ISZA 2Y75A 1O7FA 3HHHA 1LEBA 4BHCA 4KLVA 1O57A 4XPDC 1UB9A 3V7SA 4L0ZB 2IT0A 3EETA 3N7ZA 4PCQA 5LGNA 3F8FA 4O6JA 2KIUA 3Q9SA 1FBQA 4MHGA 4YGOA 4A12A 4I09A 2FA5A 1XMAA 1ZAOA 2VOPA 2DFIA 3REOA 2GZWA 2R7DA 3DR8A 4WXCA 3RJPA 1GVJA 5CLSA 1WKMA 2DAOA 5LRSA 1PU9A 1R1TA 3DF8A 2A07F 1VKCA 2L54A 2KCWA 4J3GA 2M30A 2XAJA 2KRFA 4KOUA 4U7BA 3T8TA 3WTZA 5FD6A 1HBXG 2ZW4A 3CTAA 3DNSA 2IA1A 5L3EA 3DFGA 1Q2DA 2OQGA 5HS9A 1N71A 3GWZA 4BQAA 3EDPA 3V7CA 1ZH5A 1OPCA 1DPUA 4CZZA 4HYEA 4R57A 4KDPA 3OOPA 3TFYA 3R96A 1YW8A 3IKVA 2Q04A 2GE3A 4E8OA 1JGSA 3NQOA 4ENNA 5JFRA 2G9WA 1IN4A 4KIFA 1USSA 3WTVC 1JHFA 4A0XA 1FBSA 2DBBA 4KN7X 3GF2A 3JSOA 1MJ9A 4L9VA 3ZMDA 2K86A 3GVAA 2M8EA 2Z99A 4K30A 4UVAA 4HX8A 4I0BA 4PSWA 3TKYA 3MZHA 3E6MA 1W5TA 2QQ9A 4LK1F 1X3UA 4M73A 4R87A 4D0PA 2FBHA 4HLYA 3DDDA 2EFPA 5E20A 4JQFA 4MY3A 3U2RA 2YPRA 1QZYA 3Q9VA 1XN7A 5DCFA 3IGRA 2ZXVA 4BYYA 1T38A 2K5TA 1FY7A 2KJCA 5L3CA 3JAMK 3FZVA 2RN7A 2LF7A 2MBFA 4MJ8A 1XSVA 1ZLKA 2H09A 1S3ZA 2K27A 2FBKA 2EB7A 2PMUA 2LNBA 2HEOA 2JPBA 5J6XA 1D5VA 5H84A 2P6SA 1Z4EA 2DLLA 5JVTA 1FYLA 4L0YB 1TNSA 1SD7A 3KP5A 1MK4A 3ZN0A 4FD7A 3KZYA 3I9SA 3MFKA 1S7FA 2PR1A 2QQAA 3HOSA 3CUQA 4PK2A 4Q5SF 2FEZA 1XIXA 5HS8A 2R7HA 4M3SA 1FPQA 2XIGA 4II9A 3IWZA 2DT5A 1Y9WA 5BPDA 1U5TA 5D6FA 2BE5F 3T90A 1XCBA 2WC2A 2M87A 3MZYA 4HF0A 3LA3A 3BJOA 1KUVA 2LKPA 4E0AA 2HGCA 2IRFG 5JI6A 3L2CA 4I49A 2OZUA 2AE6A 3R9FA 3LSTA 4HNYB 5DWNA 3DPTA 1D8JA 1R22A 1XSDA 1REPC 2VOOA 3MGDA 3RYPA 2ZW5A 5ICEA 4CDGA 4JXQA 4RB3C 3P7NA 3MAJA 2PLYA 3SHPA 2WPWA 1YGHA 3PFIA 5BQTA 5KTCA 1STZA 3ZJ0A 5EEGA 1CF7A 3MEXA 5AIQA 1MDMA 4O5VA 2PC1A 4H89A 2FL4A 3MWMA 4HF1A 3WGGA 1OZPA 4LK0F 4OIPF 2CNTA 2LF8A 3SQNA 1TIQA 2JDDA 2FT0A 3W91A 4P9FA 2IVMA 1K7AA 2QZ8A 4NEXA 4KOSA 2P5LC 1YW9A 3S2WA 1S6LA 4BHBA 3M7GA 1FP2A 2XASA 4U0WA 1IW7F 2ZO4A 1KYZA 3K1MA 2G3AA 2UZKA 2DPUA 1RO5A 2PFBA 2Q4YA 3CJNA 4CHUA 4UBRA 1P4AA 4AIHA 4GYIA 3IRQA 4FHTA 2WTEA 3OV8A 5A2QK 6PAXA 2QQBA 1BC8C 2QMLA 1B59A 2ATRA 2ZMEB 2MH2A 3E3VA 3GXOA 3FYNA 3FXTA 2Z3YA 3G8WA 1MJBA 5J8FA 3TDZC 3GY9A 2ZXJA 4KUMA 3D0SA 5F64A 2VONA 1YK3A 4XRFA 2GA1A 2Y48A 1SFEA 4WX9A 5DCMB 2BUEA 1QSOA 2FIAA 4XSXF 3COAC 1M1DA 2FBIA 2QUFA 1LVAA 1R7JA 1U3EM 4KVXA 2VN2A 3EYYA 3VODA 4M85A 3GFMA 3CDHA 3RPUA 1FYKA 4AVBA 5KVRA 5FFXA 1YX0A 4YFNF 4KVOE 4LB5A 1FLIA 2QBYB 3V8KA 3EYIA 4A5MA 3I59B 3JAMZ 4DQ2A 3LA2A 2DW4A 1IZ1A 4PGGA 3L09A 4RS2A 2B4DA 2FS5A 2QM3A 1J75A 2MD5A 1RXTA 2HYFA 3CXPA 3H4QA 4LD5A 4LLNA 2ESNA 4WWCA 3IKTA 3R9GA 4P9UA 2HKXA 3ZZIA 2FF4A 2XUBA 4NCZA 2FMLA 5D4SA 2UXXA 3KEOA 3RI4A 2JSCA 1U8RA 2ZW6A 2MLGA 4L89A 4A5NA 4ZYEA 2WV0A 1LQ1A 5F46A 4L5IA 4B5PA 3LQQA 1IIDA 2HYGD 2MH9A 2RVCA 1A04A 3K1PA 3GUDA 2ZFWA 2REFA 3FRMA 4ENJA 2FOKA 5KTAA 1OR7A 1M4DA 5L3GA 1O3QA 3BZ6A 3ULQB 1T98A 2GIVA 5DUKA 1IYLA 5ILVA 4PV6A 4UWIA 3PGPA 4OU0A 5IT9K 2FU4A 3LAPA 2XV4S 2K02A 3ELKA 3GO5A 3E5QA 2YR2A 2A6HF 2M45A 2C27A 2VODA 3WGHA 3K69A 3QU3A 5F47A 4RB0A 1GHEA 1O3RA 4MNUA 1ZLJA 1SQHA 3P9KA 3JW4A 3F8BA 4UXNA 2P5KA 5FD5A 3W6SA 4Y49B 3ROUA 5DD8A 2OU2A 3W6JB 2CSOA 3EFAA 2J5OA 1XSXA 1IXSB 2J8NA 4R9MA 4YFKF 1LEAA 1J5YA 2FE7A 3HRMA 4QLCU 2H6CA 1UHMA 5CVUA 4OMYA 2GQQA 2HV2A 3O2PE 2GAUA 1J4JA 2LDUA 1XMTA 4PK3A 1QNTA 1IN6A 1Y0UA 3QP6A 3EC4A 2K7LA 2HQYA 4EGZA 2VI7A 3FIXA 3DXJF 3E5XA 1QSMA 3G3SA 4A2UA 1ZARA 4MHDA 1YVOA 1KUXA 4YIFA 1FNNA 2COMA 3HHGA 1P4NA 3TO7A 1V0CA 3RYRA 4EJUA 5ED4A 1ZG3A 4KMUX 4OIQF 4RI1A 3T1BA 4HOBA 3TE4A 1BIAA 2CQKA 4I0AA 4QC6A 3J80K 3N97A 3BY6A 2CY2A 3DPLC 5LGTA 1ON1A 5A2QZ 4Q4ZF 3C18A 2OBPA 2VT2A 2DPDA 4IHTA 2R8VA 1QSNA 3ABUA 4EJVA 1J9IA 2QECA 2EFOA 3Q5FA 4M74A 2D45A 1IN5A 2R3SA 2VE8A 4HAMA 2A5YB 5HDNA 1HKQA 1PP7U 3DSBA 3D3SA 5DDGA 2R7FA 5F6FA 3GZ5A 2P5VA 2QENA 1U78A 2ZBKA 1RZ4A 4IRHA 2OZHA 3BJ8A 1XGOA 1TW3A 3UY5A 3FXRA 1Z91A 4LB6B 2NYXA 4CRZB 1Z6RA 2JDCA 2I00A 4IPAA 1S29A 2BV6A 3H92A 2TDXA 2OZ6A 1XCVA 2A68F 3JTGA 4ORFA 4L9NA 3GFIA 4NHJA 1I27A 1YG2A 1VHSA 3CLOA 2P6TA 4KOYA 3BPVA 1SAXA 1U6GA
chains in the Genus database with same CATH superfamily
5B5EC 3FC3A 3F8NA 4A3IJ 1D0YA 1TWAJ 2GM4A 1Q2CA 2D4OA 3FMQA 3IH4A 3S9NA 3VE5A 3SXYA 4JX5A 3VDXA 1ZG8A 3MD2A 2EV0A 2VQCA 1I5ZA 2HQRA 4GRIA 2CWGA 5CNPA 1DUXC 2ZMEC 3K1NA 1TBRR 2QSFX 1BBYA 4FX0A 4C3JJ 3W2WA 1PDNC 3QOPA 3BOQA 2PJ8A 4F0XA 3PQKA 2EZLA 1TQMA 2R1IA 1M8BA 2JYYA 4ZYHA 1TBNA 1P7JA 2ROWA 2QYOA 4IHWA 4BHPA 4Y17A 4UCPA 4ZX9A 1S5KA 3TOBA 4PK4A 3QWPA 2F7VA 3NH8A 4RGUA 2F5VA 3HOTA 2HOSA 2Z5UA 3LWFA 1KQ8A 1TLHB 1UJ8A 4LG0A 3U9GA 2Y0MA 3IL2A 4I7HA 5DS9A 4P4BA 1J09A 2DA1A 5J4VA 1T56A 3QP5A 4G7ZF 3O8HA 4MFDA 3ECOA 1BR2A 2DYRH 2VZZA 1O4XA 1ONVA 1ETYA 1PTRA 1RETA 2LSOA 3SDBA 1A31A 2YNCA 2WAQN 1YFHA 1X1CA 2YUSA 3FHZA 1VFCA 1P92A 2JA7J 2YX4A 2QYVA 4MCSA 4I2OA 4HNUA 2HOEA 4LUAA 4I01A 3SFIA 2DK5A 3IWFA 2ELIA 3S9MA 4A39A 2WADA 1HLVA 2JT1A 4FD5A 2JZYA 5GADJ 2XRNA 3B3TA 3P2HA 2A6TA 3I5UA 3PO3J 2E1NA 1IRGA 2IAIA 1Q9BA 5HS7A 1DE4C 1RRJA 4IF4A 1S7AA 3HDDA 1R4NB 2PJBA 4P4FA 3VB2A 2KIFA 2WAQA 2PJ4A 2L5QA 3LFKA 4A94A 5F0CA 1YU6C 2GKRI 1K4TA 2HQNA 4KOTA 5J1YA 3CF2A 5ICFA 2ZEFA 2HOAA 1LKXA 2AXTC 3QPHA 4G6QA 3TDUC 1QQIA 2M4GA 4PFPA 2VZYA 1F5TA 4BMHA 1FX7A 2RNJA 4CYDA 1H0MA 2VUMJ 4HNTA 3CJTB 5HMNA 2SGFI 4DBRA 4A69C 4XPDB 2OCCH 3KZIC 3I53A 4EM2A 5IT9Z 2BO9A 3FJUA 4P45A 3G1LA 4JXRA 1TBXA 3PFOA 5FB2A 3KLNA 3UGDA 3BR6A 3FBUA 2H6BA 3SFZA 1JKOC 4BXFA 3CJRB 1W5SA 2RGVA 3TW6A 4F7ZA 1UVFA 1G4DA 1FYBA 4F0YA 4C7IA 3HG9A 3TL4X 5EMIA 2E19A 2JUGA 4IAVA 5FUXA 3GTKJ 4E7HA 4KIBA 1Z3XA 4B09A 1YLEA 4EMEA 2LY1A 1TGSI 4OC5A 1WH7A 3ZN1A 5J47A 1YITI 2GWRA 2YNEA 4ZYAA 3BXMA 3OXGA 1LANA 2M34A 1QGPA 1VQOI 3F8KA 2ANPA 1EV7A 4P10A 2P7VB 5FKLA 1UG0A 2ID3A 4CS0B 4IQ4A 3MZ8A 4CAEA 3TP3A 2JRTA 2QVPA 1LR9A 4KJZA 2CO5A 4NJRA 4NJQA 4EGYA 4H0EA 2V79A 2XAGA 3WHCA 5EBVA 2DO7A 2A20A 4NC8A 3D5SC 3PL8A 5B66C 4BJ6C 2O61A 2J5PA 1BOBA 3RTRA 1KU7A 5BWAB 3GIUA 3P9IA 4WK8F 1XGNA 5CVIA 2R7TA 3LODA 5CQEA 1Z9UA 3U1DA 2VXZA 1TBOA 2EV6A 2BEOA 4E7IA 4HX7A 2R4GA 1Z21A 3L1PA 3DGVA 4M9XA 1K61A 3C7JA 3A9LA 1S3JA 3FNCA 2DFEA 4P4EA 5A27A 1T6SA 2CWHA 2YQPA 1R00A 1V1HA 4KUAA 2IJLA 4L9JA 1OCTC 1ZKGA 3HTSB 2WPXA 4FETA 1S20A 2IW5A 1WHUA 4F92B 2M7BA 2FX0A 1VQ7I 4EJTA 1TT0A 4KFCA 4IHYA 2CFXA 3FXUA 1CX8A 2M7AA 3CP2A 1M8CA 1V1IA 2P6FA 1ENHA 1TWHJ 1ZGWA 1ZREA 2ECCA 2FQ3A 1BR1A 1V3FA 1YQEA 1V5EA 2B5GA 1UZCA 2DPTA 4MFLA 5GAGJ 2OPTA 1GHCA 3I54A 1W36D 1NE9A 3CXQA 1E3OC 2FIWA 5D5WB 2SGQI 5CJ9A 4HDUA 3R1KA 1S7LA 4U9ZA 1QO0D 2A4NA 3KASA 3RQ4A 1HDQA 3K2KA 1IO2A 5KK1A 1SFKA 3NEUA 2WZNA 4CUGA 2DTZA 1CPSA 3BP8A 2PBIA 3KX2A 3IC7A 3B3VA 1HSTA 4Y49C 3J80Z 3VFZA 1F1ZA 3OL4A 1YRNA 5FLXK 4HPSA 5FFZA 5J8CA 4CAXA 3CPAA 3MKLA 2CU7A 3KEQA 3AG4H 3B6CA 4XKVA 4Y33A 4EMSA 3EXNA 3JSPA 1MMDA 3FEDA 2HVQA 2BBYA 2BOLA 2IGMA 1LDKB 2M0MA 3S8PA 1NG6A 3E97A 4LLGF 5HDKA 2WVJA 2IP2A 1Z9CA 3B8GA 3WT4A 3CCEI 3FXOA 3B02A 1Z3YA 4G7HF 2DMTA 1RIOH 4HNXB 4PGHA 3DV8A 4CCKA 2EUIA 2V4JC 1JQGA 7CPAA 5KTDA 4ZTFA 3M4OJ 3MMYB 4CGZA 2PJ2A 4J00A 2J8MA 2LY9A 3GUXA 2DA2A 5JR3A 2C6PA 2F3CI 5HVGA 2BEIA 5LLQA 1H8LA 3SHFA 1XRYA 4PSXA 3E5UA 3OIQA 4OP4A 1IN8A 1P2FA 3ISPA 4JOMA 1NMTA 1HSJA 1AUGA 5LHHA 3G71I 1KQ9A 3IRRA 3HKZN 1SD6A 5EDNA 4A3LJ 2X85A 1WWZA 5IB0A 2CW7A 5KAFC 4G8XA 2VRWB 4BJTA 4IHSA 3S6GA 4NSQA 2ZJQF 2DA3A 5F0FA 1LR8A 5KCMA 3T5XA 1ETQA 2XGCA 5E8IA 2QIRA 3CCSI 1B72A 1IDZA 5LEJA 3EUHC 5FJ8J 4PJNA 3T9YA 3ZXSA 4EFDA 2E5ZA 2MC3A 4Y15A 1A6IA 2VKDA 2DOEA 4LIUA 4AVPA 5IP7J 1ZRFA 3C3WA 1IU8A 3R5DA 1TF9A 4A3EJ 4CGMA 3TBIA 4CPAA 3W2VA 2NXNB 4HLXA 2ADUA 2DDAA 2RNGA 4UVCA 2W0TA 1XFOA 5K5OA 4R1HA 3K9UA 1P4XA 5B3SH 1TURA 1VIXA 3SJXA 4CGLA 4AIKA 3HSEA 2A5WA 4FX4A 1XD7A 4L8AA 4Y3OA 4HX4A 1Z4RA 2E7XA 4DGWB 1POGA 3HGGA 1SGPI 4FD4A 3KP7A 3WTWC 3CCRI 2J8RA 3LMMA 2Q7BA 5K1YA 4M9ZA 1NG7A 4PJLA 4S0HB 5FKKA 1BAVA 4MGRA 2D2WA 4RAZA 2GXBA 3CXSA 4LLLA 5G22A 1MMNA 2X6YA 2LTPA 1S5LC 1T08B 4HQMA 1C0WA 1Q1VA 3BDDA 3OYHA 2VBXA 2J87A 2AXLA 2VBWA 1MBGA 2E1CA 1Z5RA 4CICA 3CUQB 1TXRA 1XPXA 1YVKA 3OR1C 2R98A 1VHEA 5H6QA 3TOAA 1BIBA 2D1VA 4CCJA 2CYYA 4WXDA 3RKXA 3PB4X 3AG2H 4KNYA 3MKZA 5HNFA 2R5ZA 4CA0A 4RGSA 4KVME 2HXOA 1LNWA 2P7CB 4M6HA 4EVIA 1U5TB 5AIPA 1KA8A 3HSFA 1OQYA 1HKSA 3M8EA 3HL2A 7WGAA 2FUG2 2VQYA 4PJ0C 4M9SA 2V9PA 3NA6A 4NF1A 2DK8A 1QHHD 1IXCA 1ARLA 2WB1N 4UNOA 3GYAA 3IC1A 4AG9A 2KRHA 2UV1A 1Z1DA 2X4HA 3OS0A 1W7PD 3R6SA 1EF4A 4CAWA 3JRUA 1BUSA 2VKVA 1QVUA 3BR3A 2MABA 3HRSA 1U6MA 5ISVA 4R76A 1QU3A 3CD6I 1WTJA 1J2XA 2OC6A 1ZLIA 1JTYA 3NH4A 4UVBA 2F4IA 2OAZA 1MZBA 4HPQA 3KP4A 4RAYA 3ZQLA 2L9NA 1ZQ3P 2XVCA 1ZLHA 3EY5A 1KU2A 2F8HA 2WB1A 4Q7AA 2PG4A 4AG7A 3ZRGA 3D67A 2X6XA 4OADA 5E79C 3TC8A 1CT4I 4R8HA 1J0RA 4LFUA 2FVGA 3FB3A 1VF9A 3D5LA 4HNWB 2V8GA 1LFPA 3A01B 3HC7A 1G3WA 4X1EA 2NS0A 2ZW7A 2Y31A 2JSPA 3BJAA 3KL9A 4N9IA 3FX3A 1GDTA 1S7KA 3AKZA 3K2AA 1GV5A 3GTMJ 1ZG7A 1T95A 3DEUA 1BI2A 1WSUA 3PBEA 5IYCJ 5H2FC 1FSEA 2OA4A 4J19A 3VEPA 1VZ0A 3BPXA 5FKOA 3GYHX 2BVMA 1WKXA 3E2IA 1WQ2A 4U7DA 3PQJA 2VXKA 1EH8A 4B6DA 1WVRA 3M8FA 1CF7B 3IH2A 1I1GA 4UXIA 2ZEMA 3I9V2 2C1CA 5HLTA 1SVMA 3FVLA 1MH3A 1W1WE 4FAIA 2Q0YA 1MDMB 2W84A 4B48A 4A3BJ 1IG7A 1BI3A 3TW7A 1S7NA 1ACIA 2PSWA 3H3UA 3V42A 2ME6A 2EK5A 1PTQA 2CJSC 4HV5A 2PN6A 3OYBA 4BE2A 1OYYA 2L02A 4QPQA 3TTHA 2O3FA 4D9JA 2C6YA 3G4SI 5DWMA 2ZEPA 5M3MJ 2VBYA 3BG6A 5B1AH 3S6KA 3TCVA 3F72A 4YFJA 1IRFA 1AWCA 1MMSA 2DPSA 1Q2YA 3ABTA 1XX5A 4AMLA 2CQ7A 2PQ8A 5HDGA 4NC6A 3A4CA 1BR4A 1MMGA 2L01A 3HSRA 4F52A 4ZJZA 2VC1A 2XHKA 4M71A 5C44J 1T0FC 3SEQA 3NE7A 3KI9A 3G2BA 2FCKA 2PR8A 1HC8A 2DTRA 3BROA 2JN6A 4A2ZA 3RKQA 2DU9A 1MKMA 1DU6A 3VDUA 1YI2I 4DYCA 2W48A 2DA6A 3I4MJ 2EK9A 3SXOA 2L7KA 2ZJ2A 3BJ7A 3L2WA 2NNNA 3RU0A 2ZEHA 3JVNA 2UXNA 1XMXA 5E17F 1YQAA 3BLNA 2L4MA 4QVTA 3IP4B 2AFOA 4UA3A 2FRHA 2OVOA 2R5YB 4BAYA 5G1ZA 2Z11A 2D1HA 2OZGA 2B0LA 3ASOH 2B4BA 2Z3NA 4Y7NJ 2Z3PA 1HXDA 2A69F 4B8XA 2L9SA 1G3YA 4AC0A 4UXJA 2RDPA 2KKOA 1FMWA 3CF5F 3B3SA 2V8DA 1BMOA 3R95A 4XR6A 1FNOA 4BQNA 4H6ZA 3C2BA 2ZNZA 4OOIA 2HKOA 1CBXA 4LQ6A 4IRGA 1HDUA 4ESJA 1X3WB 3B73A 2PIZA 4JWPA 1XOVA 1V4RA 4RLQA 3RBUA 1D1CA 4H6UA 5EG0B 4OWRB 3GTOJ 2EBIA 2L7FP 3TGNA 5D5VB 1SFUA 2VIXA 2O0YA 2R7SA 5JHWC 3WU0A 3L2RA 3ABKH 4FCYA 4L18B 2ACJA 2MGQA 3ONQA 1O3SA 2JA8J 2JXDA 2XEJA 3S1QJ 3RO0A 4ZYGA 1WGTA 1LFUP 5FLXZ 5GP9A 3G73A 1VQ8I 1XF8A 3M1EA 3S6HA 4IO9F 2LKXA 1JUSA 1SVOA 5D5XB 4BQOA 1OVOA 2OOTA 3CUOA 5D5UB 1B8IB 2CGPA 2CV1A 2JPCA 3TP0A 3ZMUA 3ABLH 3LAJA 3D1NI 1K78A 2D5VA 2V1UA 4DJAA 2OB0A 2MSYA 3FMSA 2A05A 4II3A 2STTA 2HDCA 3RZAA 1ITYA 2V1DA 2BYVE 2FJ1A 3RKWA 2FMYA 3W2AA 3OYAA 1QSRA 1VQNI 2JQ7A 3B4VC 2IQ6A 2F5EA 1EH6A 2L7MP 1TIHA 4UV9A 1X19A 5E3PA 1NSLA 5A28A 5DD4A 2MA3A 4BXUA 1TKJA 4JJXA 4CH7A 1IICA 2LFBA 1D5YA 2GREA 1S60A 4A24A 1U9OA 1Q1HA 1TQIA 3P5JA 5GTIC 3BI1A 3H8EA 3HB9A 2DIPA 3UR3C 4A93J 4XSZF 3WTTC 3KR4A 3T8RA 3GLJA 2M8GX 3OSFA 2HR3A 5E18F 3WG9A 4IEJA 4IOAF 1ZTRA 2HPMA 3RSNA 2WSAA 4X3RA 2ZXIA 5L3FA 4QIWN 3QODA 3R0JA 3CMYA 4E7JA 5TGTA 2ERWA 4ZGYB 2RB7A 4RBOA 1SGRI 1DS2I 2EA2A 3V8LA 1ULKA 4DUKA 1ZGAA 2F5FA 4LOCA 2W82A 4MY0A 5C88A 3DTKA 4CZCA 1N25A 3L7WA 3BWGA 4HKFA 3BZKA 2QWWA 1HEEA 2OCEA 3FM5A 3O6BB 2B4DB 4AVCA 4UUSA 4RB1A 4MCPA 2DI3A 3HUVA 2EFQA 1UG2A 2X1EA 2CMPA 1QQ9A 4TWEA 1X4OA 1IOIA 4ZYDA 3WE3A 4A0ZA 2XAFA 3FXLA 1TP4A 1KU3A 3QPTA 5K7HA 3GKRA 2PEXA 3C2GA 5CVRA 2JA5J 5LHGA 4ESFA 2HFHA 1H0ZA 2V1CA 2NVXJ 2LH9A 2AFMA 3QB8A 3L2UA 3K4JA 1ZYRF 2O9LA 3PZJA 3JRFA 4IJAA 3I64A 4IHXA 2ICWG 2CUZA 1PUEE 5E1WA 2R7XA 2MW8A 4B5PB 3U21A 3GLXA 4AM3A 2KPMA 4CRYB 1XX6A 3CCJI 4A6DA 2VQLA 5K5RA 5JVGF 1D1AA 1CM0A 2I5UA 1LB2A 4EEFG 1PP8F 5FRNA 2G0BA 3HLPA 4OC2A 3A02A 1HPTA 2WCYA 5HH1A 3SEZA 5JGFA 1M4GA 3E6CC 2LR8A 4UF4A 3OS1A 3SDGA 2REEA 4DYOA 5ILSA 4G6DA 1T39A 4GGGA 3HYIA 3MEKA 3ZOBA 3ERMA 2Z16A 1VQKI 2B7EA 3DBLB 2E36A 1EE3P 1LRZA 3HM5A 3V8IA 3PM1A 4TV7A 1F43A 4EJOA 4B13A 4Q48A 1S8NA 1QMUA 3I4PA 2NVQJ 1SMYF 3H5RA 3PNVA 4XMYA 2DMUA 2UUZA 4ZY0A 1SD4A 1OCRH 3HPGA 1MBJA 3I3GA 2M1BA 2BSWA 2CWEA 4WP4A 3CO6C 3X2QH 4HDVA 1ODDA 4E7ZA 1YLFA 4A6EA 1CHOI 2DEAA 4P4JA 2R7ZJ 3J81K 2XEGA 3F3XA 3K4MA 3RIRA 2PJ6A 3SYTA 1WI9A 1Y8RB 2HTSA 3ZQ7A 5GAHJ 5JHUA 2P0WA 4BH9A 1F57A 2LC2A 3F8CA 3VPRA 1X58A 3SZPA 3LD2A 4P44A 3CQZJ 4A0YA 3HEFA 4QWQA 3ZQQA 1YW7A 3T0YA 2PJ3A 4HSTA 4BBRJ 5HVQC 3G1MA 2ZEOA 4XNHB 2LK2A 4BBSJ 5AGEA 3JRHA 3LSHA 2QQ8A 1K6OA 1HW2A 3FM3A 1K7VA 1OBRA 4E7SA 3KQXA 3P2FA 2OD5A 1G6NA 3H9GA 3CUQC 5D8LB 1E17A 3LSJA 4AD9A 4CCOA 1ZG1A 2Y30A 2OTJI 2WYRA 1G3TA 1R5GA 4XBFA 3CCLI 4N0BA 1PUFA 2DF5A 1QZZA 4OAYA 2CRGA 3DLAA 3BC8A 1O7LA 1WGCA 2EBJA 2ETHA 4RDUA 1HF0A 4NGSA 3MQ0A 3J7ZI 3QNVA 4B43A 4JLYA 2X51A 1ZRCA 1U5TC 2H94A 1EA3A 5I0CA 2XSJC 3CJQB 2AFWA 2W57A 4LJZF 3FSYA 1LDJA 4D5FA 4LX9A 1IJWC 4NGRA 5LD2C 5BOXA 4BS9A 5LEKA 4ENMA 4OINF 2DA4A 2Z0ZA 2HS5A 3KETA 1DPRA 2A3SA 4A3CJ 1USTA 3VYTB 3KEYA 4HQEA 2HWVA 2X0LA 4M3DA 1XMBA 1NK3P 3LSRA 2AJ6A 3B2YA 1W7PA 5H20A 4JCVE 1HDLA 1R4MB 2AFUA 1GT0C 3O8GA 5C4JJ 3NRVA 2ZFUA 3E0KA 1OYIA 3S6FA 3CO7C 2V8VA 3DPUA 4QUSA 1Z7LA 1Z7UA 4LIVA 4XKWA 1I50J 3Q0UA 4UHTA 3H9JA 3TO6A 2Y69H 3SZTA 5AG5A 1X12A 4EVYA 4GDFA 3ML6A 1TTYA 4CYCA 2XROA 3DQVC 3TQNA 3OL3A 1ZHFA 4XK4A 2EV5A 2CG4A 1ULYA 3JCUC 4DJLA 2J9RA 1BJAA 2EFWA 1LE8A 3JRBA 2DODA 1XMKA 2CFOA 3HZJA 3G1OA 3W6KB 4I76A 2KIQA 3R61A 3JUWA 2IA0A 1XDUA 4XM3A 3KZZA 3GOXA 3HTUA 1FOKA 4ESBA 4PQAA 3WU1B 3CC4I 4UUVA 5K7FA 2GANA 5DTDA 3V38A 2IA2A 5KAIC 1E2XA 1S7OA 2JA2A 1DDNA 4YEJA 2E2JJ 1NUBA 1M4IA 1IRXA 4F6AA 3ESWB 4I98B 4EJWA 4RAGA 4KA4A 2QQCA 3IAS2 1ZG9A 3MN8A 4C9YA 3DKWA 2ISYA 2RQPA 1XB4A 3DKYA 2PI0A 1YR0A 2IGKA 2NOJB 2VE9A 2NRAC 1PUFB 1AOYA 2PCUA 4MFZA 4S04A 1I21A 3L2QA 2DT7B 1FJLA 2HB6A 1FP1D 1JI8A 3OL0A 1MBHA 5LYFA 3BTJA 4FD6A 4MTEA 5K5QA 1VHOA 2L4AA 4DZJA 3VSLA 4HF2A 4KLWA 3WTXC 2YU3A 4EWTA 2I79A 3WODF 4R6TA 2EINH 3F22A 4XICA 4Y52J 3IU2A 4OAEA 1YYVA 4AVZA 2K40A 3R9EA 4C2YA 1Z77A 2DB6A 1XEBA 2RC4A 1BL0A 2PJ9A 4MLOA 4MHPA 4JD6A 5HLGA 2XSDC 4KOVA 2W25A 1BOAA 1B87A 5E3MA 2F2EA 4EM0B 3WC7A 2DMPA 4BKXA 3UGIA 1B4AA 1R71A 4MQVA 4IOCF 3IEHA 1CQTA 2VL8A 1W7PB 5DYMA 2NU1I 4OMZA 4NB5A 3V4GA 2N52A 4WCGA 4QB9A 5F48A 2FNPA 2DCEA 2LREA 4UIBA 3GZNB 2EK8A 4KSIA 3KE2A 4IHVA 1HEVA 3F8MA 4IVNA 4HV6A 5EYRA 1OMUA 1PPFI 1N78A 2YSRA 2V77A 2HZTA 2DT6A 3QRFF 3KZWA 5CPAA 3SJEA 5DEQA 3KYCB 1PJRA 2XPVA 2PJ5A 2O4HA 2XAHA 3I56I 2VJ4A 3WR7A 5GTHC 1WJBA 4XPLA 1FZPB 5IP6A 3N05A 5EC4A 1VGYA 3QYFA 4GS4A 4G6TB 1GLNA 1IDYA 4DYQA 4LG0B 1R36A 3MN2A 4ASNA 1SC7A 4AWXB 4F9VA 2LVSA 1MSFC 2EJRA 1K83J 2QGUA 5HXDA 4XPKA 3GFLA 1APLC 1X1BA 2BXYA 1LFBA 3CZXA 1MIJA 5C82A 1YS6A 4C2UA 5CCLA 5LRJA 5IV0A 1B6BA 1IXRC 1MT1A 2L9VA 2QSHX 4JZ0A 4YRHA 4EQQA 5ILUA 1PYTB 1BN5A 1OYWA 5ERIA 2DMQA 2B63J 1K6YA 2F5CA 3ZMTA 3ZPLA 4HBLA 4QPOA 1IYKA 1B6AA 1LR7A 4C3HJ 1R43A 2JLMA 5DV5A 4JYKA 3ECHA 3DCFA 4XIDA 4MRIA 1IY5A 3S3MA 3JRIA 5IT3A 4P5OA 4XN0A 3ISXA 4RUHA 2FSWA 2ARPF 1IC8A 3CT9A 4ON0A 1UHSA 4KORA 1XDSA 5CYVA 3O3KA 9WGAA 2EILH 4XL9A 2PMZN 1O3TA 2SGPI 1QBJA 4Q47A 3K70C 2RFHA 1EKEA 3HRTA 2E5NA 2LUYA 2CW8A 2W24A 3PNTA 2NS8A 1MSEC 3S2DJ 4MFJA 1YO5C 4M6GA 4HGUA 4PDKA 4IRIA 1CJWA 1AHDP 4CGOA 1D8KA 4UEFA 1IUFA 3K4LA 4ZH4F 3MKWB 2VEZA 1NTCA 1FC3A 4Y4RA 3LSMA 4O23A 3CLQA 4PPZA 3S9LA 1Y1VJ 1TNTA 2HQAA 1MMAA 5M5XJ 3ZMZA 1DP7P 2ZSIB 1KYWA 3W3CA 1WK4A 4R3LA 4FTHA 2O28A 4CAVA 2LOOA 4CCNA 2X1CA 2CW0F 2ME0A 2A61A 2ZKZA 3FHNA 3F23A 4MEXF 3E59A 3R5BA 3FIWA 1CG2A 2ABZA 4ZZDA 3J81Z 3DEEA 3CESA 1NSAA 4C3IJ 3I58A 2F5IA 1UFHA 3KLOA 4G94A 2SGEI 3D5RC 2A6EF 2ARHA 2GOXB 1Z67A 3S15J 3OYJA 3OYNA 2WBMA 3GFJA 3OMYA 3DLLF 4G12A 2H27A 3AG1H 3LACA 3SJMA 4AIJA 5THWA 1X2NA 1W0UA 2IGOA 3OOUA 4QTRA 4X5KA 3KFWX 1MGTA 3F21A 1GUUA 5KNLA 2NU2I 3HOUJ 2G3TA 4MHZA 2KFDA 3WE2A 1UHAA 4C2MJ 3CDIA 1NH3A 3GX4X 3OIPA 3RDIA 4HSRA 2DDBA 3OYMA 1SD5A 1TL8A 1Y1BA 2DXQA 1YJ9I 4KITB 3D2MA 1WGXA 1YIOA 3OYFA 1MD0A 2R7OA 5K8OA 4I02A 3F6VA 4M6YA 3VYSB 1OR7C 1IV6A 3KKWA 1M1EB 4NXYA 1B9NA 3I0TA 4MFPA 1PJUA 1XG1A 4O3MA 3CDLA 4E7LA 1RKWA 2HI3A 5FRMA 4A30A 4OC4A 4CYQA 4NQWA 1BI1A 1J59A 3IHUA 2L9RA 4MEYF 3IIBA 3HKZA 3FF5A 1R0RI 1BW6A 1R23A 5F49A 3RPQA 4Z2YA 1QRYA 2JEVA 3HIFA 2Z9OA 3FXJA 1JHHA 1BC7C 3E1SA 3J7AO 1XJOA 5EZHA 1TW2A 2XAQA 1KZHA 4OLLA 4ZY2A 4FUUA 2OTLI 5FVJA 3FKJA 4UWJA 2JEWA 2DQRA 3SI2A 1UCRA 2VJJA 4NC7A 2PIYA 5EZGA 1WWXA 2ZMEA 4M6VA 2B5GB 1M4LA 3IWGA 3BG7A 4YG2F 1ZELA 4U0VA 2RAEA 2V1XA 4EATA 1W3SA 4KT5C 2FSRA 1RPWA 4R79A 2CNSA 1A2ZA 4B5OA 2BHYA 4D5CA 3UFFA 5HLIA 4P96A 1Z8TA 3LWUA 3TX8A 4OVOA 1Z8LA 2E73A 4XNFA 1Y9KA 3HRUA 4RGRA 5EGOA 2XEFA 4C7HA 1AU7A 4MQ9F 2VBZA 4KOXA 4YELA 3IFEA 2ZSHB 1JKPC 1RUNA 1YRNB 1SVLA 4Q36A 1KQ0A 4XNHC 3UEJA 4E70A 3QAHA 4IL6C 2DXIA 2F5DA 2G9DA 4RGXA 5DCMA 5D4RA 2VT3A 5E1XA 3S2HJ 1IV8A 3A0HC 1W36C 2EWBA 2H5MA 1MJAA 2W7NA 1G2HA 1AA7A 3ZMSA 3H0DA 5FLVA 4IXAA 4AVAA 3QU6A 1BJZA 1LDDA 4U88A 2O8XA 5LRRA 4FBEA 2KMRA 2M2EA 2MC4A 1YREA 2CTCA 2KL4A 5ICCA 4CYNA 1T2KA 1MNMC 2ESHA 1Y1CA 2VC0A 3D7DA 4GYGA 3S32A 4DNCA 2ODDA 4RM2A 3KQZA 2GXGA 3GLLA 4GFBA 4KOWA 2PMHA 2WWYA 1N13A 3ERED 1F2PA 2Z33A 2B58A 4L5JA 1AKHA 1U2WA 3DP7A 2UWMA 2VKEA 1R1UA 1IAWA 4GCVA 1RUOA 4ONUA 2ELHA 4KMFA 2BL1A 3WTYC 2FNAA 4CO8A 2CNMA 4YU9A 2E60A 1Y39A 1K7UA 3FXMA 5LHIA 3GZ6A 2B9SA 1VQLI 1ZN2A 1ELLP 3KP2A 2JJ7A 2IS2A 5H6RA 1B72B 2QBYA 2NU4I 4ENKA 2O03A 1YJWI 3OYGA 2R7VA 4YFXF 1Z7KB 3I59A 1I6XA 2EIMH 1TWCJ 1ETKA 4XLPF 3S17J 5EF6A 1IUYA 2B3UA 2PJ1A 2RKHA 1X10A 2IGNA 2WA0A 1QSTA 2G7HA 2TRTA 4IUSA 4XLNF 1FT9A 3BJ6A 4PXEA 3FH4A 1BA5A 4Z65A 2ELJA 3HPHA 4KT6A 1JT6A 1R5HA 1HQCA 2CUJA 3RKYA 4KIGA 1AN1I 4UFVA 3OSGA 2CH0A 3V7RA 5H86A 3I1UA 1L3LA 9ANTA 2XDVA 3OYEA 5IOZA 5CVVA 1RR8C 1SEUA 1ON2A 3GW2A 5HOOA 3DR6A 4U9YA 3OVOA 4MMOA 2FXAA 2VXDA 1L0OC 3H3ZA 3I3LA 3W6XA 3IAM2 1IY7A 2L3DA 5D8KB 3EUKL 3GEZA 2VBQA 2BY2A 2RIJA 3VATA 1DU0A 2Q0OA 3K9TA 4NBQA 1XGMA 1QHGA 2OJED 5F27A 1AYEA 4PXBA 2AFSA 3K4KA 5DM6F 1GXPA 4E1PA 2EWNA 3V7ZA 4G9YA 3IU1A 1F9NA 3D2PA 5EGOB 4E2AA 2ENZA 3KP6A 1IF1A 4XOTA 4B44A 1RI7A 1H89C 2PJRA 2QLZA 2O8KA 5L3DA 2EA4A 2DQLA 5AONA 3D4UA 5DUIA 2IJZA 4CGPA 2ZENA 1DQUA 1WJFA 2I10A 3E6DA 2Y9ZA 1K79A 2R5ZB 1X74A 3D7FA 1G3SA 3WU2C 3WTSC 4XKCA 4GI3C 4Z6YA 2V6CA 1KZFA 2GU2A 3VOEA 3SJGA 2B3VA 2E35A 2O6GE 2ZCWA 3HUGA 3OYCA 4UB8C 3RQIA 1VTNC 1YTYA 2O7OA 3Q0VA 2HNHA 3HOZJ 3TEDA 3VWBA 5TJJA 2B0UC 3IUOA 1SMTA 2ZNYA 2PVVA 4AB7A 4K3NA 2V7FA 4JBAA 3OYDA 4OIRF 1YS7A 2AS5F 2NAZA 1WFXA 1ZGJA 1SGYI 2PJ0A 3N4MA 2YX7A 2YS9A 2B8TA 3PB6X 4GXOA 1KGSA 2XKOA 2Q4ZA 2PRBA 1Y0YA 3CC7I 1EH7A 4TNUA 1WJEA 3E6BA 3R4KA 4PJJA 1JE8A 3GTLJ 3WABA 8CPAA 1XGSA 2PDOA 1MNDA 3BG5A 3HH2C 1JGGA 4LGWA 2H1LA 3FDYA 1P0HA 3L9FA 4HZFA 3SJFA 2X7BA 3D8PA 1OMIA 4RAFA 2QQDA 3IO1A 2GLFA 2PJPA 2MD0A 3UKGA 1F2OA 1KBFA 2XF5A 3QOEA 3C1DA 3RYOA 1WZ2A 2P6AC 2K3PA 1I1SA 3BR1A 1Z05A 5TISC 1LJ9A 1IB1E 3SGBI 1OMTA 2BGCA 1RNLA 4W97A 3PBBA 1UHWA 1IRZA 4R8FA 3F0AA 1X1PA 2M4KA 1QPMA 1HW5A 5E96A 2K9MA 2ORWA 5CVJA 3EO4A 3MCZA 4EV0A 1RFHA 4WXHA 2ZC2A 2E2HJ 1JXSA 1YX3A 2ZB9A 4U87A 5LBQA 3DEWA 1YTPA 4P6YA 2DJIA 4P4IA 4ANJA 2NU3I 2QF7A 1TUSA 2XPWA 3AG3H 2LY2A 2NMTA 4BEHA 1KWMA 3FWEA 4II2A 4M3BA 2HUZA 4N4OB 4LMYA 1X1DA 4F55A 2NNYA 3VWDA 3PFYA 3BLYA 5CBMA 3ZCOA 5JQ4A 2V1NA 3A0BC 4IF5A 2IS6A 2N71A 3F5BA 3EUAA 2YNCC 1B9MA 2E7WA 3BJIA 5JLXA 4OIOF 3LFUA 1LCPA 2AFZA 2M5WA 2P4WA 4CCMA 4B1RA 2FE3A 2ZXWH 4A33A 1Z6TA 4CYPA 3S3OA 3F6OA 3J7YJ 2Z3OA 2COBA 2OH1A 3FISA 2LBFA 4I99C 3JTHA 4KYWA 1YW6A 5GCNA 3EUHA 1J7KA 3NWTA 4JX4A 4D1QA 1GYTA 2V9KA 1M44A 2D4PA 1CGPA 3GCMA 2CXAA 3HUGB 2QCOA 4XRSA 4FQGA 4FT8A 3K0LA 1WH5A 3AAFA 4H4KC 3I71A 1JT0A 2JK3A 1R58A 4FASD 1Z2LA 3PP9A 4RMNA 1Z8XA 4FE7A 4KN4X 5FGMA 2OQRA 1LFWA 4B3XA 3OXFA 3CCQI 3LQRA 4OIDA 3K10A 3CCUI 1SFXA 2QKLB 1HKTA 5DAEA 2P6EA 3D68A 2GKVA 4MBUA 2EFNA 1D1BA 3RZDJ 5IX3A 1R49A 2GIZA 2PE3A 3ZQIA 3D66A 1V5GA 1ZG5A 3MRUA 2KT0A 1FEXA 1H9GA 2HTJA 4UIAA 1OCOH 2DA5A 1I3QJ 2E34A 1R3NA 3ISZA 1Y7RA 3UNGC 1F4KA 2HYJA 4XQFA 1TQPA 2CQNA 1GXQA 2WV1A 2XB0X 2XKPA 1HOMA 3G3ZA 5TRDA 1GVDA 3K2ZA 1NXUA 3KHXA 3PDNA 2W85A 4JK1X 4K2EA 2Z10A 2KIMA 5BMZA 2FXFA 4N9HA 1FT7A 4BBHA 2RV8A 1CP7A 3R0AA 2G7UA 4RS8A 2Q2EA 3TMOA 3R5AA 2WUUA 4R3KA 5F1RA 1ON0A 1L0CA 3V8JA 3EQLF 3R60A 1V54H 2HQ5A 4AIDA 5D6EA 3FXQA 5BPIA 1CT0I 4ZY1A 1P4WA 5IP9J 1EJ9A 2K4JA 1IN7A 1KU9A 4CXFA 3ZP5A 1TKHA 5E3NA 4OIWA 1I12A 2P81A 4ZZLA 4MHDA 1Y6IA 4PZJA 3DLJA 4L9TA 3ZQCA 3PB7X 4MHNA 4B12A 1YHQI 4UCNA 3PFEA 2CQXA 3L00A 4YRVA 1XC5A 1TZLA 5IOYA 2DOAA 2GBYA 2FNFX 5JHFA 2GA2A 4C2TA 1XE4A 3M9AA 4BD9A 1IOFA 3JRGA 3FMRA 1K78B 5HLHA 3QPLA 3PO2J 2L0KA 1OKRA 2EO8A 5AG6A 2Z3LA 2QVOA 3ZMVA 3HOWJ 4MI4A 4A3MJ 1T8IA 4BE1A 1PUAA 1R1VA 2V26A 3RCOA 4S05A 1DP3A 3H8FA 4BQQA 1P6RA 2KMQA 2P6GA 1OFCX 2KP6A 2JTVA 2K4BA 1ZRDA 2XGXA 1HW1A 2I8DA 1FWZA 2ZEEA 3KHZA 4M3EA 5JPHA 1FBUA 4RB2C 2E1MB 1N77A 5ICGA 3NE8A 3CMAI 5CPRB 4MTDA 4NGPA 2MG4A 4P55A 4UV8A 4A31A 5E8GA 3C26A 4YIIA 4ZC3A 2JA6J 3KCCA 4BDYA 1YSJA 2KJBA 5JH9A 2Q1ZB 3F0CA 3NAUA 3PEIA 3WC5A 1ZR4A 2R7UA 2IPQX 4PXDA 2GKTI 3LA7A 1FSHA 2V53A 3LSGA 2F4OB 3FK7A 3KP3A 2P8TA 3VYRB 1X4SA 2Q4VA 5LYIA 4U5YA 4M6XA 1JTXA 3TT2A 3WTUC 1P9ZA 1D3YA 4M72A 1PVEA 4CGNA 2EQRA 4BNCA 3AL0B 1A5JA 3TO9A 1K4JA 3I4NJ 2STWA 4NGTA 5LRGA 4ZI6A 4I6ZA 4UUSB 3P9CA 5BS6A 5DS0A 4C68A 4WF2A 3PB9X 3A1YA 3FK6A 4QBJA 4A3KJ 4EM1A 4HW0A 3KPHA 1YJNI 3OWCA 3PJRA 2EVNA 2WAFA 1FYMA 1BM9A 4GM5A 4ETSA 2IMOA 1BI0A 3H9QA 2Q44A 1Y7EA 3WGIA 3SXNA 5FKNA 4MO7A 1IGNA 3UOEA 5E1ZB 2JBJA 4E4HA 1VNDA 3OYLA 4HA8A 3S14J 1HA8A 4U0YA 2EZHA 4G7OF 3S1NJ 1FTTA 3L2NA 5HNHA 5F08A 2XRLA 3B6AA 2H1KA 1UELB 4PFOA 1TWFJ 5L3BA 2BY0A 5LGUA 1XBUA 1T0FA 4KUBA 1WRJA 2Z1DA 1B1BA 1W4MA 3UEYA 4ZBGA 2N8GA 3JTKA 1KUYA 1UFMA 3VWEA 4ABZA 2V9VA 1UMQA 3I55I 4OMEA 5EEHA 4KZTA 2KZGA 4MFEA 4W1UA 1R57A 2V8HA 2IL4A 4Y13A 4M3GA 5G20A 4KICA 2ZPAA 1JUPA 4F3QA 2DKVA 3PUFA 2DFHA 1Q7LA 1BO4A 4BINA 5J1QA 2JW6A 2Q8KA 1I1DA 4IHMA 5JM6A 1ETXA 3LSIA 5FO5A 3QWLA 1H9TA 2PVWA 2MLKA 1NHAA 4GO1A 3OYKA 2ISZA 1MNEA 5IYBJ 2Y75A 4KISA 1O7FA 4A3JJ 2AFXA 3HHHA 1Y8FA 3GB0A 4B14A 2DN0A 1R9TJ 1LEBA 4BHCA 4A32A 4BXXJ 2YNDA 3TJQA 4KLVA 3BI0A 3QQAA 1O57A 4C30A 1MBEA 2NVTJ 2VI6A 1UB9A 4XPDC 3V7SA 4L0ZB 3S93A 3G6EI 2IT0A 4DZPA 4H2KA 3EETA 3N7ZA 4PCQA 3H1CA 4A3GJ 5LGNA 5E3RA 4P4DA 3F8FA 4O6JA 2KIUA 4PJMA 3Q9SA 1FBQA 3VYUB 4X8IA 3MVPA 4MHGA 4A38A 4YGOA 1FOWA 4A12A 3BT9A 2FA5A 4I09A 1DGWY 4XOPA 4AU7A 1XMAA 2RREA 1ZAOA 4R7MA 2GOMA 2VOPA 1D0XA 1S7EA 2CQQA 5IYDJ 3H35A 2DFIA 3REOA 5CCMA 2DOFA 2GZWA 4A95A 2R7DA 3PIOF 4YIRX 2YU9J 4W9YA 3DR8A 4WXCA 3RJPA 1GVJA 5CLSA 1WKMA 4BU2A 4E7KA 2DAOA 5LRSA 4F9UA 2M9HA 1JJ6C 2TCTA 1BW5A 1PU9A 3FEEA 1R1TA 1U5KA 3DF8A 3NARA 2BY3A 2A07F 2NVUB 1VKCA 1BLLE 2L54A 3RPUD 2IS1A 2KCWA 1FARA 3GBGA 4J3GA 2M30A 2XAJA 1SGQI 2KRFA 4KOUA 4U7BA 3K70D 2AO9A 3T8TA 3WTZA 1IW4A 4L9MA 5FD6A 1PCAA 1FOXA 2LKSA 1HBXG 4OKOA 2ZW4A 3CTAA 2W4SA 4OAZA 3DNSA 2IA1A 2HXIA 2ODFA 5L3EA 3DFGA 4A3DJ 1HDPA 1LAPA 1Q2DA 5K8MA 1K7TA 2OQGA 5HS9A 1TOTA 1N71A 2AHQA 1RTQA 3GWZA 4BQAA 5D29A 1HDDC 4F8ZA 2IS4A 2CS3A 3EDPA 3V7CA 4BE0A 1ZH5A 2EZIA 2NYQA 1OPCA 1DPUA 3M3YJ 4CZZA 5J1UA 2EH3A 5HQ8A 3VSKA 3CCYA 5GPAA 2KMUA 4AUXA 4HYEA 1QPIA 4KDPA 4HRIA 4R57A 4AXVA 3OOPA 4SGBI 3TFYA 2LLKA 3R96A 1YMEA 1YW8A 3BG9A 2VKHA 3IKVA 2J9AA 2Q04A 2ZELA 2GE3A 5B1BH 3KGQA 4IKFA 4E8OA 1JGSA 3NQOA 1VQ5I 4ENNA 1OISA 5JFRA 2K5CA 2G9WA 1IN4A 3GTGJ 1WJDA 4KIFA 1W4RA 1USSA 2VJ5A 3WTVC 1JHFA 4A0XA 4CYCB 2KLOA 1R5ID 1FBSA 2DBBA 4KN7X 3GF2A 4V2GA 2Z3MA 3JSOA 3D7GA 1UUCA 1LE8B 4KSAA 1FIPA 1MJ9A 1TWGJ 3F9KA 4L9VA 3ZMDA 2K86A 3H5NA 5ELYA 3GVAA 2M8EA 2Z99A 4K30A 4WWVA 2HZDA 4UVAA 3PNYA 1CPXA 4HX8A 2BY1A 2IBDA 1CT2I 4I0BA 1WJCA 5F0HA 3H5ZA 4PSWA 1G59A 3TKYA 3MZHA 1QVTA 2JBKA 3E6MA 2X3TA 5GAEJ 3Q0WA 4CAFA 3D00A 2QQEA 5HVHA 1W5TA 2QQ9A 4LK1F 1X3UA 3C2HA 4M73A 1E0EA 4R87A 1F36A 3DBHB 1SANA 5FLMJ 4D0PA 3SI1A 2FBHA 2JWTA 4HLYA 3DDDA 2EFPA 3BTIA 5E20A 4JQFA 3A2KA 3JREA 4MIMA 4MY3A 1W0TA 3U2RA 2YPRA 5EEAA 1QZYA 2VQGA 3Q9VA 4B10A 5F1JA 1XN7A 3H0GJ 5DCFA 3IGRA 2ZXVA 4BYYA 1T38A 5E3OA 2K5TA 2BXZA 2H8WA 3VDPA 5EX0A 4UXHA 1FY7A 1WCMJ 2KJCA 1E3PA 1YE9A 5L3CA 1LUJB 3JAMK 4ZTJA 4ZDOA 1JJ8C 1TC3C 1CSOI 3FZVA 3T8WA 2K9QA 2KQRA 3S1MJ 1QA6A 2UZ3A 3LSPA 2RN7A 2LF7A 2MBFA 2ENNA 4MJ8A 1XSVA 3WG7H 1ZLKA 5J1RA 2H09A 1S3ZA 2K27A 2FBKA 1MBKA 3SZGA 2EB7A 2PMUA 2YGWA 1TKFA 3BQYA 2PMZA 2LNBA 5LFAA 3E7LA 2HEOA 2HC9A 2JPBA 5J6XA 3K4BA 1D5VA 2X48A 2P6SA 5H84A 4D7NA 4X6AJ 1Z4EA 2L7ZA 2DLLA 3S3NA 5JVTA 1FYLA 3CCMI 2ELKA 4L0YB 1TNSA 1SD7A 3KP5A 1MK4A 1X3ZB 3ZN0A 1VDDA 4FD7A 3KZYA 3BG3A 3VH9A 3I9SA 2GLJA 3BR0A 3MFKA 1S7FA 2PR1A 3S16J 2QQAA 3HOSA 1CP6A 3CUQA 1HCRA 4PK2A 4Q5SF 2FEZA 4JX6A 3JRDA 2ZEGA 5CQGA 1XIXA 5HS8A 1YW4A 1G8XA 3QYBA 2R7HA 4DW6A 4M3SA 1FPQA 1UAAA 2XIGA 2VPLA 5EX3A 5DM7F 3KYLA 2NU0I 4II9A 3IWZA 2DT5A 1Y9WA 3KIOA 2M0CA 5BPDA 2K9SA 1VQPI 5M3FJ 1U5TA 2F6CA 2G0EA 5D6FA 2BE5F 3T90A 1OLTA 2Y2ZA 2XC7A 3S1RJ 1XCBA 2WC2A 2I3CA 2M87A 3MZYA 4HF0A 3LA3A 3BJOA 3DWLE 1KUVA 2LKPA 4E0AA 4G1PA 3HOXJ 3CP8A 2HGCA 2CTBA 2IRFG 1MH4A 1NK2P 3HOVJ 5JI6A 3L2CA 4I49A 2OZUA 1HJAI 2BVLA 2E1MC 3HGYA 2ORVA 2AE6A 3BR2A 3R9FA 3LSTA 4HNYB 2R7RA 1XA6A 1RR7A 3DPTA 5DWNA 3FXKA 3FBNB 1D8JA 3QAYA 1R22A 5FUVA 4YWYA 3DU6A 1XSDA 1REPC 4B11A 3A01A 1XTAA 1LVKA 2VOOA 3WHBA 3MGDA 2X52A 4NDLA 3K4CA 3RYPA 3OYIA 2QQ0A 2ZW5A 4B6ZA 2K85A 5ICEA 3KY9A 4MFKA 2Y9YA 5FUWA 4CDGA 4JXQA 4MFQA 4ZX8A 3DU5A 4PUSA 3PUBA 4RB3C 5C3EJ 3P7NA 2KRCA 3MAJA 2PLYA 4UEEA 5G21A 3SHPA 2WPWA 1WI3A 1YGHA 3PFIA 5BQTA 5KTCA 5K8PA 4HG2A 1STZA 3IV5A 5EEGA 5HODA 2QSGX 1SGDI 1CF7A 3PB8X 3AL0C 3ZJ0A 4IQJA 3MEXA 4LG3A 1E3HA 1A35A 5AIQA 1MDMA 5LRKA 2O5RA 4O5VA 5M5WJ 1U8BA 2PC1A 5AG4A 4H89A 3L2VA 3MWMA 2FL4A 5F09A 4DOZA 4HF1A 5C4XJ 2BCOA 2EIKH 2XPUA 2XF7A 3WGGA 2HVRA 1OZPA 4LK0F 4BY1J 1I39A 2VB6A 4OIPF 2CNTA 2QKMB 4MCQA 1ETOA 1W5CC 2LF8A 4RN7A 2V1CC 3BR5A 5I4MA 2CUEA 2RQQA 3SQNA 2KDOA 2QEXI 1TIQA 2FT0A 2JDDA 4P9FA 2IVMA 3H8GA 1S9HA 3J7AY 3W91A 2HPIA 1K7AA 2BW3A 2QZ8A 3LNQA 4NGMA 2ECBA 5D8NA 1P9GA 5GPCA 4KOSA 2F48A 4J01A 4NEXA 3ABMH 1BPNA 2ZOFA 3BTLA 2DMNA 4C2XA 3H5AA 2GFQA 4AYBN 4B4CA 1WJAA 2LG4A 2P5LC 1Z8WA 3DBRB 2SGDI 1YW9A 3B35A 2CJJA 1S6LA 3S2WA 5K8NA 4BHBA 2KISA 3M7GA 1FP2A 4UUTA 1SAUA 2XASA 2OR4A 4U0WA 1IW7F 4GXHA 2WY8Q 3BCAA 1ETVA 5J3LA 2KCXA 4DIQA 5IY5H 2ZO4A 3IH3A 3QPSA 3GTPJ 1KYZA 3K1MA 2G3AA 2BHZA 2E1OA 2KDZA 1SFOJ 2UZKA 1ARMA 4A37A 4AYBA 2R5YA 4NQWB 1PCEA 1YLOA 3QTLD 2DPUA 1RO5A 3KR5A 2DA7A 2PFBA 2Q4YA 3B3CA 1X4PA 3CJNA 4CHUA 2UVOA 4UBRA 1P4AA 4AIHA 4GYIA 4XRMA 3IRQA 1KBEA 2FOWA 4NGNA 2F4MB 5JLWA 4FHTA 4XKBA 2WTEA 2Y0SN 3OV8A 5A2QK 3OY9A 6PAXA 2QQBA 1BC8C 1OCCH 2QMLA 3RNZA 1B59A 2KHMA 2XB5A 4F91B 4XONA 3FSXA 2ZMEB 3M1CA 2ATRA 2MH2A 3E3VA 5F04A 1VI0A 3GXOA 2L7XA 5EG0A 2JVGA 4HNVA 3NH5A 2K3FA 4V2FA 3FYNA 2EIJH 1JKQC 2Z3YA 2X6WA 2R92J 1MJBA 3FF3A 3FXTA 5J8FA 3TDZC 3G8WA 4UEZA 2NS7A 3GY9A 2ZXJA 4KUMA 4XLFA 2Y0SA 3D0SA 1VQ4I 1D0ZA 4BY7J 5F64A 2VONA 5FUYA 1YK3A 4UB6C 4XRFA 2GA1A 2Y48A 1SFEA 2WAEA 2OF7A 4WX9A 1I6HJ 4ZDLA 3B7IA 1B8IA 5DCMB 3FBIB 2BUEA 5J40A 1QSOA 1DTDA 2PRQA 2IEKA 2FIAA 4V19K 2L2OA 4XSXF 4ZDPA 2LYCA 4BJ5C 3COAC 3WC6A 1YOVB 2VQHA 1FMVA 1M1DA 1DS3I 2FBIA 2QUFA 1LVAA 1R7JA 1U3EM 2QJ8A 4KVXA 2VN2A 3EYYA 2ZOGA 2IXSA 3VODA 2CV2A 4RA2A 2VJIA 4M85A 3RAMA 2HU9A 3CZ6A 3GFMA 3CDHA 2WGCA 2BW3B 3M8JA 3FKIJ 4NUBA 3RPUA 3A03A 1FYKA 1RESA 1AMPA 3N5FA 2R7QA 5KVRA 5FFXA 2H8RA 4AVBA 4OC0A 1CGJI 1AKHB 1JKRC 3CC2I 3FX6A 1YX0A 3JRAA 1VQMI 4YFNF 2BOAA 2GVIA 3BZCA 3LOCA 2VASA 2N17A 4KVOE 4LB5A 2HDDA 1MBFA 4QSHA 1FLIA 4BDZA 1V55H 2QBYB 3V8KA 3PSFA 1I3AA 4XLCA 4UFWA 1T33A 3JR9A 3EYIA 2NVYJ 4A5MA 4BL0B 4KS9A 3I59B 3JAMZ 4DQ2A 2JUCA 4D7MA 3HJEA 3LA2A 4MPIA 2DW4A 1IZ1A 4PGGA 3L09A 1S72I 4RS2A 2B4DA 5FROA 2FS5A 2ZEDA 2QM3A 3CPXA 1J75A 1R79A 4DBQA 2MD5A 5KHDA 2HYFA 1RXTA 3CXPA 3H4QA 4LD5A 4X0GA 4LLNA 2ESNA 4XRSG 4WWCA 3IKTA 1TBQR 1UVGA 3R9GA 2VL1A 1U0JA 3GTJJ 1JWQA 4P9UA 2HKXA 2QPOA 2FF4A 2JMWA 2XUBA 4NCZA 3ZZIA 2FMLA 5EJCA 2C6GA 5D4SA 1CGII 2UXXA 3KEOA 3RI4A 2JSCA 1OYVI 3UGLA 1U8RA 2ZW6A 2XEIA 2KMPA 4MXUA 2MLGA 3ZQHA 4L89A 4A5NA 4ZYEA 2WV0A 1ETWA 4CYOA 2WY7Q 2AQEA 1LQ1A 5F46A 5CKTA 2NOGA 3OIOA 1XS9A 4JP0A 3ZQGA 3Q3SA 4L5IA 4FKDA 4B5PA 3DKXA 3LQQA 2PJRB 1IIDA 4NGQA 2HYGD 2MH9A 2RVCA 1A04A 3K1PA 2PJAA 3GUDA 2ZFWA 3EPZA 4ITVA 1FOYA 2REFA 2M3AA 2O53A 4B3AA 4M6IA 3JRCA 3FRMA 1V5FA 2FQ4A 4ENJA 2M5XA 2FOKA 2KZVA 3DTEA 2Z3KA 5KTAA 1OR7A 2XAUA 4B47A 1M4DA 4L5EA 1DGRM 1OCPA 5L3GA 3SI0A 4DYRA 3BZ6A 3H36A 3ULQB 1T98A 4RLFA 4CSWA 1O3QA 2BUSA 2LB7A 4M3FA 2GIVA 5HI7A 5FKMA 1TT5B 2CV0A 5DUKA 1IYLA 3BTCA 5ILVA 2EZKA 4P1WA 4PV6A 4UWIA 3PGPA 4OU0A 3BHXA 5IT9K 3IWWA 2FU4A 1LOKA 3LAPA 2E71A 2PJ7A 2XGEA 2XV4S 1ERDA 4KSFA 2K02A 3ELKA 3GO5A 4FWUA 3VARA 3GMEA 3B3WA 3E5QA 2YR2A 4ZYQA 2XF6A 4BUPA 2A6HF 5K7ZA 2M45A 4IZZA 2PX9A 1ZR2A 1A36A 4FE4A 2C27A 2L8EA 4HEA2 2VODA 3WGHA 3K69A 3QU3A 5F47A 2CF4A 2LMDA 4RB0A 1GHEA 4E6KG 1O3RA 4MNUA 1ZLJA 2X9DA 2W1OA 2ZJPF 1SQHA 1ORKA 3OWTA 3P9KA 2N1AB 3CMMA 1BPMA 3JW4A 1K4SA 3F8BA 3BQZA 3R5CA 2AQFA 5IPAA 3K4NA 4UXNA 2P5KA 5FD5A 3D7HA 3W6SA 2R0QC 4Y49B 2GXAA 3KYDB 3ROUA 5DD8A 2EPFA 2OU2A 4A3FJ 3IJ3A 1TF8A 3W6JB 2CSOA 5E3QA 3EFAA 4X2TA 2J5OA 1WJ5A 1XSXA 1N75A 1IXSB 2W00A 4F93B 2E2IJ 2J8NA 4Q38A 4R9MA 4YFKF 1LEAA 1Y0RA 2Q43A 4XLEA 1J5YA 3ZQFA 2FE7A 2GLOA 3HRMA 4QLCU 6CPAA 2H6CA 3ZR8X 3CMEI 2JA1A 1UHMA 2JRMA 5CVUA 4OMYA 2GQQA 2ID6A 1YX5A 2HV2A 3O2PE 4BACA 1ELMP 2CIJA 2GAUA 1JUMA 2VPRA 2LDUA 4BEHB 3PIPF 1H88C 3W6VA 1J4JA 1XMTA 2K9LA 4BGDA 4PK3A 1GV2A 1XBTA 3NWSA 1QNTA 4PXCA 3CXLA 1IN6A 1Y0UA 5IB9A 3QP6A 3EC4A 1Y56A 2K7LA 4XLHA 4EGZA 2HQYA 2MFZA 2VI7A 5HVFA 2HDWA 3FIXA 4NFRA 3DXJF 3E5XA 1QSMA 1MW7A 2YUUA 3ZGKA 2R93J 3G3SA 4A2UA 1ZARA 3ASNH 3HXLA 1WPKA 2HVSA 1YVOA 3AFHA 3LSKA 4YIFA 1IY6A 1KUXA 2MYSA 2K9NA 2HOTA 3PSIA 1FNNA 1Z0XA 4OC3A 2COMA 4MCRA 1CE3A 3HHGA 1VQ9I 1P4NA 1OJLA 2DJNA 2LBFB 3TO7A 3HOYJ 2OD1A 1V0CA 1SGNI 1FIAA 3GTQJ 3RYRA 1ULNA 4EJUA 1RC9A 5ED4A 1ZG3A 1KONA 4KMUX 4OIQF 2LEOA 4CCLA 2V6EA 3CDXA 1LAMA 5LYDA 2PJCA 4RI1A 3T1BA 4HOBA 5J4YA 3IWEA 2NSMA 3TE4A 4LITA 2LRDA 3LL7A 4E1RA 4MHYA 3U1KA 2XGDA 1SGEI 3SEKC 2OV7A 1BIAA 1ZK8A 2CQKA 1YIJI 1X1AA 4I0AA 1Z2IA 1P7IA 4QC6A 3J80K 4IX7A 3N97A 1UWYA 1OCZH 3HBLA 3BY6A 2LD5A 3OXLA 2CY2A 3NFZA 4UFXA 1QZEA 1R6RA 3DPLC 3BCBA 4FISA 2C6CA 5LGTA 5M5YJ 3SGQI 1ON1A 5A2QZ 4Q4ZF 3C18A 2OBPA 2VT2A 3QYEA 2DPDA 4IHTA 1Y8QB 2R8VA 1QSNA 2X1DA 2Z2SB 3LMSA 3ABUA 3E0JB 4EJVA 4UY8I 1J9IA 2JVHA 2DFFA 2QECA 2LP0A 2FD5A 2EFOA 3Q5FA 4M74A 1KMAA 4UCMA 2D45A 1IN5A 2R3SA 2VE8A 4HAMA 2A5YB 5HDNA 1HKQA 1PP7U 3H3VK 2Q51A 4LQGA 3DSBA 2Q2EB 4WJBA 4XN3A 3OR2C 3D3SA 5DDGA 2E5RA 2R7FA 5F6FA 1VQ6I 1LPQA 4IK2A 4C2ZA 2CWFA 3GZ5A 2P5VA 1Y1WJ 2QENA 3PRTA 1U78A 2BZTA 2ZBKA 2KMOA 1RZ4A 3OS2A 2VLAA 2QA4I 4JYWA 3DTIA 2JZMA 2DYSH 1IGBA 4IRHA 2OZHA 3BJ8A 1XGOA 5LYLA 2ZXHA 1TW3A 1U9NA 2XRCA 3UY5A 3FXRA 4XORA 1ULMA 2OUMA 1Z91A 4NNJA 4LB6B 4OC1A 2NYXA 4CRZB 4XLAA 1Z6RA 2JDCA 2I00A 4IPAA 5BNGA 2ZJRF 1S29A 2BV6A 2POKA 3M07A 3H92A 3MKYB 2TDXA 5E3LA 2OZ6A 1H8AC 1XCVA 3RZOJ 2A68F 4ONWA 1PYVA 3JTGA 4ORFA 3K7AJ 2X6OA 4L9NA 3GFIA 4NHJA 2R7WA 1I27A 1YG2A 2K9HA 1VHSA 3K6GA 1P9QC 2CUFA 4RM3A 1A6QA 3CLOA 4N4NB 1X2MA 5AG7A 1FTZA 2P6TA 3FECA 4KOYA 2Q7SA 3BPVA 1ZO0A 1Y0NA 3CCVI 1FAQA 1SAXA 1U6GA 3FMCA 1RKTA
chains in the Genus database with same CATH topology
3F8NA 1Q2CA 2D4OA 3FMQA 3SXYA 2EV0A 1I5ZA 2HQRA 5CNPA 1DUXC 3K1NA 4F0XA 1BBYA 4FX0A 1PDNC 3QOPA 3BOQA 3PQKA 1TQMA 2R1IA 4ZYHA 2QYOA 4BHPA 4Y17A 4UCPA 1S5KA 3TOBA 4RGUA 3HOTA 2Z5UA 3LWFA 1KQ8A 1TLHB 3U9GA 4LG0A 3IL2A 2Y0MA 4I7HA 3QP5A 4G7ZF 3ECOA 2VZZA 1ONVA 2LSOA 2YNCA 1YFHA 3FHZA 1P92A 2YX4A 4I2OA 2HOEA 4LUAA 4I01A 2DK5A 3IWFA 2JT1A 4FD5A 2JZYA 3P2HA 2XRNA 3I5UA 2E1NA 1IRGA 5HS7A 4IF4A 1S7AA 3VB2A 2KIFA 3LFKA 2HQNA 4KOTA 5ICFA 4G6QA 3TDUC 3QPHA 1QQIA 2VZYA 1F5TA 4BMHA 1FX7A 2RNJA 4CYDA 1H0MA 5HMNA 4EM2A 3I53A 5IT9Z 4JXRA 1TBXA 5FB2A 3KLNA 3FBUA 2H6BA 3SFZA 1W5SA 2RGVA 4F7ZA 1G4DA 4F0YA 4C7IA 4KIBA 4B09A 1YLEA 3ZN1A 2YNEA 2GWRA 1QGPA 3F8KA 1EV7A 4CS0B 2P7VB 4CAEA 2JRTA 2CO5A 4EGYA 4H0EA 2V79A 2XAGA 5EBVA 2DO7A 2O61A 2J5PA 1BOBA 3RTRA 1KU7A 5BWAB 3P9IA 4WK8F 1XGNA 5CVIA 3LODA 1Z9UA 3U1DA 2VXZA 2EV6A 2BEOA 4HX7A 4M9XA 3C7JA 3A9LA 1S3JA 3FNCA 5A27A 1T6SA 1R00A 4KUAA 2IJLA 4L9JA 3HTSB 2WPXA 2IW5A 4EJTA 4KFCA 2CFXA 3FXUA 2P6FA 1ZREA 2FQ3A 1V3FA 2B5GA 2DPTA 4MFLA 1GHCA 3I54A 1NE9A 3CXQA 2FIWA 5D5WB 5CJ9A 4HDUA 3R1KA 1S7LA 4U9ZA 1QO0D 2A4NA 5KK1A 3NEUA 3BP8A 2PBIA 3IC7A 1HSTA 4Y49C 3J80Z 3VFZA 1F1ZA 5FLXK 5FFZA 5J8CA 4CAXA 3KEQA 3EXNA 4EMSA 3JSPA 2BBYA 1LDKB 3E97A 4LLGF 5HDKA 2IP2A 1Z9CA 3B8GA 3B02A 4G7HF 1RIOH 4PGHA 3DV8A 2EUIA 5KTDA 4CGZA 2J8MA 5JR3A 2BEIA 5LLQA 3SHFA 4PSXA 3E5UA 1IN8A 1P2FA 3ISPA 1NMTA 1HSJA 5LHHA 1KQ9A 3IRRA 1WWZA