1FY7A

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
273
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESA1 HISTONE ACETYLTRANSFERASE
publication title Crystal structure of yeast Esa1 suggests a unified mechanism for catalysis and substrate binding by histone acetyltransferases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 81
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fy7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1fy7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1fy7A02
3P2FA 3GFIA 3DEUA 1O57A 1KGSA 1W7PA 2G7HA 3FXUA 1QSOA 2BGCA 1WSUA 1Z1DA 4LB5A 3DXJF 1OMIA 1T39A 2R1IA 3WGGA 5JFRA 5F1RA 2G7UA 3HTUA 3GYAA 2OH1A 1HW1A 2DPUA 4BHPA 2A69F 4EJUA 4U0YA 2RVCA 1PUEE 2ZW6A 2GWRA 4O3MA 1TNSA 2VEZA 3D2MA 2HR3A 2P7VB 2K5TA 3KP4A 3LODA 1HW2A 2OD5A 2H6CA 1J75A 2VI7A 1L0CA 4Q4ZF 5HS7A 3L9FA 1O3QA 3P7NA 4ESFA 3TTHA 1M4IA 1BBYA 3B02A 4G8XA 1XSXA 1SD4A 5ILSA 4MI4A 3I53A 3K69A 3GKRA 4UNOA 5IT9Z 3CJNA 3ZZIA 1YFHA 3IL2A 2X0LA 2KIFA 5F47A 2O28A 2FL4A 5E1WA 1DUXC 1M4DA 5LHIA 2FF4A 2B4BA 2D1VA 3P9KA 4BH9A 4WK8F 3MQ0A 5L3GA 4YFKF 2LF8A 5FLXZ 2G0BA 3QB8A 4FD6A 2IA2A 5F46A 1U5TC 4AVCA 3V8IA 2D4PA 1MJBA 5DCMB 2X7BA 3JVNA 5F48A 1Z05A 2QQBA 4LMYA 4M9SA 2R3SA 3REOA 4OIOF 3RPUA 1UFMA 2R8VA 4UV8A 4CGZA 2MA3A 3IWZA 2PQ8A 2CFXA 5DUIA 4OIQF 3NE7A 1WI9A 1KU3A 3OWCA 5TRDA 5JVTA 2LF7A 2GA2A 2EV5A 2R7FA 2F5IA 4L9NA 4H89A 3I4PA 4L0YB 5LHGA 3GO5A 4JD6A 4L9JA 3CXPA 2O8XA 5E8IA 4NQWA 4RAYA 2IA1A 3R9GA 2VC1A 4HZFA 3KP7A 2ZMEB 3R1KA 4MTDA 1Z4EA 4QUSA 4AVPA 1XE4A 2XROA 3FMQA 3BJ6A 3HHGA 4I7HA 1ZAOA 4I0AA 1GXQA 2DPDA 1P6RA 4HX7A 1S7FA 3MEXA 1YO5C 3FX3A 2ZW5A 3R0AA 2CO5A 3DFGA 3NRVA 1XMKA 5KK1A 3QP6A 4G7OF 1E17A 4HNYB 2B4DB 1RZ4A 4ESBA 1B1BA 3P9IA 3QU3A 4WXCA 5DCFA 1YLEA 1W5TA 3WG9A 4CAXA 4YIFA 4OINF 3WTVC 4HF2A 4OOIA 2HZTA 1Y9KA 4A0YA 2P5LC 1U5TB 4EJWA 2J8MA 1UFHA 2MLGA 5FFXA 1LEAA 3JW4A 4EMSA 4HV5A 2HUZA 3MZHA 3L7WA 2XKPA 4CZZA 3QOPA 3KKWA 3D5LA 2HQYA 5HMNA 2GAUA 4HDVA 4P9UA 4AVBA 2A3SA 1MZBA 5JPHA 3HRMA 4AVAA 3TO9A 2GIVA 3RTRA 4BNCA 5LBQA 2ADUA 3C7JA 3MWMA 4A0XA 2FS5A 2EV6A 5J8FA 4MEXF 5CVUA 2K7LA 3TGNA 5CJ9A 1ZREA 4HLXA 1KYZA 1I27A 1NHAA 4DNCA 1ZRCA 3ZMTA 2HGCA 4AIKA 2EVNA 1UHMA 1O3SA 1FNNA 3D8PA 2GXGA 1YR0A 4XBFA 1RO5A 3PZJA 2REEA 1YW9A 1XIXA 4RGRA 3OV8A 4YFNF 2ZXVA 3FNCA 4O6JA 1P2FA 4MEYF 1Z91A 4II9A 3I64A 3ZMVA 3J80Z 1BI3A 2ZO4A 3NEUA 3C3WA 3R9EA 3W6JB 4AB7A 3E6BA 5D4SA 4P55A 1ZG5A 2LSOA 1LRZA 3T90A 2PJPA 1XMTA 2ZXJA 1Z6TA 5CVJA 4YFJA 5E17F 4KN7X 1IW7F 2A68F 4GS4A 1ON1A 4NEXA 3I59A 4CAVA 3JAMZ 2VT3A 3ZP5A 3E5UA 1UCRA 2OU2A 5D8LB 1R58A 4LG0B 2IPQX 3T1BA 3D3SA 4F6AA 2VXKA 3BY6A 5A2QK 3GFMA 2HS5A 3TKYA 4UBRA 1ZARA 2P6TA 2Z0ZA 4YIIA 5TJJA 1X3UA 2ZFWA 2D2WA 5LLQA 1IYLA 2QQ9A 1KQ0A 1RI7A 1BIAA 2H09A 2BBYA 2HFHA 1FWZA 2UXXA 2H6BA 5ERIA 1OYWA 1TBXA 4LJZF 2AS5F 3KP6A 1OYIA 4AD9A 2RGVA 3FF5A 2RDPA 4GYIA 5EBVA 2JDCA 4AG7A 4IRIA 4R1HA 4BXUA 4EV0A 2NMTA 5DD8A 4U5YA 2QLZA 3FYNA 2CNTA 1H0MA 1V3FA 1MGTA 3E3VA 2VOOA 3PGPA 3HYIA 3IHUA 4A6DA 3M7GA 1T38A 3TE4A 1NE9A 4A0ZA 4ZYHA 1TTYA 1STZA 3F72A 2Z33A 3EETA 5E96A 2QYOA 3H3UA 3HRTA 2BV6A 5BQTA 1IN4A 3KP2A 2IT0A 3BJ7A 3FXTA 4B5PA 1IN6A 2DTRA 5D8KB 1FOKA 2O6GE 3R0JA 5IT9K 1FPQA 2PI0A 4BHBA 2EK5A 2CYYA 5D6EA 2ACJA 4KZTA 2QECA 2L3DA 2A6HF 3GY9A 3I54A 4QB9A 4HX8A 2M87A 4UV9A 5BS6A 2FQ3A 1SD7A 1FZPB 1H9GA 4PSWA 3V8JA 1PUAA 5C82A 4ENKA 3SHFA 2B3VA 3S6HA 4Y17A 4OIRF 2M30A 4N9IA 5FLXK 2ETHA 1K78B 2F5EA 3ECOA 1IRGA 4FHTA 2JTVA 3GWZA 4P96A 2FT0A 1LDJA 4JBAA 1W5SA 3SZTA 4U7DA 5JHUA 5FFZA 2JEVA 2O03A 1G3YA 2WC2A 1OR7A 2ZNYA 1U8RA 3VB2A 5EEGA 3JTGA 2D4OA 3BLNA 4ETSA 1RUNA 1IF1A 4LLGF 1O7LA 1REPC 2L01A 3E97A 4YRHA 1B6AA 4XSZF 2C6YA 1USTA 3TT2A 2STTA 2OZ6A 1ON2A 3F3XA 2NNNA 4MJ8A 2DXQA 5BMZA 5E20A 1BIBA 4KOSA 2BE5F 2FE7A 4TV7A 1FY7A 4MNUA 1KUXA 4XLPF 2W25A 3RYOA 3VEPA 2HQNA 4KNYA 4HQEA 5AIPA 2FMLA 3FZVA 4WX9A 3V8LA 2OZHA 4ENMA 1R5HA 3DPTA 3KZZA 3M9AA 4FX4A 4ZYGA 1CJWA 3BJ8A 4KVOE 3MAJA 2H5MA 1G3SA 2DQLA 2KRFA 2ZJ2A 1MJ9A 1S7AA 2RNJA 3HHHA 2GANA 3TOBA 2FCKA 2A61A 2QUFA 4L5IA 3TDZC 3FMSA 3GF2A 3TFYA 2EB7A 4HQMA 1J0RA 2GE3A 1CF7B 3R61A 3GZ6A 1YS6A 1ON0A 2WTEA 5HLGA 2RN7A 1IAWA 2K4JA 3WTYC 2XAQA 4CHUA 1ZHFA 2DW4A 4K2EA 2MC3A 2P4WA 3F0AA 5D5VB 1RUOA 3B8GA 3I5UA 4LLLA 2FXFA 3DKWA 4KMFA 2XAGA 1ONVA 4OADA 4RB2C 3VWDA 2FIWA 4R79A 2EV0A 1HSTA 4I98B 1Y9WA 1HKTA 2V9VA 4AIJA 3HRSA 3ZJ0A 2A5YB 1D3YA 1ZLKA 3QPTA 2HQRA 5KVRA 4ASNA 1Z6RA 4KUMA 1FP1D 3EC4A 3UY5A 2FBHA 4NF1A 2HKXA 2WV0A 1IXRC 1XEBA 4JK1X 4EM2A 1KU9A 1EV7A 1YLFA 2HDCA 1F9NA 4HBLA 3J80K 1S3ZA 3TO6A 1XSVA 3VODA 3ZMUA 2GXBA 4FD4A 2YPRA 1KQ9A 3K1PA 4QLCU 1IXCA 4U9ZA 3GX4X 4A2UA 4RS8A 3RKXA 2GQQA 5LEKA 3C26A 3SHPA 3LAJA 1Q2CA 2M5WA 1R7JA 4OU0A 3N7ZA 2IA0A 4UVAA 1TQMA 1KYWA 3U2RA 3JAMK 1XGMA 3BJOA 2FA5A 1GXPA 3ZMDA 2HEOA 1F4KA 1LB2A 3TO7A 1WWZA 3ISPA 4LFUA 1D5VA 4PK3A 3E0KA 4MQ9F 4EM1A 3CO6C 3FB3A 3QU6A 2EUIA 3KETA 4QWQA 4M9ZA 1WRJA 3S6FA 1BO4A 4PK2A 5K5QA 5GCNA 3R60A 4KYWA 1O7FA 4ONUA 4I09A 2L02A 1HSJA 3MCZA 2VZZA 3J81Z 4BYYA 5IX3A 2V79A 4I02A 5D6FA 3R6SA 2PR1A 2QZ8A 5BPDA 1XSDA 4NCZA 3P9CA 1TIQA 1LVAA 1HW5A 1BN5A 1J4JA 4EVYA 2FOKA 5K1YA 3IWFA 2ARHA 2HKOA 3F8NA 4KOTA 1XCVA 4PGHA 2V6CA 4UUVA 2VOPA 2FMYA 3RJPA 4YG2F 3HRUA 2O0YA 4ENJA 3PFIA 3PQKA 3D0SA 1DP7P 2Z99A 4IRGA 3DNSA 2XUBA 4KOVA 5E18F 4HNXB 1K7AA 1M4GA 2I00A 3V7RA 6PAXA 2KCWA 3DV8A 3KZYA 2CQKA 4RB1A 4KOXA 3ERED 3RKWA 3GVAA 1IB1E 1BI1A 1QO0D 1YGHA 1K6OA 3C1DA 2FU4A 4MHDA 1ZG3A 2KIMA 1EH7A 1E2XA 5HDNA 3FXQA 1OKRA 3S2WA 1S8NA 5FB2A 4PSXA 1T98A 2EFQA 1J2XA 4Q48A 4CAWA 3W6SA 2KIUA 1P4NA 1Z7UA 3HSEA 1Q2YA 2Z11A 1R1VA 4L89A 2QIRA 2F5FA 2YR2A 4GO1A 4L9TA 4HF1A 1ZRFA 1HKQA 5K5OA 2VBXA 3K1NA 4MGRA 4KOYA 5LRRA 4RGXA 2OB0A 2Q2EA 1GHEA 2BL1A 3KEQA 1SFUA 1YW7A 1W7PD 4HLYA 4IF4A 5ICFA 2AXLA 2JSCA 4KVXA 4KDPA 1W7PB 3K1MA 2P5KA 4DQ2A 1SFXA 1XCBA 2XASA 1EH6A 2L54A 3ELKA 2K02A 3E6CC 5FD6A 5AIQA 3CUQA 2D45A 2PG4A 2CSOA 3MFKA 2Q8KA 3DPLC 5L3BA 1ULYA 5LGTA 3F6VA 3WTXC 1FP2A 5ILUA 4I01A 4HX4A 4JQFA 3LQQA 1LDKB 2DAOA 4IUSA 3DR8A 4A12A 1XDUA 3ZMZA 4WXHA 1QSRA 1TNTA 4CDGA 2CY2A 1IRFA 1BOBA 1B4AA 3RI4A 2MH2A 4FD5A 2OA4A 3IRQA 2PRBA 4XPDC 3IRRA 3AAFA 4UVBA 2O61A 4KT5C 2EFOA 2FBIA 1OPCA 3KCCA 4ZYDA 1OZPA 1QQIA 5BOXA 1PP7U 1Z9CA 2PMHA 2EWNA 1S7NA 3LSTA 2B5GA 1SMYF 1WQ2A 3V4GA 2NNYA 1LDDA 2NS0A 4A6EA 3ECHA 2FIAA 2HYFA 4G6QA 4QC6A 1W4MA 2VZYA 2OBPA 1TLHB 2VQYA 1BC8C 2E7XA 1MDMA 3SXYA 1R23A 1U3EM 2F5DA 1YVKA 5JQ4A 5KTAA 5HLHA 5CVVA 5F64A 4LGWA 2CGPA 1I1GA 1S7OA 1FT9A 3HOSA 1ZN2A 3KP3A 3GEZA 3V7CA 2MBFA 1T0FA 3EXNA 4KIFA 4Y13A 3KLOA 3GFLA 4O5VA 4RGSA 1HQCA 3LA2A 2XAJA 1ZRDA 4HYEA 1MKMA 2B0LA 2QBYA 1R36A 1KUYA 4CICA 3K2ZA 2Z5UA 2O3FA 1IN5A 2DK8A 2YU3A 2DQRA 4B09A 5H6RA 1I21A 3BPXA 5ICGA 3WGIA 4Y15A 3HOTA 1P0HA 1MD0A 4EM0B 4RGUA 1I1SA 3CTAA 2VE9A 4R57A 3JTHA 5HS8A 5CVIA 1IZ1A 3KP5A 2H27A 2K4BA 4XPDB 2KKOA 1C0WA 3I9SA 4KMUX 1ZG1A 2PEXA 2V1UA 3GZ5A 5F49A 2E1CA 3L2CA 2R7HA 2ESNA 1YK3A 2R7DA 4P9FA 3BWGA 3SXNA 2X4HA 4LX9A 2XIGA 2VBWA 2EJRA 2L4AA 5J8CA 1SFEA 1Z9UA 4HAMA 3I3GA 2ZPAA 3WU0A 2DI3A 2UZKA 1ZGAA 2GZWA 2VONA 2W84A 2Z3YA 3M1EA 3EY5A 3EYIA 2DU9A 3F8KA 2CWEA 3KE2A 1XF8A 3V8KA 2R98A 1XB4A 3GYHX 1XDSA 2Q4YA 2G3AA 4AG9A 4RB3C 2VE8A 2E1NA 2EFPA 2HTJA 4RAZA 2WPXA 4N9HA 2CG4A 4IRHA 4HKFA 1XD7A 4LLNA 2J8RA 4MY0A 2XHKA 2COMA 1ZYRF 2YX4A 4ZZDA 2BSWA 2PC1A 4KIGA 3WTTC 2JZYA 4XSXF 1GHCA 2REFA 3K0LA 1KU2A 1MJAA 3R96A 4HV6A 2RKHA 5J6XA 1PP8F 2HWVA 1JHFA 2VN2A 2PMUA 3WTWC 5LGUA 4ZH4F 3D2PA 3H4QA 1J7KA 4XNHC 4ZZLA 3TQNA 2IJLA 4IF5A 3N4MA 2K86A 2PFBA 2QVOA 1SAXA 2Q04A 2VXZA 5L3CA 1L3LA 2LDUA 4JLYA 4KVME 1SD5A 4XPKA 3R95A 3JSOA 4BMHA 1VTNC 4U88A 2BEOA 3W6XA 2GA1A 2QENA 1IUYA 1QPMA 1Y0UA 1TQIA 1ODDA 4IVNA 4IXAA 5ICEA 4HA8A 5DCMA 3GFJA 5ICCA 1YX0A 4D0PA 3F23A 2Q0OA 3JUWA 5DWNA 2JLMA 4FX0A 4LB6B 4GYGA 5FO5A 4CYDA 4I49A 3T8TA 4NB5A 3I59B 5IB0A 3DQVC 3QAHA 1S7LA 3K9UA 1YVOA 2BYVE 4ORFA 5CNPA 2OQRA 3GXOA 4UWJA 4WCGA 1I1DA 3TCVA 3CDHA 3M8FA 2Z9OA 4LUAA 1I6XA 3LQRA 3ZPLA 1I12A 3FRMA 2MD5A 4NXYA 1Q2DA 1USSA 1M1DA 3G73A 2ZMEA 3KLNA 2RC4A 3DF8A 4HW0A 2VT2A 2J8NA 2XAFA 4BAYA 2PDOA 2EFNA 1Y7RA 1YW8A 3T0YA 1MK4A 5CLSA 3G3SA 1HKSA 3Q5FA 4XNHB 2Q7BA 3TDUC 3T9YA 1HXDA 2IRFG 2DO7A 2JPCA 2B4DA 1NSLA 3FHZA 1R57A 3BROA 2HV2A 1L0OC 1XGNA 3HTSB 4UHTA 3RPQA 3DDDA 3BOQA 2IP2A 3V7SA 3SXOA 2KJCA 4I0BA 4FT8A 3QP5A 2ZKZA 1F1ZA 1JE8A 4OMZA 1U5TA 1TW2A 2NRAC 3WTZA 1ZGJA 4F0YA 4ZBGA 4B5PB 3WGHA 1FSHA 2P8TA 2HYGD 1BI0A 4Q5SF 3TOAA 4EJOA 4M73A 1QBJA 1D8KA 3F22A 1A04A 2FNPA 3ULQB 1O3RA 3W91A 2PN6A 4E0AA 3FBUA 4EJVA 2NYXA 3ZQ7A 4I2OA 4PGGA 1CGPA 1IICA 4HF0A 2FEZA 4RS2A 1LQ1A 3M8EA 4R8HA 2W24A 5K5RA 3HSFA 3C18A 4MQVA 1KQ8A 5DUKA 3PQJA 2YX7A 2CNSA 4XRFA 4KA4A 2P7CB 4U9YA 4IPAA 5JI6A 1U6MA 5H6QA 2ZW4A 2PSWA 3RDIA 1XGSA 3F8FA 4EGYA 4KLWA 3ML6A 5ISVA 2A07F 2TDXA 1EH8A 3RYRA 2OAZA 2D1HA 1WKMA 3E6MA 4OAEA 1QSMA 3COAC 4EJTA 5D5UB 3CXSA 1BJAA 1HBXG 2P6EA 3EUHA 4ON0A 5DD4A 3PP9A 4H6UA 3F8MA 3FM3A 1S3JA 2WPWA 2RV8A 4LK1F 2E7WA 3G8WA 1YIOA 3SFZA 2XRNA 4LG0A 1B9NA 5EC4A 1J59A 3G3ZA 4Y49C 2P6GA 4Q47A 4U0VA 1KZFA 4RB0A 1QZZA 4MTEA 5H84A 5D5WB 3WE2A 4GGGA 4AIHA 1BOAA 3CO7C 3E5QA 3WR7A 1M44A 4R3KA 5LGNA 1AWCA 1Z4RA 1DPUA 2V1XA 1VHSA 1YG2A 2XV4S 5KTDA 3I0TA 1S6LA 1P92A 4KN4X 4M74A 1WWXA 3LA7A 1YTYA 2P6FA 3QRFF 4JWPA 3E5XA 3NQOA 4WF2A 4A5NA 4KOUA 4M6YA 2ISYA 5FD5A 4X5KA 1DPRA 4KICA 4R3LA 1FSEA 3WODF 3IKTA 1B87A 2A6EF 4S04A 4M85A 4N0BA 5JR3A 5HH1A 1R22A 1FX7A 2Q44A 2B3UA 1I5ZA 3WU1B 3F8BA 2RQPA 3Q9VA 1R5GA 2OQGA 4FD7A 1S29A 2ZW7A 4PZJA 1R1TA 1FYLA 5L3FA 3J7AO 2QMLA 1B9MA 2VODA 1IN8A 1O3TA 2M45A 3O2PE 2VBYA 3GLXA 4K30A 3ABTA 3IWGA 2F5CA 3K9TA 3SQNA 3WTUC 2I79A 4L9VA 1IYKA 2FBKA 1JHHA 4Y49B 2DBBA 4CRYB 3LD2A 3LFKA 1K78A 4F7ZA 5I0CA 1CM0A 1ZH5A 1V0CA 2QWWA 2IL4A 3EO4A 4G6DA 4QVTA 3E6DA 4XLNF 1YS7A 2HOEA 2P0WA 5DDGA 1P4AA 4KORA 3IC7A 1FBUA 1V4RA 2ZNZA 4KFCA 1S60A 4IHTA 3F21A 2ZBKA 3HSRA 5EEHA 1DDNA 1FC3A 1PDNC 4M3SA 1RXTA 1FYMA 1KU7A 5ILVA 3ZN1A 3L00A 2V1DA 3FIXA 2J5OA 3OOPA 4IHSA 3BJAA 3S6KA 5F6FA 4BHCA 2VBQA 3H92A 1G6NA 2C27A 4GXOA 2ELHA 1U2WA 4MBUA 4ZYEA 3VOEA 3ZMSA 3FWEA 3N97A 1PU9A 1T6SA 4EQQA 3Q9SA 3F6OA 1ZLJA 2FSWA 4EVIA 4L18B 4KIBA 4CRZB 1LJ9A 1AOYA 3FM5A 1XGOA 2JRTA 4M71A 4UXNA 4UWIA 5CVRA 2BUEA 5C88A 1SQHA 3IGRA 3CUQC 3LAPA 1UHWA 3EYYA 3U9GA 4HNWB 3CLOA 1Q1HA 4B8XA 4A5MA 3EDPA 3O6BB 5DEQA 1XN7A 4MHGA 2A4NA 3GUDA 4NHJA 1FLIA 5HOOA 2VC0A 4JXRA 2FE3A 2MLKA 1T2KA 4CXFA 4G9YA 3CUOA 3LA3A 4HOBA 4E8OA 2W57A 4ESJA 3MZYA 4M6XA 4MY3A 4G7ZF 1CF7A 4PV6A 2OZGA 1KUVA 3S6GA 3CXQA 2QQAA 4KUAA 1RNLA 2Q0YA 2Y75A 1G3WA 1B59A 3ROUA 4E2AA 5D5XB 3W6KB 5DV5A 2Q4VA 1B6BA 4E70A 4H0EA 4ENNA 2STWA 1XMAA 2JT1A 1UB9A 2G3TA 1QZYA 3BPVA 3R4KA 2MH9A 1F5TA 4R87A 3DSBA 5LEJA 2WWYA 5HLIA 1S7KA 4WWCA 5E1XA 1TQPA 2JPBA 4H6ZA 2NAZA 4JXQA 4EGZA 4J3GA 3FMRA 1R1UA 1YYVA 1IXSB 3EFAA 1YREA 3O3KA 2XGXA 3WTSC 4XPLA 4QBJA 2UWMA 2Y48A 1VKCA 1JGSA 3ZN0A 4G7HF 4YGOA 4B5OA 2BEIA 3B73A 5IV0A 3BP8A 2XAHA 4UVCA 3RKYA 4OMYA 3LWFA 3WE3A 4OIPF 1QSNA 1BC7C 3CUQB 2FXAA 3IKVA 2M8EA 3HUGA 5L3EA 5E8GA 3F8CA 4KUBA 4KOWA 2ATRA 3KFWX 3J81K 4L0ZB 1FYKA 2ZCWA 4G94A 3RYPA 2EA4A 1SD6A 3HIFA 2M1BA 2FRHA 4U7BA 5HDKA 1N71A 5H86A 2KJBA 4LK0F 2QM3A 1YQAA 2P6SA 4PDKA 1QGPA 3L09A 1IN7A 3ABUA 5AONA 2IVMA 4JJXA 2Y0MA 1FBQA 4KLVA 2FNAA 2EFWA 3R9FA 3QPHA 3I58A 2XVCA 1RIOH 1LNWA 1J5YA 5LRSA 1QSTA 1S5KA 2B5GB 1FBSA 1U78A 2ISZA 3RIRA 4R9MA 1NMTA 5LHHA 2LKPA 2AE6A 4M9XA 4GCVA 2B58A 4OLLA 1D8JA 1G3TA 2IW5A 1BI2A 2J5PA 5IT3A 4CO8A 1SMTA 3SZPA 1MDMB 2H94A 2K27A 2LNBA 2PLYA 1R00A 5H20A 2Z10A 1P4XA 1U6GA 4BQAA 3MGDA 2CNMA 3T5XA 3GW2A 2EA2A 5FGMA 2W85A 1K4JA 5ED4A 4WXDA 2G9WA 4HDUA 1OYYA 3F5BA 3U1DA 2UXNA 2DK5A 1WK4A 1LEBA 5HS9A 3DR6A 4S05A 4P5OA 1P4WA 4IJAA 1KA8A 2L4MA 2JDDA 2QBYB 1H9TA 2YSRA 5D4RA 2ESHA 5FVJA 3VFZA 2FSRA 5HDGA 1BM9A 5DWMA 2PR8A 3H3ZA 2CW0F 3FXRA 4AWXB 4CS0B 4M72A 3P2HA 2VBZA 4L8AA 4UA3A 3KEOA 1K79A 1QNTA 5E1ZB 2XKOA 2OZUA 3DP7A 4U0WA 4YFXF 2DT5A 3JSPA 2DFIA 4RI1A 5BPIA 5L3DA 4L5JA 2AJ6A 4PCQA 1G4DA 5KTCA 3BDDA 3I71A 2F2EA 3VWEA 1IIDA 1TW3A 1J9IA 1JXSA 2PBIA 2DLLA 1GVJA 5DYMA 5CYVA 4Z2YA 5A2QZ 3T8RA 3EQLF 3BZ6A 4LD5A 2HTSA 4NSQA 5HVQC 2P5VA
chains in the Genus database with same CATH superfamily
3P2FA 3GFIA 2PIZA 5G21A 3DEUA 1O57A 4RLQA 1BPMA 3TEDA 3H35A 2O8KA 1SAUA 1VHEA 4OC0A 2Z3PA 1KGSA 3RQIA 3HOXJ 1W7PA 3CCSI 2WY8Q 3SJXA 2R92J 2BO9A 4MO7A 3QAYA 2DIPA 2G7HA 5FUYA 3FXUA 1QSOA 2BGCA 1BA5A 1ZLIA 1WSUA 3FH4A 2V7FA 1Z1DA 2VPRA 4M3BA 4E6KG 1D1BA 4LB5A 1ETOA 1HDLA 2F6CA 1KBFA 3DXJF 1OMIA 4B14A 4BBRJ 3VYSB 1CP6A 3K4KA 3PIPF 1T39A 4CSWA 4M3EA 1MBKA 3HDDA 3UFFA 2R1IA 3WGGA 2ZFUA 5JFRA 1AN1I 5F1RA 3H5RA 2G7UA 5BNGA 1PYTB 1LKXA 3L2NA 2R7OA 4C2TA 3HTUA 1LPQA 1YRNA 3S8PA 1XG1A 3GYAA 4A24A 4XNFA 3RZOJ 3A01B 2HPIA 1HW1A 1VQKI 2OH1A 2XPVA 2DPUA 4BHPA 2A69F 4E7HA 4EJUA 1ZO0A 4U0YA 2RVCA 3GTJJ 2Y69H 1PUEE 3ONQA 4ZYAA 2GWRA 4O3MA 2ZW6A 2M0CA 1TNSA 4AU7A 1JKQC 3LMMA 2GLJA 2VKHA 2VEZA 3LSRA 3S15J 3VWBA 3D2MA 2HR3A 5JM6A 2P7VB 1NH3A 2CRGA 2K5TA 2PJ9A 4KS9A 3KP4A 2F8HA 3OYEA 2NS7A 2OD5A 1HW2A 1SGPI 3LODA 2H6CA 4TWEA 3FXOA 1J75A 2VI7A 2H1LA 2NU2I 1L0CA 4Q4ZF 5HS7A 3L9FA 1O3QA 2CUEA 3P7NA 1GT0C 4ESFA 1HA8A 3ZRGA 3TTHA 2SGDI 2ZMEC 1LCPA 2V8HA 3LSGA 1M4IA 1BBYA 4BJTA 2F7VA 1Z2LA 3B02A 3G2BA 4U87A 4G8XA 4JD6A 4HNUA 2LY2A 1ZG7A 1XSXA 4JZ0A 2JVHA 3ESWB 5B5EC 1SD4A 5ILSA 1EKEA 1MBJA 1AKHB 3KZWA 3I53A 4MI4A 3S3MA 3K69A 4Y52J 5LYIA 3GKRA 2ZJRF 4UNOA 5IT9Z 3CJNA 1HDUA 2VJJA 1X19A 3ZZIA 3BCBA 2B7EA 1YFHA 4XL9A 2M4KA 3IL2A 1CBXA 3ABKH 1JUSA 2OF7A 2X0LA 1T8IA 5FKKA 2KIFA 2W4SA 5F47A 2O28A 1CT2I 2FL4A 2VXDA 3FXJA 3LSJA 5E1WA 1DUXC 4BDYA 1V5GA 1M4DA 3IUOA 4XKCA 5LHIA 2FF4A 1NK3P 2PX9A 2B4BA 3PM1A 2D1VA 3P9KA 3Q3SA 1YQEA 2K40A 4BH9A 4WK8F 2KCXA 1KWMA 3OYBA 1QPIA 1UJ8A 3MQ0A 5L3GA 1HJAI 3HGGA 4YFKF 2LF8A 5FLXZ 1DTDA 2G0BA 5B66C 3FF3A 2Y0SN 4AUXA 2WGCA 4E7JA 3B7IA 4X0GA 2XGCA 2HQ5A 3OWTA 3QB8A 4FD6A 2IA2A 3RO0A 5F46A 3J7YJ 1VGYA 3S93A 1U5TC 1OYVI 4AVCA 3V8IA 2D4PA 4PPZA 2FQ4A 2I8DA 3OYNA 4GM5A 4B12A 1MJBA 5DCMB 4B1RA 3CLQA 2XB0X 1S9HA 3PSFA 1ACIA 5AG5A 1NTCA 3L2UA 4F8ZA 2X7BA 2HZDA 3JVNA 5F48A 4NC8A 3DWLE 4XOTA 1Z05A 2KPMA 2QQBA 2CUFA 2WAQA 1GLNA 4LMYA 4M9SA 2R3SA 3REOA 1TBNA 2ZSHB 3ISXA 4OIOF 1W4RA 3RPUA 1UFMA 4Q36A 2R8VA 2JUCA 4A94A 2UUZA 4UV8A 1XS9A 3TBIA 4CGZA 2MA3A 1BPNA 4P1WA 3PEIA 1P7JA 5JHFA 1YX5A 3IWZA 1R0RI 2PQ8A 2CFXA 3MZ8A 1ZGWA 5DUIA 4OIQF 1JI8A 3NE7A 1WI9A 1KU3A 1W5CC 3SEQA 3OWCA 4B47A 5JVTA 2LF7A 5TRDA 2GA2A 3FK7A 2EV5A 2GBYA 4ONWA 2R7FA 2F5IA 4L9NA 4UY8I 2EBJA 3I4PA 1S72I 5LHGA 3GO5A 4L0YB 3BI0A 4L9JA 3OYGA 4H89A 1VFCA 3CXPA 4XKWA 2NU1I 2BVLA 5EF6A 2KDZA 2QEXI 2HQAA 2O8XA 5E8IA 5K8PA 4A3CJ 1M4LA 4XIDA 1GV2A 2L5QA 1X1CA 4BE1A 2KZVA 4NQWA 1R79A 4RAYA 2QQEA 2IA1A 1Y8RB 3R9GA 2PJCA 2VC1A 4HZFA 3KP7A 2ZMEB 1BUSA 3JRUA 4MTDA 3R1KA 5IP9J 1Z4EA 2EWBA 4C3IJ 4QUSA 4R8FA 4AVPA 1XE4A 2XROA 3FMQA 3K10A 1YITI 3BJ6A 3HJEA 3HHGA 4I7HA 1ZAOA 2BHYA 4XN0A 3GUXA 1TBOA 4I0AA 1GXQA 2DPDA 1RRJA 1P6RA 4HX7A 2OC6A 4D7NA 4YWYA 1S7FA 4ZY0A 1XTAA 1W36C 3MEXA 1YO5C 5J47A 1Y1VJ 4BE2A 4IHVA 5K8OA 4IOCF 3BR2A 2KP6A 4LITA 3VDPA 3FX3A 1D0ZA 1FNOA 2ZW5A 3R0AA 2CO5A 4M6GA 3DFGA 3NRVA 2SGEI 3KR4A 1XMKA 3PL8A 5KK1A 4LOCA 1SGNI 2NOJB 2V53A 4F9VA 3QP6A 4G7OF 1E17A 4HNYB 1LAPA 2B4DB 4OC5A 4UB8C 4UF4A 1RZ4A 3NARA 2LD5A 3NWSA 4ESBA 5EGOB 1B1BA 1ARMA 1MNDA 3EUHC 4R7MA 4M3GA 1U0JA 3P9IA 3QU3A 1FT7A 4WXCA 5DCFA 1YLEA 1W5TA 1D5YA 2VJ5A 3WG9A 4CAXA 4YIFA 2AQEA 1K6YA 1SGQI 4I76A 3W2VA 4OINF 3WTVC 1VQPI 4HF2A 1ULMA 2PMZN 1WI3A 3OYIA 3DKYA 1LFPA 3D7GA 4OOIA 3QTLD 2HZTA 1Y9KA 1TWHJ 4A0YA 2P5LC 1U5TB 2L7ZA 2ZXWH 4EJWA 1UFHA 2J8MA 3JR9A 2FUG2 2MLGA 1IGNA 5FFXA 1LEAA 2E60A 3JW4A 3M4OJ 4D1QA 4EMSA 4HV5A 1T95A 3R5DA 4EEFG 5K7ZA 2BXYA 3I4NJ 2HUZA 3SZGA 3MZHA 2KT0A 3N5FA 4X2TA 2DCEA 3L7WA 2XPWA 2XKPA 4CZZA 2CQQA 3QOPA 2GOXB 5CPRB 3KKWA 1WJDA 4YIRX 3D5LA 2HQYA 1J09A 2RFHA 4MRIA 1QHGA 3PB9X 1VHOA 5HMNA 2GAUA 4HDVA 1IC8A 4P9UA 4AVBA 2A3SA 5HQ8A 4FQGA 2EK8A 1MZBA 4E1PA 2E5NA 4MFJA 1ZQ3P 5JPHA 3HRMA 4A3JJ 4MFLA 3JRAA 1IRXA 4AVAA 4J01A 3TO9A 2GIVA 3RTRA 4BNCA 4IHYA 2QQCA 1VQLI 1VI0A 5LBQA 2ADUA 5J1RA 5FLMJ 3C7JA 3CMEI 1LAMA 3MWMA 4A0XA 2QQDA 2FS5A 2EV6A 5J8FA 1EA3A 4MEXF 5CVUA 2K7LA 3TGNA 1ZR2A 5CJ9A 1ZREA 4HLXA 1KYZA 1I27A 1NHAA 4CCMA 4DNCA 1ZRCA 3ZMTA 2KQRA 2HGCA 4NGTA 4AIKA 4MLOA 2K9HA 2V1CC 5FUXA 4MCPA 2EVNA 2K9MA 1UHMA 1O3SA 1FNNA 3BTLA 4IHXA 3HUVA 2OD1A 3D8PA 2GXGA 3DTKA 1YR0A 3I55I 2SGQI 4XBFA 1RO5A 3PZJA 2REEA 1YW9A 2D5VA 1XIXA 4HNVA 2RREA 2LK2A 4OC4A 4RGRA 1U9OA 3OV8A 4YFNF 1OCTC 2ZXVA 4YRVA 1HEVA 3FNCA 4O6JA 3K4LA 5IYCJ 1P2FA 4MEYF 1Z91A 3QYFA 4II9A 3AFHA 3I64A 4KISA 3FC3A 1OBRA 3CESA 3HPHA 3ZMVA 3J80Z 1N77A 1BI3A 2ZO4A 3GTQJ 3NEUA 5E3PA 2F48A 3C3WA 3R9EA 3A02A 3CF2A 3W6JB 4AB7A 3E6BA 5FJ8J 3CMMA 1U5KA 2K3FA 5D4SA 5H2FC 4E7ZA 4P55A 1KZHA 1WZ2A 4UEEA 1ZG5A 3IWEA 2TCTA 4JX5A 2LSOA 3IAS2 1LRZA 2JRMA 2A20A 3T90A 1SVOA 5CBMA 1YI2I 2PJPA 3HB9A 2ZXJA 1Z6TA 1XMTA 2Q43A 5CVJA 2L8EA 4YFJA 4ZI6A 4YEJA 1Y6IA 5E17F 4KN7X 2E73A 4HEA2 1X1DA 1XBUA 1IW7F 3BR1A 2A68F 2V26A 4XKVA 4GS4A 2DA3A 2WZNA 5J4VA 1ON1A 3CZ6A 2W7NA 4NEXA 3KYDB 3I59A 4CAVA 2DTZA 3JAMZ 3LWUA 3RKQA 2VT3A 1KONA 3ZP5A 3E5UA 1UCRA 1SGEI 5IP6A 4PK4A 3SI2A 1K4SA 2OU2A 3HKZN 5D8LB 1R58A 4LG0B 2IPQX 3Q0UA 5KAFC 1Z8LA 3T1BA 3U21A 2XC7A 3D3SA 4F6AA 4IHMA 3SI0A 4FAIA 2VXKA 3FBIB 1YIJI 3BY6A 5A2QK 3SEKC 3GFMA 4L9MA 2HS5A 4CGPA 3TKYA 4BXXJ 4UBRA 1ZARA 3DTIA 3GBGA 2P6TA 2Z0ZA 2JSPA 4YIIA 5TJJA 1OLTA 2ZFWA 1X3UA 1X58A 4OAZA 3JRFA 2D2WA 4HPSA 2KHMA 5LLQA 3HOZJ 4X6AJ 2ODDA 2QQ9A 1IYLA 2CTBA 2DDBA 2KRCA 1KQ0A 1S20A 1WJ5A 1RI7A 1BIAA 2H09A 3D7HA 2Z3MA 2BBYA 2VQGA 2TRTA 1MH3A 1XJOA 2HFHA 3VDUA 1FWZA 2UXXA 1O4XA 2H6BA 3BZKA 5ERIA 1OYWA 4HSRA 4CCJA 1TBXA 1Y0RA 2DMQA 3QWLA 4BDZA 4A3EJ 1LE8A 2QYVA 2ZEMA 4MIMA 3KZIC 1QZEA 4LJZF 2AS5F 4GI3C 2EQRA 4P4BA 3KP6A 1OYIA 4AD9A 4J00A 4NGPA 4RBOA 2RGVA 2PCUA 3FF5A 2RDPA 4GYIA 1LFWA 2PJ8A 2JDCA 5EBVA 4IRIA 4AG7A 4R1HA 2E5RA 4BXUA 1ULNA 4EV0A 1YJ9I 1FJLA 2NMTA 5DD8A 2HYJA 4U5YA 5AG7A 2QLZA 1H0ZA 2CNTA 1H0MA 2ZEPA 3FYNA 1V3FA 3PB4X 1MGTA 3E3VA 3K4CA 2VOOA 1HPTA 3PGPA 4OKOA 3QPSA 3HYIA 3IHUA 4A6DA 3M7GA 1WH7A 1T38A 2M3AA 3TE4A 2ZEFA 1H8AC 1XMXA 1NE9A 2GLFA 5F0CA 4A0ZA 4FE4A 1BW6A 2DXIA 4ZYHA 1WJEA 1TTYA 1STZA 2CJJA 3F72A 4XRSA 1GVDA 2Z33A 3EETA 2RIJA 2E5ZA 4XKBA 1Z8XA 2XEGA 3AL0C 2JJ7A 5E96A 4G12A 3BTCA 1YMEA 2QYOA 1A31A 4ZTJA 2AHQA 1R9TJ 3H3UA 2PJ3A 4F0XA 3K4NA 3LMSA 2X1CA 3FXLA 4E7SA 2NVTJ 2F3CI 3HRTA 2BV6A 1TF8A 2VL8A 2BW3B 5BQTA 3BG6A 4DGWB 1IN4A 1CSOI 1VZ0A 5E3QA 3IU2A 3KP2A 3D4UA 3OS0A 2IT0A 2ENZA 3BJ7A 1WGTA 3FXTA 4B5PA 1E3PA 4BD9A 4NDLA 1IN6A 2DTRA 3QYEA 5D8KB 1FOKA 2E2IJ 2O6GE 2E1MC 4CYNA 3R0JA 1SVLA 3ZQIA 3HZJA 5IT9K 1FPQA 2PI0A 2V8DA 2YUSA 4BHBA 2EK5A 2CYYA 2IAIA 2PMZA 5D6EA 2ACJA 1CPXA 4KZTA 2JW6A 2QECA 2L3DA 2A6HF 2XDVA 3DKXA 3I54A 3JREA 3GY9A 3LSHA 4QB9A 3NA6A 2YNDA 5FROA 4HX8A 2M87A 1UZCA 3LSKA 4UV9A 5B1BH 5BS6A 2FQ3A 5EG0B 1SD7A 1FZPB 3ABMH 2OCEA 1H9GA 4B44A 4PSWA 1BMOA 3MEKA 1Y56A 3V8JA 1PUAA 1TF9A 3B3TA 5C82A 1X3ZB 4ENKA 4DBQA 3SHFA 1AMPA 3FKIJ 2B3VA 3S6HA 1Z77A 4Y17A 4OIRF 2DYRH 2M30A 2NVYJ 4N9IA 1R4MB 4CCLA 5FLXK 3WC7A 2ETHA 1K78B 3S3OA 2F5EA 3ECOA 1WGXA 2WV1A 1IRGA 4FHTA 2JTVA 1SFOJ 1LFBA 1A6IA 1DGRM 3GWZA 4P96A 2FT0A 1LDJA 4JBAA 4UIAA 1W5SA 2M7BA 3SZTA 4U7DA 5JHUA 5FFZA 3UEJA 2JEVA 2DT6A 3JRDA 4II3A 1F57A 2O03A 1G3YA 2WC2A 1OR7A 2ZNYA 1U8RA 3KYCB 3E1SA 1Z8WA 3VB2A 2CFOA 5EEGA 5F0HA 3VE5A 1K7VA 4OVOA 3CCMI 3GTLJ 5D29A 4DUKA 1LVKA 3JTGA 2MABA 2K3PA 3MMYB 1YLOA 1YJWI 2D4OA 3EUAA 4Q38A 3BLNA 2PJRB 1RETA 2ZC2A 3HLPA 4ETSA 4CGOA 2LB7A 4LQ6A 5EJCA 1W0TA 1X1PA 1RUNA 1IF1A 4LLGF 1DGWY 2KMOA 1O7LA 1REPC 2L01A 4KJZA 3E97A 3OYLA 4YRHA 1B6AA 4DJLA 4XSZF 5IYBJ 1SGRI 2C6YA 4PJNA 2VASA 2WADA 2XSJC 2B63J 2HXOA 4P44A 1USTA 3TT2A 4XQFA 3HGYA 3LSPA 2STTA 2OZ6A 1ON2A 3F3XA 1JJ8C 1UELB 4UIBA 2NNNA 2HOTA 4MJ8A 2DXQA 5BMZA 5E20A 3FX6A 2CV0A 1BIBA 3CCJI 3PO3J 5EX0A 4KOSA 2BE5F 2FE7A 2ICWG 4TV7A 2LRDA 1FY7A 4MNUA 4E7IA 3AL0B 1TUSA 2KMQA 1KUXA 3PB6X 3H9GA 1I50J 3D5SC 2W25A 4XLPF 3RYOA 4ZDOA 3VEPA 2HQNA 3H36A 3BHXA 4KNYA 3BG3A 4HQEA 5AIPA 1WPKA 2FMLA 3FZVA 1Z7LA 2V4JC 3V8LA 4WX9A 1Z3XA 4ENMA 2YS9A 2OZHA 1CGJI 1R5HA 3DPTA 3KZZA 3M9AA 4JYKA 3M8JA 4ZYGA 4FX4A 1CJWA 1PYVA 3BJ8A 4KVOE 4UUSB 2R7TA 3MAJA 4ZTFA 2E1MB 1Z2IA 2H5MA 2Q1ZB 1G3SA 2IGNA 2DQLA 2KRFA 5GTIC 2L0KA 2ZJ2A 4OC1A 1TT5B 3BG5A 1SVMA 1MJ9A 4DBRA 4CYOA 1S7AA 1Y0NA 3AG4H 2UZ3A 4ABZA 2RNJA 3GIUA 1RC9A 3HHHA 1IY7A 2GANA 3TOBA 3SI1A 2FCKA 4HG2A 3PB8X 2KLOA 3A0HC 3PNTA 2K85A 3ZXSA 3KR5A 2VUMJ 2A61A 2QUFA 2AFMA 3NH4A 4L5IA 3TDZC 4PJMA 1ETVA 3BTIA 4D5CA 3FMSA 1VIXA 3GF2A 3CC2I 3TFYA 2JA7J 4GDFA 1VQ6I 3GZNB 5JLXA 3S14J 2EB7A 5CCLA 4ZJZA 2KMRA 3BR6A 3KY9A 3UOEA 2RB7A 4HQMA 1J0RA 2GE3A 4IAVA 2KFDA 4L5EA 3GLJA 2EK9A 3UKGA 3CJRB 2R5ZB 4FE7A 1CF7B 3OXLA 3R61A 4XMYA 3GZ6A 1YS6A 3A0BC 3R5AA 2BXZA 1ON0A 2WTEA 2C6GA 4V2FA 5HLGA 2RN7A 3IAM2 1OR7C 3PFEA 1IAWA 5DAEA 4JOMA 3IH2A 2K4JA 3WTYC 2XAQA 4CHUA 1ZHFA 2DW4A 3MKWB 4K2EA 2MC3A 2P4WA 3F0AA 5D5VB 5EYRA 3L2VA 2BUSA 4XRMA 3CQZJ 3QODA 1RUOA 3S17J 3B8GA 3SJFA 5J1QA 1G2HA 2ZEDA 1OISA 2Y9ZA 4GFBA 5B1AH 4BJ5C 3HOVJ 3I5UA 4LLLA 2FXFA 3DKWA 4CUGA 2R5YA 4PXBA 4KMFA 2XAGA 2PJ6A 3V38A 1ONVA 4OADA 2QKMB 4RB2C 3VWDA 1XFOA 1V54H 2FIWA 4R79A 2DPTA 1S5LC 3AG1H 2KRHA 1LFUP 2EV0A 1HSTA 4P4IA 4I98B 1Y9WA 1HKTA 2EO8A 2V9VA 4AIJA 3HRSA 3OR1C 4D5FA 3ZJ0A 2A5YB 1MH4A 4NBQA 1D3YA 2VRWB 4A30A 3PUBA 1TBQR 1ZLKA 2X6WA 3WC5A 1NXUA 3AKZA 3H5ZA 3KGQA 3KQXA 4P4JA 3QPTA 3K4JA 2HQRA 5KVRA 4ASNA 1Z6RA 4KUMA 2VLAA 1FP1D 1GUUA 1PUFB 1VQ9I 3EC4A 3UY5A 1WHUA 2FBHA 1X74A 4NF1A 2HKXA 1W1WE 3SGBI 3UGIA 2WV0A 4BE0A 3JRIA 4W97A 1IXRC 1MSEC 1FAQA 1H8LA 1XEBA 4JK1X 4MFEA 4FUUA 2VI6A 4EM2A 2ELKA 4EMEA 3PUFA 3GTPJ 1KU9A 2IEKA 1EV7A 1YLFA 3CCLI 1FIAA 2HDCA 4CYCB 2HDWA 2CJSC 1F9NA 3MKYB 2N17A 4HBLA 5FKLA 3IWWA 4KITB 2HVRA 3J80K 3JCUC 2GKTI 1IDYA 1S3ZA 3TO6A 2CW7A 5F09A 2ZXIA 1XSVA 2VQLA 3VODA 4B3XA 1RTQA 4P45A 3ZMUA 2GXBA 1X10A 2E34A 4FD4A 3HUGB 2CIJA 2YPRA 1KQ9A 3K1PA 3IH4A 2M5XA 4NJRA 3QNVA 2MW8A 2ORWA 4QLCU 2QQ0A 2L9SA 5KAIC 3KHXA 4ZX9A 1IXCA 4U9ZA 2CQXA 1EE3P 5F04A 3GX4X 4A2UA 4RS8A 1HCRA 3RKXA 5KCMA 1JT0A 1FYBA 3BTJA 2GQQA 4A95A 1ITYA 5LEKA 2JA2A 2ARPF 4RAGA 3C26A 3H1CA 4A39A 5DM6F 3SHPA 3LAJA 1KMAA 2Z3NA 1Q2CA 1ETYA 2IS6A 3OMYA 3NWTA 4NGQA 3RU0A 2M5WA 4BEHA 3CDLA 1R7JA 1OCZH 4OU0A 3N7ZA 2IA0A 4UVAA 1TQMA 1KYWA 3U2RA 3OR2C 4BINA 4NNJA 3JAMK 1Y8QB 4D9JA 1XGMA 3BJOA 2FA5A 3JRGA 4XLHA 1GXPA 1D1AA 3ZMDA 1YSJA 2HEOA 1F4KA 1Y8FA 4KSFA 1LB2A 3TO7A 3V7ZA 4HNTA 1WWZA 1VQ4I 2VQHA 3ISPA 4LFUA 4OIWA 2LUYA 1E3OC 1D5VA 4PK3A 3E0KA 4MQ9F 4JX4A 2GXAA 2QJ8A 3FJUA 5LRGA 3RAMA 1QU3A 3D7FA 4II2A 4EM1A 3EPZA 3CO6C 3FB3A 2NU3I 3FSYA 3QU6A 4HPQA 1EF4A 3SGQI 2EUIA 3KETA 4WP4A 4QWQA 1X2MA 4FETA 1OMTA 2JA6J 1X2NA 2EZLA 1WRJA 4M9ZA 4UCPA 1FMVA 3S6FA 1WJCA 5FRNA 1Y1WJ 1BO4A 3ERMA 4PK2A 4ZDLA 5K5QA 5LFAA 3B3VA 3R60A 4KYWA 2WUUA 5GCNA 1O7FA 4ONUA 4I09A 4M3DA 2L02A 4M6VA 4IO9F 1BL0A 1B8IA 3Q0WA 2N71A 1HSJA 3MCZA 2VZZA 3ZGKA 3J81Z 4BYYA 2DODA 5IX3A 2V79A 1R6RA 3VATA 4I02A 5D6FA 4W1UA 3SFIA 4P10A 2VB6A 3R6SA 2IMOA 2PR1A 2V9KA 2QZ8A 5BPDA 1XSDA 4NCZA 1K83J 3A1YA 3P9CA 2AFOA 1TIQA 1LVAA 1K4TA 1MIJA 5FUWA 1HW5A 2CUJA 1BN5A 1J4JA 1TKHA 4EVYA 4PFOA 2K9SA 2FOKA 2V9PA 2JMWA 5K1YA 3IWFA 1WCMJ 3WHBA 2ARHA 2HKOA 3F8NA 4OAYA 3MKLA 4PXCA 2AXTC 4KOTA 2ZSIB 3S9LA 1XCVA 1V5EA 4PGHA 4B48A 1A2ZA 1FIPA 2V6CA 1B72B 4UUVA 2FMYA 2VOPA 3A9LA 3RJPA 4AVZA 5M3FJ 4YG2F 3OL0A 2QSGX 4A3GJ 2UVOA 3HRUA 2O0YA 4ENJA 2NOGA 3O8GA 3PFIA 3PQKA 4Y4RA 3D0SA 1DP7P 2Z99A 3J7AY 2ENNA 4IRGA 3DNSA 2XUBA 1WFXA 4KOVA 2LFBA 5E18F 3HOYJ 4HNXB 1H88C 1PCEA 1VF9A 1K7AA 1M4GA 2I00A 3V7RA 6PAXA 2KCWA 3DV8A 1MNMC 1P9ZA 3KZYA 2CQKA 4RB1A 2LY9A 2IBDA 4KOXA 1DQUA 3ERED 4C2UA 3RKWA 3GVAA 1IB1E 1BI1A 1QO0D 3PO2J 1YGHA 2KL4A 1K6OA 2EPFA 4MMOA 3DBRB 3C1DA 2FU4A 2RAEA 5EX3A 4MHDA 1ZG3A 2KIMA 1EH7A 1E2XA 5HDNA 1VQOI 2M34A 3FXQA 1OKRA 4G6TB 3S2WA 2HVSA 1S8NA 1OVOA 5FB2A 2JYYA 4PSXA 1T98A 2EFQA 1J2XA 4Q48A 4CCOA 4CAWA 3W6SA 2KIUA 1P4NA 5JHWC 1TKFA 1XA6A 2DT7B 2E2HJ 2IS4A 1BR4A 1Z7UA 4NJQA 3HSEA 1Q2YA 2Z11A 1R1VA 3DLLF 1M1EB 2RNGA 5M5XJ 3RQ4A 4L89A 3U1KA 4A3DJ 1LANA 2EBIA 5FRMA 5A28A 1BR2A 2OTJI 2QIRA 2F5FA 2JA1A 2YR2A 4GO1A 4L9TA 3RCOA 4HF1A 1ZRFA 1HKQA 1IO2A 4F91B 5K5OA 2VBXA 3HPGA 3K1NA 4MGRA 4KOYA 2OJED 2M2EA 1I3QJ 5LRRA 4RGXA 3WABA 1MSFC 3H9QA 1XMBA 1TWAJ 1Z0XA 3CMYA 1YHQI 2Q2EA 2OB0A 1GHEA 2BL1A 3KEQA 2H1KA 1SFUA 2VJ4A 1YW7A 1W7PD 2VKDA 3KYLA 4HLYA 4IF4A 1CHOI 2DJIA 4K3NA 5ICFA 1XOVA 2GIZA 2O53A 2AXLA 2JSCA 1Y1BA 3W3CA 2QCOA 1W7PB 2RQQA 3K1MA 4BACA 4KDPA 2P5KA 2DA5A 2GKVA 3DU6A 3FEDA 4C2XA 3KIOA 4NC7A 4DQ2A 1SFXA 5F0FA 2B0UC 4CGMA 1XCBA 4EWTA 5A27A 2XASA 3K70C 1N78A 2BOAA 1EH6A 2L54A 3ELKA 2HDDA 2CWHA 2SGFI 2K02A 3E6CC 4IHWA 4A3LJ 1ZG9A 5FD6A 3K6GA 2LG4A 4IQJA 3K4BA 5AIQA 3CUQA 2G9DA 2LKXA 3H9JA 1WH5A 1ETWA 2D45A 2PE3A 3WT4A 2ZEHA 2PG4A 1PJRA 2CSOA 2Q8KA 1TWFJ 3DPLC 3MFKA 5L3BA 7CPAA 4JYWA 1ULYA 2XF6A 1YRNB 5LGTA 4WJBA 3NH8A 4N4OB 3WC6A 1TL8A 1VQ8I 3SDBA 3F6VA 2BY0A 3WTXC 1FP2A 1QQ9A 5ILUA 4I01A 3ZCOA 5K7FA 4HX4A 1XC5A 2ZENA 4BBSJ 4JQFA 1KBEA 3ISZA 3LQQA 3H0GJ 1LDKB 2DAOA 3CCQI 4P6YA 4IUSA 3DR8A 2K5CA 1AA7A 2EIJH 2EIKH 1LR9A 3GOXA 4A12A 2B9SA 3IFEA 4UCNA 1XDUA 3ZMZA 1VQNI 4WXHA 3D7DA 1QSRA 1TNTA 4F52A 1YU6C 2DMTA 2X1EA 5C4JJ 4CDGA 3TW6A 2CY2A 2M9HA 1CT4I 1IRFA 1BOBA 2WVJA 4MHPA 2E2JJ 3PSIA 4QIWN 1B4AA 3RI4A 4BQOA 5IOYA 3D00A 2MH2A 4FD5A 2OA4A 3IRQA 4RDUA 2PRBA 1LOKA 3PDNA 3OSFA 4XPDC 3IRRA 1QA6A 3AAFA 4UVBA 2O61A 4KT5C 1A35A 1N25A 4ANJA 1JTXA 3FHNA 2EFOA 2FBIA 2HU9A 1OPCA 1W36D 2DPSA 3KCCA 4ZYDA 1OZPA 1QQIA 5BOXA 3MD2A 1Z9CA 1PP7U 2PMHA 4BBHA 2EWNA 1S7NA 5CCMA 3LSTA 2B5GA 1MMDA 2L9NA 3PRTA 1SMYF 1WQ2A 3V4GA 4J19A 3KI9A 4OWRB 2ZJPF 1ZKGA 2NNYA 1LDDA 2NS0A 1JTYA 4A6EA 4P4FA 4QPQA 2NXNB 3H5NA 1POGA 3AG2H 5AG4A 4CAFA 3ECHA 2FIAA 4D7MA 2HYFA 5E79C 2ANPA 4G6QA 2LREA 1W4MA 1IW4A 4QC6A 2VZYA 2OBPA 2IQ6A 3I4MJ 1R4NB 1JUPA 1TLHB 2IGKA 2VQYA 1BC8C 2E7XA 2I10A 1MDMA 3SXYA 1R23A 1U3EM 1XPXA 2F5DA 1YVKA 5JQ4A 4LG3A 4BXFA 3S1MJ 2X51A 5KTAA 5F1JA 5HLHA 2XEFA 1MMAA 1M8BA 5CVVA 5F64A 1MT1A 1R71A 4NUBA 3MVPA 4LGWA 2CGPA 3CCUI 1WKXA 2WSAA 1I1GA 1S7OA 1R49A 1FT9A 3HOSA 4KVXA 1U9NA 4KSAA 1ZN2A 2DDAA 2HI3A 3KP3A 1IOFA 3GEZA 2HVQA 1ZG8A 2NU4I 1NUBA 3RBUA 4BJ6C 3V7CA 2MBFA 3RPUD 1VDDA 4AMLA 4F92B 1T0FA 4AIDA 2IGOA 1IUFA 2KMUA 2GKRI 3EXNA 3KHZA 4KIFA 4Y13A 4AM3A 1Y7EA 2N1AB 3KLOA 4B6DA 1Z3YA 3GFLA 4O5VA 4RGSA 1HQCA 3LA2A 2XAJA 1ZRDA 3KQZA 4HYEA 5E3OA 2V8VA 1MKMA 2B0LA 2IGMA 1R36A 2WY7Q 3HL2A 3ZR8X 3CF5F 1AHDP 2QBYA 4UXIA 1KUYA 4MXUA 1OCPA 4CICA 3VH9A 3K2ZA 5IY5H 1QHHD 2Z5UA 2O3FA 1IN5A 3PFOA 2DK8A 3VARA 2YU3A 2DQRA 3DPUA 4B09A 2PJ4A 2YNCA 5HNHA 5H6RA 1I21A 1TWCJ 3BPXA 1G8XA 1MBFA 2K9QA 5IB9A 5ICGA 3WGIA 1UWYA 4Y15A 3HOTA 1P0HA 1MD0A 3LL7A 4RGUA 1I3AA 4EM0B 2EILH 3CTAA 1I1SA 2VE9A 2QPOA 3GB0A 3TX8A 4R57A 3JTHA 4NQWB 1Q1VA 5HS8A 1VQMI 5CVIA 3G1OA 1IZ1A 2R7UA 2JZMA 3KP5A 1DS2I 2H27A 2K4BA 2GM4A 1TGSI 4FISA 2KKOA 4DYRA 1HF0A 1C0WA 2PVVA 4XPDB 2LBFA 4C3JJ 4C68A 1Q7LA 5G1ZA 3I9SA 4XR6A 4RLFA 1JQGA 4KMUX 3ABLH 1ZG1A 2C6PA 3IIBA 2PEXA 4C7IA 2V1UA 2R7QA 2X6XA 3GZ5A 4B3AA 2AFZA 2Y2ZA 2JA5J 5F49A 2NSMA 4PJ0C 5AG6A 2E1CA 3VPRA 4RM3A 9WGAA 5HLTA 3OY9A 5TISC 3L2CA 2R7HA 4OMEA 2DFHA 2MYSA 2X48A 3B3SA 4OC3A 4ZDPA 3NH5A 2O5RA 2ESNA 2FNFX 4A3MJ 1YK3A 2XEIA 3CCYA 4UB6C 5EMIA 2E1OA 2R7DA 1UG0A 4P9FA 4XRSG 3BWGA 1F43A 3SXNA 1R5ID 3FIWA 2ORVA 2XPUA 2X4HA 3B35A 3BQZA 4LX9A 2GFQA 2MSYA 2XIGA 2VBWA 2VQCA 1X1AA 2EJRA 2DA7A 2Y31A 1JWQA 2L4AA 5J8CA 3G4SI 3H8GA 1SFEA 1Z9UA 4HAMA 3I3GA 4Z65A 2W00A 4LIUA 2ZEOA 2ZPAA 3QOEA 3WU0A 2DI3A 3OIQA 1PVEA 5GP9A 1ZGAA 2GZWA 2LOOA 2UZKA 5EZGA 2CWFA 2YUUA 2VONA 4PJJA 2W84A 2Z3YA 3M1EA 3EY5A 2WAEA 2EH3A 3ZQGA 4Y3OA 3EYIA 2DU9A 3F8KA 2IJZA 3FXKA 2CWEA 3KE2A 4MFQA 1ERDA 3UEYA 3TP0A 3R5BA 5G20A 1XF8A 3V8KA 2R98A 3A01A 4DYCA 1XB4A 3GYHX 2GU2A 3DU5A 1XDSA 1YW6A 2Q4YA 2L9VA 3DCFA 2VPLA 2G3AA 4AG9A 4RB3C 2I3CA 2VE8A 3CCRI 1YE9A 2E1NA 2EFPA 2HTJA 4RAZA 2WPXA 4N9HA 3WG7H 2CG4A 2DA2A 4IRHA 3C2BA 4HKFA 3FMCA 1XD7A 4DJAA 4LLNA 3GTMJ 2J8RA 4Q7AA 4MY0A 3OYFA 2XHKA 2JA8J 2COMA 2CTCA 2PJ0A 3CZXA 1ZYRF 3K7AJ 2COBA 3T8WA 1T08B 2BHZA 2N8GA 2YX4A 1MW7A 1P9GA 1ZK8A 4ZZDA 2DB6A 4KIGA 5EEAA 2BSWA 2PC1A 4IQ4A 3WTTC 2JZYA 4XSXF 4B4CA 5JLWA 1GHCA 4IOAF 1XX6A 2REFA 3K0LA 1KU2A 1MJAA 3R96A 1CP7A 4HV6A 5GAHJ 2RKHA 3W6VA 2QF7A 4FBEA 5J6XA 2DA4A 1PP8F 3GCMA 2HWVA 1AKHA 4UFVA 4OC2A 4OP4A 4HGUA 2Z16A 1JHFA 2ERWA 2VN2A 2PMUA 3WTWC 5LGUA 1TP4A 4BKXA 4ZH4F 3D2PA 1W3SA 3H4QA 3CCVI 4C9YA 4GRIA 5J3LA 2ZOGA 1J7KA 3M1CA 4XNHC 1MNEA 3TQNA 4ZZLA 2ECCA 1GYTA 2PIYA 2IJLA 4IF5A 2PRQA 3N4MA 2K86A 2PFBA 2X6OA 2QVOA 1SAXA 3B4VC 2Q04A 1RKTA 2VXZA 5L3CA 1E3HA 1L3LA 1I39A 2LDUA 2KISA 3RSNA 3SDGA 4JLYA 2K9LA 5B3SH 4KVME 1SD5A 1JT6A 4XPKA 4IL6C 1IV6A 2LEOA 3R95A 3JSOA 4DW6A 1IU8A 4BMHA 3BLYA 1VTNC 4U88A 4OIDA 2BEOA 1HOMA 2DF5A 3W6XA 4IEJA 2GA1A 2QENA 2LP0A 4CGNA 1IUYA 1QPMA 5F08A 1Y0UA 4BS9A 1SANA 1TQIA 1ODDA 2CMPA 2OCCH 4IVNA 3GMEA 2CU7A 2L2OA 4IXAA 5TGTA 5ICEA 3L2WA 4HA8A 5DCMA 1JKPC 1PTRA 1IY6A 2NYQA 2OR4A 3GFJA 5ICCA 1YX0A 4D0PA 3F23A 2Q0OA 2R7ZJ 3JUWA 5DWNA 1BAVA 2JLMA 1Z67A 2EZIA 4BGDA 1HC8A 1FOYA 1JUMA 4FX0A 4LB6B 2X52A 3LACA 2EIMH 4RM2A 4GYGA 4JP0A 5FO5A 5GAEJ 2CQNA 4CYDA 4I49A 3T8TA 3OYJA 4NB5A 2QQ8A 3I59B 4C3HJ 1ZLHA 1APLC 3DQVC 5IB0A 2CS3A 3QAHA 1CE3A 1S7LA 4M6IA 3K9UA 3SYTA 2BYVE 1YVOA 4ORFA 2BY3A 4BQQA 4P4EA 1R43A 3IP4B 3B3CA 2X85A 5D8NA 3QWPA 4UXHA 3E7LA 5K8MA 3GTOJ 5HI7A 3TJQA 2JBKA 2H8RA 2UV1A 5CNPA 4DYOA 3G71I 1DP3A 2OQRA 3GXOA 3SJMA 4UWJA 4WCGA 4NC6A 1CPSA 1I1DA 3TCVA 3CDHA 3M8FA 2OOTA 2Z9OA 3PBEA 4LUAA 1I6XA 3D5RC 3LQRA 3ZPLA 1ELLP 1X3WB 3CP2A 2GOMA 1I12A 3FRMA 2MD5A 4NXYA 1Q2DA 3CC7I 1USSA 1M1DA 3HEFA 4DYQA 3S9MA 5DS0A 3G73A 1N75A 4B10A 2ZMEA 5FKNA 3RZAA 3G1MA 3OXFA 2XRCA 3DEEA 1LE8B 3KLNA 4A69C 1TT0A 2RC4A 3DF8A 2AFUA 4HW0A 5M5WJ 1ZTRA 1HDPA 2VT2A 2XAFA 1I6HJ 4BAYA 2J8NA 2EFNA 2VKEA 1YW8A 2K9NA 1Y7RA 3T0YA 2PDOA 1MK4A 3D66A 5CLSA 3G3SA 2PJAA 1HKSA 3Q5FA 2L7KA 1BR1A 3W2AA 4XNHB 2Q7BA 5K8NA 3TDUC 2FJ1A 3VDXA 1HXDA 2PJ1A 2IRFG 3QYBA 5G22A 3T9YA 2DO7A 2JPCA 4B43A 2B4DA 1NSLA 1D0YA 2HOSA 1Q9BA 3FHZA 1IV8A 1R57A 5EGOA 4H4KC 4UEFA 3EUKL 3BROA 2HV2A 1L0OC 1XGNA 2W1OA 4S0HB 1YX3A 3HTSB 4B11A 2WB1A 3OXGA 5GTHC 4UHTA 3RPQA 3DDDA 3BOQA 1BJZA 2IP2A 3V7SA 3SXOA 2KJCA 2B8TA 4I0BA 4FT8A 4XM3A 3VYUB 3GTKJ 4LQGA 3QP5A 2JXDA 2ZKZA 2PJBA 1F1ZA 2BY1A 5J4YA 1LR7A 1JE8A 4OMZA 2ZEEA 4ZX8A 1U5TA 4PUSA 1CX8A 1TW2A 2Z2SB 2NRAC 3WTZA 1YJNI 2ROWA 1RESA 1ZGJA 4F0YA 5FUVA 4ZBGA 4B5PB 2ID3A 1NG6A 3WGHA 4XLCA 4W9YA 6CPAA 1FSHA 2CQ7A 3OIPA 3S1NJ 2P8TA 3NAUA 3OYAA 2HYGD 3CXLA 3FEEA 4P4DA 1BI0A 1Z21A 3TOAA 4EJOA 4Q5SF 4A33A 1UUCA 4M73A 1QBJA 2ZEGA 3OOUA 1D8KA 5DS9A 4A32A 3F22A 1A04A 2FNPA 3ULQB 1O3RA 1IGBA 3W91A 2PN6A 4E0AA 3I3LA 1RFHA 2DA1A 3FBUA 4EJVA 3BG9A 5IYDJ 3OYMA 4C7HA 2AO9A 1UHSA 1TXRA 2NYXA 4XONA 3ZQ7A 1FOWA 5LYFA 4ZYQA 4I2OA 3HH2C 2O7OA 4PGGA 1CGPA 3F0CA 1IICA 2M4GA 2KIQA 4HF0A 2Q4ZA 2FEZA 3B6CA 3RZDJ 4FKDA 4RS2A 2JVGA 4O23A 3LSMA 1LQ1A 3M8EA 4R8HA 2BOLA 4PFPA 1PCAA 2W24A 2G0EA 5K5RA 4C2MJ 2KZGA 4MPIA 3HSFA 4MCQA 3C18A 3FSXA 4MQVA 2NVQJ 1KQ8A 5DUKA 2JK3A 4AC0A 4CCKA 3PQJA 2YX7A 2DOAA 3DTEA 2QA4I 2CV1A 2OV7A 2CNSA 5FKMA 4XRFA 2XSDC 2WBMA 1JKOC 2YQPA 4KA4A 2P7CB 4U9YA 2HNHA 1UMQA 2DYSH 4IPAA 5JI6A 1U8BA 2P6AC 1U6MA 5H6QA 2DFFA 5F27A 1A5JA 1MMSA 1X1BA 1PTQA 2A6TA 2DEAA 2ZW4A 3IEHA 2PSWA 4MCSA 1RR7A 1WVRA 3RDIA 4H2KA 1XGSA 2IS1A 1ORKA 4CYPA 3KPHA 3F8FA 3IV5A 4EGYA 3C2GA 3ML6A 2J87A 4KLWA 4R76A 5ISVA 2LY1A 2A07F 2V8GA 2Y9YA 1S7EA 4IX7A 1F36A 2ECBA 5HVFA 5THWA 1TZLA 1EH8A 2TDXA 1X12A 3RYRA 2OAZA 2W0TA 3E0JB 2D1HA 1WKMA 1XX5A 3E6MA 5CKTA 1QSMA 4AYBN 1JGGA 4OAEA 3QPLA 2YGWA 2LC2A 1ZR4A 3COAC 4EJTA 5J40A 5D5UB 3CCEI 3CXSA 1BJAA 1HBXG 2LH9A 1M8CA 1E0EA 3ZOBA 2CUZA 2VKVA 1A36A 3DBHB 4BUPA 2P6EA 3EUHA 4BU2A 2M7AA 2FX0A 2NU0I 2A5WA 4ON0A 5DD4A 1WTJA 2R7VA 3PP9A 4H6UA 2P81A 4RA2A 3F8MA 3FM3A 2DKVA 1S3JA 2WPWA 5C44J 1TC3C 2RV8A 2BCOA 1OCOH 4LK1F 5EDNA 2E7WA 2DFEA 3G8WA 4XLEA 4DZJA 2R7XA 1YIOA 4MFKA 1GV5A 1WJAA 4BY7J 3SFZA 3BXMA 1D0XA 2CW8A 1MBHA 3BZCA 2XRNA 1AUGA 4LG0A 3GTGJ 1HEEA 1B9NA 2FVGA 5EC4A 1J59A 2JWTA 3G3ZA 1W0UA 3BI1A 2QGUA 2XGEA 2AFXA 1K7TA 2X3TA 5E3RA 2KDOA 1QRYA 5J1UA 2JBJA 3MRUA 3UNGC 4X8IA 2P6GA 4Q47A 4U0VA 1KZFA 5DTDA 4RB0A 5FLVA 1IG7A 5AGEA 2BVMA 2DMPA 2YNEA 2HOAA 4F93B 3K2AA 2R0QC 4N4NB 5IP7J 1HDQA 1QZZA 1ENHA 3H8EA 4FWUA 4MTEA 1Y39A 1SEUA 3B6AA 3HBLA 5H84A 5D5WB 3AG3H 3WE2A 2Q7SA 4GGGA 1BOAA 4AIHA 3CO7C 3B2YA 4F55A 3E5QA 2MD0A 2C1CA 3BC8A 2HPMA 2FOWA 4MFDA 2KMPA 3WR7A 3CD6I 1M44A 2PJ7A 4DZPA 4R3KA 5LGNA 1AWCA 1DU6A 4XOPA 4A31A 1Z4RA 4A3KJ 1DPUA 3E59A 3ZQQA 2V1XA 1VHSA 1YG2A 2XV4S 4IZZA 5KTDA 2V1CA 2R7WA 3I0TA 4QPOA 2CV2A 4I6ZA 5GAGJ 3JRCA 2GVIA 1S6LA 4XICA 1F2PA 2A05A 3LFUA 4ZY1A 1TURA 3TMOA 1OFCX 2WYRA 4MCRA 3I9V2 1V1IA 2LTPA 3F9KA 1Z5RA 3ZQCA 2ABZA 1P92A 4KN4X 4M74A 1WWXA 3LA7A 3OL4A 1YTYA 3O8HA 3JTKA 4TNUA 2P6FA 2WAFA 1MBEA 4UXJA 3MN8A 2MGQA 3QRFF 3IO1A 4JWPA 3E5XA 3NQOA 4WF2A 3S16J 4A5NA 4KOUA 4M6YA 2ISYA 5FD5A 4X5KA 1DPRA 3FK6A 2R5YB 4KICA 2EZHA 3FECA 3A2KA 2ELIA 4R3LA 1WJFA 1FSEA 3WODF 3IKTA 1B87A 2A6EF 1T33A 4S04A 4N0BA 5JR3A 2WCYA 1R22A 3UGDA 4M6HA 4M85A 4YU9A 1FX7A 1TBRR 2Q44A 2SGPI 4JCVE 1ZELA 2B3UA 1I5ZA 1UAAA 3WU1B 3F8BA 2RQPA 3Q9VA 2BW3A 4M3FA 3OYKA 1ETKA 3R5CA 3CPAA 1R5GA 3V42A 1JKRC 4CA0A 2ZB9A 2ZJQF 4A3FJ 5EZHA 2OQGA 2LVSA 1UHAA 2Z3KA 4FD7A 2DJNA 4YELA 7WGAA 1S29A 3VSLA 5DM7F 4MHZA 2ZW7A 1WJBA 3HM5A 4PZJA 4QSHA 1R1TA 3FISA 3ZQLA 4HRIA 1FYLA 1G59A 5L3FA 3J7AO 2QMLA 1B9MA 2VODA 1ETQA 1IN8A 1O3TA 2M45A 3O2PE 2VBYA 3GLXA 4RMNA 3HOUJ 4B13A 4K30A 1X4PA 1XRYA 1IY5A 3L2RA 3ABTA 2ME0A 3IWGA 3WU2C 4X1EA 3H5AA 4XLAA 2R7RA 2F5CA 3K9TA 5EG0A 2ZOFA 3SQNA 3WTUC 1Z8TA 4L9VA 2LR8A 1ETXA 2I79A 1IYKA 1UG2A 1T56A 2FBKA 2JQ7A 1JHHA 3A4CA 4AXVA 3DGVA 4Y49B 3TW7A 1YOVB 1XBTA 2L7MP 2MFZA 2DBBA 4CRYB 1TWGJ 3LD2A 4HSTA 3PB7X 3LFKA 1K78A 4F7ZA 3TP3A 1VQ7I 4ZY2A 5I0CA 3H3VK 1CM0A 1ZH5A 1V0CA 3FBNB 2QWWA 2IL4A 3EO4A 2OUMA 3ASOH 3E6DA 3Q0VA 4G6DA 4QVTA 4XLNF 3NE8A 3OYDA 3LOCA 5M5YJ 1YS7A 2HOEA 2P0WA 3IJ3A 1SGDI 3H0DA 5DDGA 1P4AA 3D68A 2V6EA 4KORA 3IC7A 4UUTA 1WGCA 4UEZA 3A03A 1BLLE 2ODFA 2JEWA 1FBUA 1V4RA 2ZNZA 4KFCA 1S60A 4IHTA 3F21A 1V55H 2ZBKA 4E7KA 3HSRA 5EEHA 2IS2A 3KASA 1DDNA 1NK2P 2NS8A 4ZGYB 3G6EI 4XORA 3E2IA 1FC3A 2PJRA 4BEHB 1PDNC 4M3SA 1RXTA 1FYMA 3M07A 1KU7A 4CYQA 5ILVA 3ZN1A 3L00A 2YU9J 1YTPA 2MG4A 4UFWA 5LYLA 1MMNA 2V1DA 3FIXA 2J5OA 3IU1A 3OOPA 3CC4I 4IHSA 3BJAA 3KL9A 5JH9A 3S6KA 5F6FA 4BHCA 3HC7A 2VJIA 3H92A 3I56I 2VBQA 3S9NA 3ZQHA 1G6NA 2C27A 1QVTA 2ELHA 1U2WA 4GXOA 3S1RJ 4MBUA 3PFYA 3OSGA 5LYDA 1Y0YA 4ZYEA 4UCMA 1D1CA 3PNVA 2AFWA 4DOZA 4F3QA 4JX6A 3VOEA 1OJLA 3ZMSA 1AYEA 3FWEA 2NVXJ 3N97A 2AFSA 3TC8A 4F9UA 5HXDA 1FARA 1ELMP 1PU9A 1T6SA 4EQQA 3UR3C 3J7ZI 3Q9SA 3OIOA 3F6OA 4CCNA 1ZLJA 2FSWA 1UVGA 5CQEA 1B8IB 5M3MJ 5HH1A 2R4GA 4Y33A 2ZXHA 4EVIA 4L18B 4KIBA 4AYBA 4CRZB 1Y1CA 4CZCA 1LJ9A 3K70D 2LYCA 1AOYA 5LD2C 2PVWA 2O9LA 2L7XA 3FM5A 1XGOA 2JRTA 2H8WA 4M71A 4UXNA 3PIOF 4UWIA 4CAEA 2ME6A 2J9AA 5HVHA 1HLVA 3HXLA 1AU7A 3K2KA 5CVRA 4UUSA 3M3YJ 2BUEA 3G1LA 5C88A 2XB5A 1SQHA 4BQNA 3IGRA 1MBGA 5K7HA 4XLFA 3CUQC 3MN2A 3VYTB 2Y0SA 2F4IA 4Y49C 3BR0A 4EATA 3LAPA 3SJGA 1UHWA 3EYYA 5IPAA 2HB6A 5IOZA 2QVPA 2V77A 3U9GA 5C3EJ 4HNWB 4E7LA 3W2WA 3CLOA 4PQAA 1Q1HA 5CQGA 4B8XA 4A5MA 2XF5A 3FKJA 3C2HA 3EDPA 3HG9A 3O6BB 2OPTA 2C6CA 2F4MB 5DEQA 4IKFA 4KSIA 4UFXA 1XN7A 4MHGA 2A4NA 3CPXA 4NGNA 3GUDA 4NHJA 1FLIA 9ANTA 2JUGA 2I5UA 5HOOA 2VC0A 4JXRA 4BY1J 2FE3A 2MLKA 3CJQB 1T2KA 2XF7A 3BCAA 4CXFA 4G9YA 2XEJA 3CUOA 3LA3A 1ARLA 4HOBA 4E8OA 2FD5A 2W57A 1OQYA 4ESJA 2ZELA 3MZYA 4GXHA 2F5VA 4M6XA 4Z6YA 2IXSA 4MY3A 4G7ZF 4A93J 1NSAA 2R5ZA 1CF7A 1CT0I 2OZGA 1KUVA 3UGLA 4PV6A 1OMUA 1IOIA 5HVGA 3S6GA 3CXQA 2QQAA 4A3IJ 4KUAA 1RNLA 2Q0YA 5KHDA 2Y75A 3OL3A 4E4HA 1G3WA 1B59A 3RNZA 3ROUA 3K4MA 1OCCH 4MFZA 2GREA 4E2AA 2WA0A 5D5XB 3W6KB 5DV5A 2Q4VA 2QSHX 4IK2A 1TKJA 1DS3I 1B6BA 4E70A 4H0EA 2E35A 4XN3A 4ENNA 2STWA 1A6QA 1XMAA 2JT1A 4NFRA 4NGRA 2PJ5A 2MC4A 2WB1N 1UB9A 4RN7A 2DMUA 2VIXA 1FOXA 2G3TA 1QZYA 3BPVA 3R4KA 1YW4A 4A3BJ 4PXEA 2MH9A 3S2HJ 4R6TA 1EJ9A 1TOTA 1F5TA 4R87A 4CGLA 3DSBA 5LEJA 2WWYA 1NG7A 5HLIA 3S3NA 1S7KA 4WWVA 4WWCA 5E1XA 1TQPA 2X1DA 2JPBA 5ELYA 2EINH 4H6ZA 2NAZA 4JXQA 3DLAA 3CT9A 3ZQFA 4EGZA 3S2DJ 4J3GA 3FMRA 1R1UA 1YYVA 1X4OA 2BY2A 1IXSB 1RPWA 2X6YA 1FTTA 2L9RA 1Z7KB 2CXAA 2Q51A 3PBBA 3EFAA 2L7FP 4QTRA 1YREA 1QVUA 2Q2EB 3O3KA 1RR8C 1H89C 3BR5A 2XGXA 3WTSC 4XPLA 4QBJA 2UWMA 1PUFA 3SJEA 3JRBA 2Y48A 1R3NA 3CDXA 2HC9A 3CDIA 1JGSA 1VKCA 3ZN0A 4G7HF 4YGOA 4B5OA 1OCRH 2BEIA 3B73A 5IV0A 3BP8A 3PNYA 2XAHA 4UVCA 2R93J 3RKYA 4B6ZA 1T0FC 4OMYA 2XRLA 3LWFA 4I99C 2O4HA 4A37A 4CYCA 3WE3A 5J1YA 4OIPF 5C4XJ 3BG7A 1CG2A 1QSNA 3IC1A 1BC7C 5JVGF 3CMAI 3CUQB 4E1RA 3GLLA 2F4OB 3OS1A 1P7IA 2LMDA 2FXAA 3IKVA 2JN6A 2DN0A 1FTZA 1FEXA 1VQ5I 2M8EA 1DE4C 2POKA 5GPAA 3D1NI 2E36A 1DU0A 3HUGA 5L3EA 5E8GA 3F8CA 1ULKA 3JRHA 4KUBA 3X2QH 4KOWA 4CH7A 2ATRA 1RKWA 3KFWX 4RUHA 3J81K 4L0ZB 1IRZA 1V1HA 3FVLA 3S1QJ 2YNCC 1FYKA 2ZCWA 4RAFA 4G94A 3RYPA 4NGSA 2EA4A 3MKZA 1SD6A 1SC7A 3HIFA 2ID6A 2M1BA 1SFKA 2FRHA 5HODA 1UVFA 4U7BA 2X9DA 2CWGA 4Y7NJ 5HDKA 1N71A 4NGMA 3BQYA 2KJBA 2Y30A 4LK0F 2J9RA 5H86A 5BWAB 1LUJB 1LR8A 2QM3A 5LRJA 1YQAA 3LNQA 3D67A 2P6SA 4PDKA 5LRKA 1QGPA 1K61A 4C2YA 3L09A 4CPAA 1IN7A 3ABUA 5AONA 1IJWC 4MHYA 2IVMA 1N13A 4JJXA 2Y0MA 1FBQA 4KLVA 1QMUA 5I4MA 5JGFA 2FNAA 4MFPA 1HDDC 2EFWA 3R9FA 2XGDA 3QPHA 1JJ6C 2QSFX 2W48A 3I58A 2Z3OA 2XVCA 1RIOH 3LSIA 2HXIA 1LNWA 3S32A 1J5YA 5LRSA 1K7UA 1QSTA 4MHNA 3FDYA 4C2ZA 4C30A 1S5KA 2B5GB 1FBSA 1U78A 2ISZA 1TIHA 3SEZA 3PJRA 3DEWA 1CGII 3RIRA 3BR3A 5FKOA 4R9MA 3H8FA 3OYHA 1NMTA 3OYCA 2DOFA 5LHHA 2BZTA 2LKPA 2AE6A 4M9XA 3N05A 4GCVA 2B58A 4OLLA 1D8JA 1G3TA 2IW5A 3B3WA 2Z1DA 3QQAA 3BT9A 1BI2A 4DIQA 4ZC3A 4V19K 3NFZA 2J5PA 2W82A 2CH0A 5IT3A 4CO8A 1SMTA 3CJTB 3SZPA 3OS2A 1MDMB 2V1NA 2WAQN 5GPCA 2CF4A 2H94A 2K27A 2LNBA 3WHCA 2PLYA 1R00A 4SGBI 5H20A 2Z10A 3VYRB 1GDTA 1P4XA 3OVOA 2N52A 1U6GA 5HNFA 4BQAA 1BW5A 3MGDA 2CNMA 3T5XA 2GLOA 3GW2A 2EA2A 5FGMA 3DLJA 2M0MA 2W85A 2E71A 1K4JA 2PJ2A 5ED4A 1F2OA 4WXDA 4BL0B 3KX2A 4A2ZA 2G9WA 4HDUA 1OYYA 1B72A 3F5BA 2E19A 4FASD 3U1DA 2UXNA 2DK5A 1WK4A 1LEBA 4X3RA 1V5FA 2LKSA 8CPAA 5HS9A 3DR6A 3I1UA 3IH3A 5E3NA 1P9QC 4S05A 3ASNH 4P5OA 1P4WA 4IJAA 1KA8A 2L4MA 5E3LA 5GADJ 3BJIA 2JDDA 2OVOA 2QBYB 2AQFA 1H9TA 2R7SA 2YSRA 5D4RA 4A38A 2ESHA 4FCYA 4PXDA 5FVJA 3VFZA 2FSRA 3L1PA 5HDGA 1BM9A 1FMWA 5KNLA 3HKZA 3CP8A 5DWMA 2PR8A 3H3ZA 2CW0F 4XK4A 3FXRA 4AWXB 4CS0B 4EFDA 4M72A 3P2HA 2VBZA 4L8AA 4UA3A 2QKLB 3KEOA 1K79A 1QNTA 2VL1A 2EZKA 5E1ZB 2XKOA 2OZUA 3FXMA 5E3MA 3DP7A 4U0WA 4YFXF 2DT5A 3JSPA 1X4SA 2DFIA 3HOWJ 4LIVA 2OTLI 4RI1A 3TL4X 5BPIA 4V2GA 4FTHA 4G1PA 5L3DA 2DOEA 1PPFI 2XAUA 2LBFB 4L5JA 2AJ6A 1PJUA 1CQTA 4PCQA 1G4DA 1IDZA 2NVUB 1MMGA 2DA6A 4ITVA 5KTCA 3BDDA 3KEYA 3I71A 2F2EA 2LLKA 1VNDA 3VWEA 2DMNA 4KT6A 1IIDA 3P5JA 1TW3A 2M8GX 1J9IA 2PBIA 3L2QA 1JXSA 2Z3LA 2DLLA 2ELJA 1GVJA 3DBLB 5CYVA 5DYMA 4Z2YA 3T8RA 3EQLF 5A2QZ 3BZ6A 4PJLA 1SGYI 4LD5A 5CPAA 3VSKA 2HTSA 4NSQA 5HVQC 2P5VA
chains in the Genus database with same CATH topology
3P2FA 3GFIA 5G21A 3DEUA 1O57A 2Z3PA 1KGSA 1W7PA 2G7HA 3FXUA 1QSOA 2BGCA 1WSUA 1Z1DA 4LB5A 3DXJF 1OMIA 4B14A 1T39A 2R1IA 3WGGA 5JFRA 5F1RA 2G7UA 3HTUA 3GYAA 2OH1A 1HW1A 2DPUA 4BHPA 2A69F 4EJUA 1ZO0A 4U0YA 2RVCA 1PUEE 2ZW6A 2GWRA 4O3MA 1TNSA 2VEZA 3D2MA 2HR3A 2P7VB 2K5TA 4KS9A 3KP4A 3LODA 1HW2A 2OD5A 2H6CA 1J75A 2VI7A 1L0CA 4Q4ZF 5HS7A 3L9FA 1O3QA 3P7NA 4ESFA 3TTHA 1M4IA 1BBYA 3B02A 4G8XA 1XSXA 1SD4A 5ILSA 4MI4A 3I53A 3K69A 3GKRA 4UNOA 5IT9Z 3CJNA 3ZZIA 1YFHA 3IL2A 2X0LA 2KIFA 5F47A 2O28A 2FL4A 5E1WA 1DUXC 1M4DA 5LHIA 2FF4A 2B4BA 2D1VA 3P9KA 4BH9A 4WK8F 3MQ0A 5L3GA 4YFKF 2LF8A 5FLXZ 2G0BA 3QB8A 4FD6A 2IA2A 5F46A 1U5TC 4AVCA 3V8IA 2D4PA 4B12A 1MJBA 5DCMB 2X7BA 3JVNA 5F48A 1Z05A 2QQBA 4LMYA 4M9SA 2R3SA 3REOA 4OIOF 3RPUA 1UFMA 4Q36A 2R8VA 4UV8A 4CGZA 2MA3A 3IWZA 2PQ8A 2CFXA 5DUIA 4OIQF 3NE7A 1WI9A 1KU3A 3OWCA 5TRDA 5JVTA 2LF7A 2GA2A 2EV5A 2R7FA 2F5IA 4L9NA 4H89A 3I4PA 4L0YB 5LHGA 3GO5A 4JD6A 4L9JA 3CXPA 2O8XA 5E8IA 4NQWA 4RAYA 2IA1A 3R9GA 2VC1A 4HZFA 3KP7A 2ZMEB 3R1KA 4MTDA 1Z4EA 4QUSA 4AVPA 1XE4A 2XROA 3FMQA 3BJ6A 3HHGA 4I7HA 1ZAOA 4I0AA 1GXQA 2DPDA 1P6RA 4HX7A 1S7FA 3MEXA 1YO5C 3FX3A 2ZW5A 3R0AA 2CO5A 3DFGA 3NRVA 1XMKA 5KK1A 3QP6A 4G7OF 1E17A 4HNYB 2B4DB 1RZ4A 4ESBA 1B1BA 3P9IA 3QU3A 4WXCA 5DCFA 1YLEA 1W5TA 3WG9A 4CAXA 4YIFA 4OINF 3WTVC 4HF2A 4OOIA 2HZTA 1Y9KA 4A0YA 2P5LC 1U5TB 4EJWA 2J8MA 1UFHA 2MLGA 5FFXA 1LEAA 3JW4A 4EMSA 4HV5A