1FY7A

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
273
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast Esa1 suggests a unified mechanism for catalysis and substrate binding by histone acetyltransferases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords ESA1 HISTONE ACETYLTRANSFERASE
total genus 81
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fy7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1fy7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1fy7A02
2E7WA 5HS7A 5A2QZ 3TT2A 2EFQA 4KFCA 1P0HA 5LBQA 3KP5A 4YGOA 4I49A 4EV0A 3CUOA 4ONUA 2WC2A 2A6EF 3GXOA 2K4BA 5L3EA 4KOWA 4AG9A 3T5XA 2EFNA 2E1CA 1Z91A 2LKPA 3QOPA 1QSNA 5HLIA 4Y15A 3D5LA 4BMHA 4KORA 3J80Z 4KOYA 2C6YA 5D5UB 4OU0A 2F5CA 1MJ9A 4M9SA 1IXCA 2WPWA 2DU9A 5JFRA 2FNAA 2ZXJA 4HV6A 3VFZA 4OOIA 3K1NA 2JDDA 1YQAA 3KP7A 3E97A 1ON0A 4IRIA 5FD5A 4HKFA 3ZMTA 1U2WA 4EJUA 5FD6A 3DPLC 3IKVA 3N7ZA 2G7UA 1OMIA 4JWPA 5F6FA 1YVOA 1KU9A 1G3YA 1Z9CA 3K2ZA 1KGSA 4U7BA 3JTHA 4YIIA 2Y48A 3F6VA 2CSOA 3MQ0A 4CAVA 1KU3A 5E1ZB 1OKRA 2R3SA 1TQMA 2A4NA 2HV2A 3FWEA 4IJAA 5LGTA 3HTSB 1B9MA 2FQ3A 1U5TA 1C0WA 2Q7BA 4BHCA 1UHMA 3WGGA 1ON2A 3F23A 3U2RA 3V8LA 1O3RA 3J81Z 4KZTA 4I02A 4N9IA 4YRHA 3W91A 3I58A 2PBIA 1TTYA 4EJWA 4PZJA 1FC3A 2DO7A 4QC6A 2LF7A 2XROA 3R1KA 4CXFA 1MGTA 5IV0A 2XAQA 2WPXA 2VQYA 2QWWA 2J5OA 4HQMA 2HGCA 1BO4A 2G3TA 2EFPA 3P7NA 2JSCA 1Y0UA 5LLQA 2V1DA 3I54A 1XSVA 4UV8A 1NE9A 4HF1A 1S7NA 2FCKA 1FBQA 1W7PD 3LA2A 1NSLA 4ESFA 4A5MA 1U3EM 3EQLF 3HRTA 1BJAA 3V8KA 4KLWA 1QZYA 1I21A 3HOTA 1S7FA 1R57A 3L2CA 4Y49C 5F1RA 3GY9A 1J9IA 2DQLA 1Z6TA 1DP7P 3RKYA 2J8MA 4U0WA 2IP2A 2L02A 5IB0A 4HX4A 1XEBA 3SFZA 1KYWA 1S6LA 1O57A 1U5TB 2O61A 5LHGA 3V4GA 4WF2A 4ZBGA 1HKQA 3S6FA 1IN7A 3DR8A 1U5TC 4MY0A 4QWQA 4ZZDA 2P6GA 2YX4A 4Q4ZF 3ZPLA 1JHHA 3HYIA 2AS5F 4UWIA 2K27A 4HX7A 3I3GA 3HRSA 5ILVA 4QVTA 3MFKA 2FIWA 3FXQA 2P8TA 3V7RA 1KUYA 1U6MA 4B5OA 3SHPA 2PR1A 1GHCA 3P9KA 3GWZA 3G3ZA 2GZWA 5FLXZ 2OQGA 2NNYA 3T0YA 1IB1E 2OH1A 3V8IA 4CYDA 1H9TA 1SMTA 4UA3A 3C7JA 3I4PA 1X3UA 2BBYA 2PG4A 3RTRA 2KIUA 5AONA 4ENMA 4LLLA 1LVAA 3SQNA 4WX9A 4PK2A 2HYFA 1J7KA 3FRMA 5CVUA 2JLMA 3GYAA 1XN7A 2NNNA 5DD4A 2G9WA 2VBZA 1PP7U 4WXDA 1EH8A 1O7LA 1CJWA 3L7WA 2R98A 5H6RA 4Q48A 2PSWA 2VXZA 3FM3A 2CW0F 1WI9A 4BQAA 2VT3A 4G7HF 1S8NA 4HDUA 2VODA 2HDCA 1ZREA 1FYMA 2FS5A 3ECHA 2AE6A 3IGRA 3GFLA 1O3SA 4FD7A 2HFHA 5EEHA 1NMTA 2RV8A 3G3SA 2G3AA 3MEXA 1YW8A 3GEZA 4TV7A 1QSTA 1L3LA 1FY7A 4XSXF 2FSWA 4FHTA 2G0BA 3E6DA 1W5TA 2AJ6A 1B87A 1O7FA 2KIMA 1IXSB 3F8FA 2Q04A 2XVCA 1XGNA 4IXAA 3ZMZA 4M72A 1YG2A 1FBSA 4K30A 2KRFA 4CRYB 1YGHA 1SD7A 2REFA 4R8HA 3TDZC 2VONA 1MDMB 1V3FA 4A5NA 4OAEA 3WTVC 4E8OA 4R87A 4U5YA 3C1DA 4CS0B 1RUOA 2DBBA 2K7LA 1LDKB 4RAZA 3WODF 2Z99A 1XGOA 3DF8A 4RS8A 2HZTA 3JSPA 2ETHA 3F22A 4AVBA 5H84A 4KMUX 1HSJA 2DAOA 3HHHA 2I79A 2TDXA 4KOVA 4A6EA 4RGXA 3FHZA 4HV5A 3DPTA 4GCVA 2ZNYA 5AIQA 4KUBA 3K1PA 3REOA 4LX9A 4MBUA 4MEYF 1IIDA 4II9A 1XIXA 1YVKA 3KFWX 2HQNA 3F3XA 1DUXC 1J2XA 2H5MA 3FYNA 2D4PA 1FP1D 2DQRA 4E0AA 3CXPA 1YREA 1TW3A 3N97A 2Z33A 4MI4A 2EA2A 1AOYA 1M4DA 1I12A 4HNYB 5L3GA 1R7JA 3OOPA 2B58A 3D3SA 4YFJA 1KQ8A 1Q2YA 3RKXA 5IT3A 2RN7A 3GVAA 3JTGA 2Q8KA 1S3JA 3PFIA 2M30A 5LEKA 5CVIA 3FXRA 1LDJA 1I1SA 1XGMA 2PLYA 3U9GA 1HKTA 3HIFA 2O6GE 3WE2A 1YLEA 4L0ZB 1D5VA 3MZYA 5HS8A 2HUZA 4OINF 3ZN1A 1JHFA 4P9FA 1S5KA 4LB5A 2O3FA 2YPRA 3WU1B 4EGZA 2VE9A 1Q2CA 3BJOA 1YS6A 2GANA 3PZJA 3BWGA 1BC8C 4I7HA 3BPVA 2A5YB 1F1ZA 1Z9UA 3NQOA 5JR3A 4L9NA 5TRDA 1BI1A 2EV5A 2XAJA 3IWFA 3LQRA 2Q4YA 1R1UA 1YO5C 2IVMA 3GFJA 2ADUA 5ICCA 3GUDA 3KP6A 1WRJA 5GCNA 2GIVA 2L4MA 5K5RA 3M8FA 5BPDA 2F5FA 5HDKA 1K6OA 4PDKA 1R5HA 4RGRA 4NHJA 3FF5A 2BGCA 4QBJA 5D8KB 4KMFA 1UB9A 1BIBA 2Q2EA 1QQIA 2Z3YA 2HWVA 2DXQA 1T98A 4BYYA 3BJAA 1IN6A 3TO7A 3PGPA 3I59B 3I0TA 4UWJA 5D4RA 3DV8A 1HW1A 2A6HF 4JK1X 2ZFWA 1BOBA 5FO5A 4IVNA 2BV6A 4MNUA 1MJBA 4I01A 2B4BA 2DPDA 3ZN0A 2ZCWA 2UXNA 2FE3A 3ML6A 3MAJA 4B5PB 1SD6A 3FXTA 1QPMA 4P55A 4WXHA 3LA3A 4CGZA 2M87A 3DR6A 2XASA 2JPBA 4KN4X 3MWMA 2QM3A 1RO5A 2CQKA 2XAHA 4E70A 1ZGJA 4RI1A 3VODA 2JT1A 1EH6A 2RDPA 2M5WA 2CFXA 1TIQA 2QZ8A 1U6GA 1FBUA 4M9XA 4A0ZA 4U7DA 4UNOA 3GLXA 3IRRA 2FF4A 1YK3A 4KOTA 1LEBA 1YYVA 2IL4A 3JSOA 2O28A 3SXNA 5C82A 2KKOA 2W84A 2PMHA 1WKMA 5IT9K 3BLNA 2DI3A 2PI0A 3EO4A 4EM0B 1R1VA 1WWXA 4G94A 4R79A 4LLNA 5L3FA 1JXSA 2OZUA 3KP4A 3CO6C 3DDDA 3F0AA 3H92A 3R61A 2IPQX 3ZQ7A 2ZW4A 2FT0A 2VC1A 3Q9VA 4S05A 1JE8A 1FP2A 4KVOE 4IPAA 2H94A 1QNTA 4OIPF 2HOEA 3K9TA 2DTRA 2DK5A 5D8LB 4MHGA 3GX4X 3TCVA 3ROUA 1YW9A 2OAZA 2VN2A 1WSUA 1S7OA 2FXFA 1I1DA 3FMSA 3M7GA 4MGRA 4U9ZA 1FX7A 3T8RA 2EFWA 4M73A 5LRSA 1IXRC 2ZMEB 3AAFA 5E20A 3FB3A 2B4DB 3JUWA 1VKCA 2BSWA 2VBWA 3KP2A 5J6XA 4BHBA 4FD5A 4PSWA 2DLLA 1R23A 2L54A 3F6OA 4D0PA 1VHSA 4N9HA 4M6XA 1P4NA 1Q2DA 3CXSA 2EJRA 4A0XA 4WK8F 3IC7A 2ZNZA 1Z4RA 1Y9WA 2EA4A 3I9SA 2ZJ2A 4H6UA 4KDPA 2Q0OA 1F4KA 2QENA 4JQFA 4HLYA 3R4KA 4AIHA 3KLNA 3TO6A 5JQ4A 4ZZLA 4ENKA 2L3DA 2QQBA 3RPUA 4L8AA 3BDDA 3LQQA 4LFUA 1G6NA 4Y13A 4FX4A 2B5GB 5BOXA 5IT9Z 3SXOA 1LRZA 4OLLA 3O2PE 3LFKA 1H9GA 3JAMZ 2LSOA 1P92A 4NCZA 4EMSA 4NQWA 4ENJA 1TNTA 2B0LA 1U8RA 3TKYA 3K69A 1KQ0A 1Z1DA 1M44A 3UY5A 4A12A 1WQ2A 4RB2C 1XSDA 2PDOA 4LMYA 1OPCA 2STWA 4XNHB 5CNPA 2J8RA 2NRAC 3KKWA 3G73A 4KIFA 4A0YA 4OIRF 2PEXA 5LGNA 2REEA 4LK0F 4HF0A 3C3WA 2XIGA 3QP5A 2R7DA 5HOOA 4R9MA 4HYEA 4YFXF 2XGXA 3F5BA 5E8GA 3W6SA 2GXGA 3U1DA 1IN5A 3GZ5A 2EV0A 5DCMA 4CAXA 4JXQA 1L0CA 3FM5A 5DDGA 3ZMSA 1VTNC 5LRRA 1XCBA 3M9AA 2P4WA 4FD6A 2VOPA 4LD5A 1T39A 2XAGA 5H86A 1GXPA 1H0MA 4HW0A 1ZRDA 2UWMA 3FIXA 1JGSA 3LSTA 3C18A 3EYYA 4ZYHA 2WTEA 4HAMA 3F8KA 3L00A 2LF8A 2A3SA 4HX8A 5FFXA 2FBHA 2PR8A 4AD9A 2QYOA 2HYGD 1W4MA 2HTSA 4UUVA 4BAYA 2P5VA 3Q9SA 3W6KB 2E1NA 4L9JA 3FX3A 4G6QA 1KU2A 1XF8A 1P4XA 1Z6RA 3R96A 3J80K 3FBUA 3QAHA 5JI6A 4AIJA 1BOAA 1U78A 1B59A 1HQCA 4S04A 1BI2A 3LA7A 4I09A 5DYMA 5HMNA 4BH9A 3SZPA 4PGGA 1ZLKA 3E5UA 2IT0A 3ULQB 1MK4A 4HNWB 3RIRA 2QLZA 5TJJA 4MTEA 5DUKA 3IRQA 1YS7A 4EM1A 3CTAA 1W5SA 1BI0A 4L9TA 2J8NA 3TOAA 5BMZA 3CUQA 1ZARA 2MC3A 3IL2A 2EWNA 4JBAA 5F49A 1XDSA 5LEJA 5KVRA 2FA5A 3TDUC 3T9YA 2ACJA 4NF1A 4HNXB 4F6AA 2OB0A 3HOSA 1K78A 2B3VA 3RYOA 2HQYA 3HSEA 1ZG1A 2OBPA 4H6ZA 2FL4A 1KQ9A 3RI4A 3TQNA 2V6CA 4IHSA 2YU3A 1P6RA 2VXKA 1V0CA 3M8EA 1YR0A 2PRBA 4LB6B 3R6SA 3W6JB 2F5DA 2QQ9A 2GQQA 3L9FA 5L3CA 2FOKA 5E1XA 1ZG3A 3KZYA 4MEXF 1R36A 2GXBA 5D5WB 5F48A 2QUFA 2VE8A 1MD0A 2ATRA 4O6JA 1ZN2A 3KETA 2Q4VA 1ON1A 1QGPA 1CF7A 3R0AA 4YIFA 1HBXG 1J4JA 2IA2A 4FX0A 2FU4A 3D2MA 4I0BA 2PMUA 2VBYA 3KLOA 1J59A 4OIOF 3S6GA 3R9EA 1ODDA 1I27A 3WTUC 1KUVA 4LUAA 5DWMA 1KZFA 4GO1A 4HQEA 2L4AA 2BEIA 2NYXA 3GFMA 3S6KA 3RKWA 3P9CA 1P4AA 2O8XA 5FLXK 1D8JA 2XV4S 4ETSA 1FT9A 1OYWA 2DFIA 1IN8A 1DPRA 1S7LA 4XSZF 5LHIA 2KJCA 2ZW7A 1R22A 2XRNA 3PQKA 1MJAA 2FIAA 4R1HA 4L5IA 3G8WA 1G4DA 1LQ1A 4RAYA 2CG4A 3T1BA 3J81K 3KP3A 1W7PA 3TTHA 5ICEA 3WTZA 3HRMA 2EVNA 4CRZB 5EBVA 2D1VA 4QB9A 3RPQA 1FSEA 1YFHA 4XPDB 3KZZA 4ZH4F 1R58A 2ARHA 2QBYB 2RC4A 4IF5A 3SHFA 2STTA 3PP9A 2Q0YA 3IKTA 1FOKA 1R00A 3ZZIA 4A2UA 1LB2A 3KCCA 2P6SA 4LGWA 1K4JA 4LG0A 2OQRA 1YLFA 3E5XA 1SQHA 1UHWA 5KK1A 2QMLA 2FMYA 4IRHA 4MQVA 1OYYA 3M1EA 3DXJF 2P6FA 2IRFG 2LNBA 2EUIA 4L9VA 4M71A 3V8JA 2ZPAA 5KTCA 3B8GA 5ERIA 3LD2A 2H6CA 2YSRA 1OR7A 2BEOA 2RNJA 3J7AO 1M4IA 3BP8A 1Z4EA 3R9FA 4I98B 4LK1F 2EK5A 4U88A 4MJ8A 3WU0A 3VB2A 5AIPA 3CLOA 4AB7A 3R60A 4UVAA 3CO7C 3LAJA 2R8VA 1QZZA 4RB0A 2HQRA 4QLCU 4UVBA 4R3KA 1HSTA 4KOUA 1KU7A 4LG0B 2ELHA 4L5JA 3N4MA 1S7KA 2H09A 1IN4A 2EFOA 3HRUA 2BUEA 2Y75A 2XKOA 3RYPA 2QBYA 3SXYA 4HLXA 4M3SA 2A61A 2R7HA 2CNMA 4EJVA 3BY6A 1IYKA 1RXTA 1W7PB 2A69F 1XMKA 2XKPA 1FNNA 2W24A 2COMA 2XAFA 1P4WA 2MA3A 1ZRFA 1HW5A 5CLSA 1O3QA 3B73A 3HSFA 1XE4A 1Y7RA 1BI3A 4OADA 1RUNA 2HEOA 1K79A 4XLNF 2Q44A 1SAXA 5DUIA 2VC0A 5HH1A 3GKRA 1S60A 1QSOA 4PSXA 1RI7A 1SFXA 2VI7A 5BPIA 3WTSC 3TFYA 4G9YA 3V7CA 3E3VA 2P0WA 3IWGA 3SZTA 1ZGAA 2IJLA 3ISPA 4P96A 1I5ZA 3TE4A 5J8FA 4G7ZF 2ESHA 1WWZA 2O0YA 5ED4A 4XPLA 3E0KA 3H3UA 2W57A 2MLKA 1FPQA 4KN7X 1P2FA 2JPCA 2NAZA 3P9IA 2K02A 2JRTA 3V7SA 1CF7B 4GGGA 4ESJA 1S3ZA 2HTJA 2OD5A 1ZH5A 4XRFA 3BJ7A 4XNHC 4F0YA 3QU3A 3D8PA 3ZMDA 1PUEE 5KTAA 3ERED 4IF4A 1ONVA 1XDUA 2OZHA 4WWCA 2JEVA 1TQIA 3R0JA 2EV6A 5L3BA 3TOBA 3Q5FA 3JVNA 1M1DA 1Z05A 1T2KA 1IW7F 3KEOA 5BS6A 4ORFA 4AVCA 2YR2A 2KIFA 4M9ZA 4EQQA 1F9NA 2HKOA 3WTXC 1J75A 4CDGA 4AG7A 2ZO4A 3ABUA 1O3TA 4UXNA 1K78B 2X0LA 2F2EA 5DV5A 2DPUA 4E2AA 1XGSA 2DT5A 5DEQA 1GHEA 1QSMA 3EYIA 3WG9A 3VWDA 1TQPA 2NS0A 2X4HA 3BPXA 5D4SA 4ON0A 2CYYA 1SMYF 3CUQB 2RKHA 1CGPA 3EFAA 3COAC 4EVIA 3EDPA 3K9UA 4HA8A 3RJPA 2K4JA 5H6QA 4NEXA 1PUAA 4CZZA 2VOOA 2RQPA 1IRGA 1E2XA 2ZKZA 1LEAA 4HOBA 4UBRA 1BM9A 4UVCA 3E5QA 1D8KA 3S2WA 2MH2A 4Z2YA 3I64A 1G3WA 2QECA 5LGUA 2W25A 2V1UA 4DQ2A 3ABTA 2JZYA 2H6BA 4YFNF 1GXQA 2G7HA 4AVAA 4EVYA 2RGVA 3JAMK 5FVJA 4BNCA 4R57A 1XMAA 3O6BB 2MD5A 1QSRA 2OZ6A 5HLGA 3QB8A 2HKXA 4RB1A 4IRGA 1HXDA 2DW4A 3WE3A 4ZYGA 1SFEA 4JJXA 3BJ6A 1YX0A 4ENNA 3TGNA 1SD5A 2VT2A 3KEQA 4MQ9F 2K5TA 4IHTA 4BHPA 2ZW5A 1S29A 4O5VA 1STZA 4PV6A 2UXXA 1QBJA 2ZXVA 1MZBA 2PN6A 3F8MA 1J5YA 2ESNA 5DCMB 4X5KA 1I6XA 4B8XA 2FRHA 5EC4A 3QPHA 3EY5A 5ISVA 5CVJA 2IW5A 1R1TA 3GFIA 3F8NA 4JLYA 5K1YA 5JHUA 2CWEA 2FNPA 3GO5A 4UV9A 2CNTA 2M1BA 3B02A 1AWCA 3NEUA 2VBQA 4KIGA 2KCWA 2VZZA 4J3GA 1IYLA 5K5OA 2P5KA 2QVOA 4L18B 4H0EA 1ZG5A 2I00A 1YIOA 2D1HA 2B5GA 2P6EA 6PAXA 1ULYA 1HKSA 4Q47A 2DK8A 4ZYEA 3OV8A 2P6TA 4DNCA 3ZJ0A 4A6DA 1RIOH 3D0SA 3CUQC 5E1WA 4U0YA 2KJBA 5D6FA 4HF2A 5F46A 1XMTA 3BJ8A 1SD4A 1IUYA 1T0FA 4NB5A 2BL1A 3F8CA 3DQVC 1T6SA 3JW4A 3ZP5A 3R9GA 4G7OF 2GE3A 3VOEA 3I5UA 3KE2A 5H20A 3GZ6A 2WWYA 3MCZA 4RGSA 3QP6A 2B4DA 1CM0A 3EUHA 2AXLA 3HSRA 4AVPA 2D45A 2ISZA 3DNSA 2ZMEA 4KVXA 3VEPA 4EJOA 3BOQA 4XPDC 1LNWA 3C26A 1SFUA 2IA0A 4KOXA 5I0CA 4PK3A 2M8EA 1ZLJA 5ICFA 1G3SA 2CY2A 2Z9OA 2GA1A 3OWCA 1MKMA 3QRFF 3WGIA 1S7AA 3BROA 4AWXB 3NE7A 5C88A 1PDNC 5J8CA 5D5VB 1IZ1A 3ECOA 3FXUA 3WTWC 3MZHA 3L09A 1B6BA 5HDGA 2RVCA 1REPC 1PP8F 2VBXA 4RB3C 1K7AA 3VWEA 4PCQA 3HTUA 1E17A 3D2PA 3O3KA 3DKWA 2FMLA 5A2QK 4WCGA 2XHKA 4JXRA 2ZW6A 2HR3A 1FSHA 1LDDA 3I53A 4MY3A 4F7ZA 3TO9A 4O3MA 3BZ6A 4Q5SF 2FBIA 5HVQC 3DSBA 2R1IA 3P2FA 2BYVE 1EH7A 4QUSA 4MHDA 1FWZA 2B3UA 3ZMUA 3HHGA 1UFHA 2IA1A 4FD4A 1KA8A 1IRFA 3GYHX 5JPHA 2QQAA 4U9YA 4CHUA 3GW2A 5HLHA 2VEZA 1KUXA 2FE7A 3F8BA 2GA2A 1BC7C 1FLIA 1OYIA 1TLHB 5HS9A 1Z7UA 1WK4A 4B5PA 3P2HA 1KYZA 1BIAA 5CVVA 1I1GA 4WXCA 1DPUA 4NXYA 5DWNA 4I0AA 2WV0A 4G8XA 4LJZF 4ESBA 2OZGA 3GF2A 2ISYA 2A68F 4G6DA 5ILUA 5D5XB 4GS4A 1FYLA 4R3LA 3K0LA 4KVME 1TW2A 2CGPA 2PQ8A 3DFGA 4KT5C 5IX3A 4ZYDA 1IF1A 1HW2A 2V79A 3I59A 3H3ZA 4L89A 4OMZA 4M85A 2JDCA 1GVJA 3WTYC 2F5IA 1F5TA 1XSXA 4KICA 4NSQA 4XBFA 5ILSA 3WGHA 5ICGA 4HZFA 3T8TA 2H27A 3EETA 2VZYA 3F72A 2FBKA 4YG2F 2R7FA 4EJTA 5FFZA 2Y0MA 3FZVA 1NHAA 1G3TA 4P5OA 2GAUA 4PGHA 4ASNA 4EGYA 2D4OA 1TBXA 2NMTA 3LWFA 1XCVA 2ZBKA 2F5EA 1PU9A 3CJNA 4P9UA 5F47A 3E6MA 4AIKA 1YW7A 2D2WA 1ZAOA 5FB2A 1B6AA 4GYIA 3EC4A 4GYGA 3I71A 2OA4A 3T90A 2MLGA 5FGMA 2MBFA 4FT8A 1EV7A 2PC1A 4XLPF 3W6XA 1UCRA 5HDNA 3FMQA 3NRVA 2FSRA 4IUSA 2L01A 4U0VA 1N71A 1T38A 1B4AA 5E96A 2OU2A 3IWZA 4JD6A 3WTTC 1LJ9A 4M74A 1BN5A 3DP7A 3EXNA 5DD8A 1BBYA 5E8IA 4KYWA 1J0RA 4HBLA 4K2EA 4UHTA 3ZMVA 4XPKA 3FNCA 2A07F 3CDHA 3LAPA 2K86A 5DCFA 3MGDA 4YFKF 1FYKA 4MTDA 2Z11A 1DDNA 2CNSA 2GWRA 2BE5F 3PQJA 4N0BA 3WR7A 4OMYA 3R95A 5E17F 4Y49B 1V4RA 1IICA 5KTDA 1USTA 3F21A 2Z0ZA 1M4GA 5K5QA 1Q1HA 5JVTA 3DEUA 5L3DA 4BXUA 2Z5UA 4L0YB 2MH9A 4H89A 4Y17A 2QIRA 4KA4A 5EEGA 1ZYRF 2O03A 2FEZA 2W85A 2XUBA 1D3YA 2CO5A 3QU6A 1L0OC 4KLVA 2P7VB 1RZ4A 3HUGA 3E6CC 1FZPB 2V9VA 4GXOA 2PFBA 4KOSA 2UZKA 4B09A 1IAWA 1R5GA 3RDIA 1Y9KA 1UFMA 1B1BA 1QO0D 4M6YA 3QPTA 2PJPA 5BQTA 4CICA 4KUMA 5F64A 4RGUA 4I2OA 4OIQF 1B9NA 5CVRA 3CXQA 4KNYA 2YX7A 1XD7A 1MDMA 4CAWA 2C27A 1OZPA 4EM2A 4CO8A 2P7CB 3IHUA 2FXAA 3H4QA 2JTVA 3S6HA 5CYVA 4HDVA 2X7BA 4LLGF 3ELKA 1ZRCA 2V1XA 2P5LC 2J5PA 4KUAA 1ZHFA 1YTYA 4RS2A 1RNLA 2LDUA 3FMRA 1XB4A 5CJ9A 3E6BA 2HS5A 1TNSA 2E7XA 2M45A 3LODA 3K1MA 5D6EA 5LHHA 4KIBA 1A04A 5E18F 2Z10A 2EB7A 1USSA 3RYRA
chains in the Genus database with same CATH superfamily
1DGWY 2E7WA 3V42A 1OJLA 5HS7A 2K40A 5A2QZ 2ME6A 3TT2A 4A31A 1W0UA 2EFQA 1K4TA 4KFCA 8CPAA 1P0HA 2QA4I 4A37A 5LBQA 5FUVA 1E3PA 3KP5A 3UEJA 4EATA 4YGOA 4I49A 4EV0A 2VUMJ 2IBDA 5C4JJ 1WVRA 3CUOA 2WC2A 3PNTA 3PJRA 2W0TA 2H1KA 4ONUA 1JI8A 3H9GA 3OL4A 5A27A 2A6EF 3GXOA 2K4BA 1D1CA 5L3EA 3OVOA 1LCPA 4KOWA 4AG9A 3T5XA 2EFNA 1YW6A 4NC6A 2E1CA 3KR5A 1Z91A 3RAMA 1N25A 2LKPA 4OC2A 3OXFA 4B44A 3IJ3A 3QOPA 1FNOA 3KQZA 1QSNA 5HLIA 4Y15A 3D5LA 4DJAA 5M3MJ 2LOOA 4BMHA 4KORA 3J80Z 2WY7Q 4KOYA 2C6YA 3OMYA 5D5UB 4OU0A 2OUMA 2F5CA 1MJ9A 2E36A 4M9SA 1IXCA 4FUUA 1RRJA 2EIJH 3OYAA 3B6AA 2RIJA 2WPWA 4P4JA 4UIBA 2K9SA 4D1QA 2BUSA 3R5AA 2DU9A 5JFRA 3SI1A 2FNAA 2ZXJA 2JRMA 3HXLA 4HV6A 3VFZA 2BY0A 3SGBI 3VYTB 4OOIA 5EMIA 4ZDLA 1ZLIA 3K1NA 2JDDA 1YQAA 3KP7A 1LR7A 3H35A 3E97A 1V1HA 2KDOA 4P4BA 1TWCJ 4UXJA 2BY1A 1ON0A 1YMEA 4IRIA 5FD5A 4HKFA 3ZMTA 3SZGA 1U2WA 4EJUA 2PJ0A 1CT4I 3WABA 3BTIA 3TL4X 3DPLC 3IKVA 5FD6A 4MFEA 3QODA 3N7ZA 1HA8A 5EX3A 2G7UA 2F7VA 1OMIA 1NH3A 2RFHA 4JWPA 3B3VA 1JKQC 1YU6C 5F6FA 1YJNI 2E2IJ 1YVOA 1KU9A 4IOAF 3FVLA 3A2KA 1G3YA 1KBEA 1ZO0A 1Z9CA 1R43A 1GT0C 3K2ZA 4XLAA 1DS3I 1KGSA 4U7BA 3FSXA 3JTHA 4JOMA 4JYWA 2DYSH 4YIIA 2Y48A 4PJ0C 3OYMA 5M5YJ 4A3IJ 1X12A 1XS9A 3F6VA 2CSOA 3MQ0A 4ZYAA 4CAVA 1KU3A 5E1ZB 1OKRA 1OCPA 3CCMI 4QPQA 2R3SA 5EYRA 1TQMA 3LFUA 2A4NA 3DCFA 2HV2A 3FMCA 3FWEA 4IJAA 1WCMJ 1VQ6I 3AL0C 5LGTA 3E0JB 1PTRA 1Y1WJ 4FWUA 3HTSB 3GOXA 1B9MA 2FQ3A 3EUAA 1RC9A 3FISA 4XRSG 1U5TA 3FHNA 4XNFA 4ZDPA 3CCSI 2PJRB 4ZY1A 4A39A 4NNJA 1C0WA 2Q7BA 4BHCA 4R8FA 1UHMA 3WGGA 5G21A 1IDYA 4B1RA 1ON2A 2L5QA 3F23A 2LB7A 1F2OA 3U2RA 3V8LA 4F9VA 1IV6A 1O3RA 2B7EA 2MW8A 3J81Z 3DU5A 4KZTA 4DOZA 4I02A 2B63J 4N9IA 4A3FJ 3ZR8X 3K7AJ 4YRHA 3A03A 3W91A 3I58A 2PBIA 1TTYA 4EJWA 4PZJA 1FC3A 1SFKA 4OC5A 5E3LA 2NVXJ 2DO7A 4H2KA 4QC6A 2ZJQF 2LF7A 2ZSIB 4NGQA 4BQOA 3U1KA 2XROA 3S1MJ 4HSRA 3R1KA 4CXFA 1MGTA 5IV0A 2XAQA 1TKFA 2WPXA 2V4JC 2EINH 3HC7A 1UVGA 1WTJA 2EQRA 2VQYA 2VQHA 1U9NA 1JTXA 2QWWA 4DZPA 1YW4A 2J5OA 4HQMA 2HVSA 1TF9A 6CPAA 1OCZH 2HGCA 1BO4A 1P9QC 2G3TA 4A95A 2VB6A 2RAEA 2DCEA 2EFPA 3P7NA 2OCCH 1ZK8A 2JSCA 1Y0UA 1IRXA 5LLQA 2CMPA 2V1DA 2H1LA 4V2GA 3I54A 3S1NJ 3L1PA 3I4NJ 2WB1A 1XSVA 2RQQA 4UV8A 1NE9A 2CUZA 3R5BA 4HF1A 3FX6A 1S7NA 4CPAA 2J87A 2DT6A 3H5RA 1FBQA 1TKJA 2FCKA 3PB9X 1W7PD 3LA2A 2Z2SB 4ESFA 4A5MA 1NSLA 4M3GA 2LP0A 1U3EM 3EQLF 3CPAA 3HRTA 1BJAA 3V8KA 5CBMA 3PDNA 2CFOA 4BACA 4KLWA 1QZYA 4NBQA 1W0TA 1I21A 2XF6A 3HOTA 1X3ZB 3BHXA 1S7FA 5C4XJ 1R57A 3L2CA 1TT5B 2ZENA 1CHOI 4Y49C 1H8AC 1T33A 5F1RA 3GY9A 2HI3A 2DQLA 1J9IA 1Z6TA 2XGDA 3HBLA 1DP7P 4OIWA 2XAUA 3JRHA 3RKYA 2JUGA 1EJ9A 4ANJA 1G2HA 2J8MA 5LYLA 4U0WA 2IP2A 4CYQA 3G1LA 2L02A 1X10A 1NG7A 3V7ZA 5IB0A 4HX4A 3CCRI 1XEBA 1V54H 1ZKGA 3BCBA 3SFZA 1KYWA 2R7SA 5HVHA 2DMUA 1S6LA 5FUWA 3HOWJ 3CJQB 1O57A 1U5TB 2PJRA 1ZQ3P 1H0ZA 5BWAB 1NTCA 2O61A 5LHGA 3V4GA 4WF2A 2R93J 2L8EA 3UGLA 2QYVA 1HKQA 4A3LJ 4ZBGA 4HPQA 3F0CA 3S6FA 5EF6A 1IN7A 2XEJA 3DR8A 4M6IA 1U5TC 5CQEA 4MY0A 4QWQA 3E59A 4ZZDA 2P6GA 3LNQA 2YX4A 4P4DA 1OCCH 2I10A 2E1MB 3D67A 4C2YA 4Q4ZF 2M7AA 1V1IA 1X58A 3OIQA 3ZPLA 1Z8LA 1VZ0A 1JHHA 3CC7I 3OR2C 2EILH 1G8XA 3B35A 5JLXA 3HYIA 3G6EI 4MHPA 2AS5F 4UWIA 2K27A 4HX7A 1Y0RA 4CGNA 3I3GA 3U21A 3ERMA 4HRIA 3HRSA 5ILVA 4QVTA 3MFKA 1FOXA 2FIWA 1RKWA 3FXQA 2P8TA 3V7RA 1KUYA 1U6MA 4B5OA 4CGMA 1VGYA 3SHPA 2PR1A 2R7ZJ 2NSMA 1MBFA 3BTJA 1GHCA 3P9KA 3GWZA 4XM3A 4RDUA 3G3ZA 3RZDJ 1VF9A 2JXDA 1Z7KB 1OMUA 2GZWA 5FLXZ 2OQGA 2NNYA 3T0YA 4ZY2A 2HXOA 1BA5A 1IB1E 3CP2A 5FKNA 2LY1A 5FRNA 4AYBN 4CYDA 1SMTA 1H9TA 2OH1A 2Z3LA 4UA3A 3C7JA 3I4PA 5IYBJ 1I39A 3ZQGA 1X3UA 2BBYA 2PG4A 3RTRA 2KIUA 1P7IA 2PJ5A 1DQUA 5AONA 3R5CA 4MMOA 4ENMA 4LLLA 1HC8A 1LVAA 3SQNA 5F27A 4CH7A 1I6HJ 4WX9A 1PJUA 3CJTB 4PK2A 4DJLA 2HYFA 1LR9A 2MG4A 3IU1A 1WJBA 1J7KA 3K2KA 3OL3A 2DA5A 3FRMA 5CVUA 2JLMA 3S3MA 3MZ8A 2N52A 4X1EA 2Z3KA 2VJ4A 3GYAA 1XN7A 2NNNA 2BHZA 2OV7A 5DD4A 2ZELA 2WADA 3O8HA 2G9WA 2VBZA 1PP7U 4WXDA 3SYTA 4F3QA 1EH8A 1SVMA 1XPXA 4B6DA 1O7LA 1CJWA 2YNEA 4X8IA 3JREA 3L7WA 5HI7A 4B3AA 3SDGA 2R98A 5H6RA 2DJIA 3OR1C 2DPSA 3KYDB 5THWA 4Q48A 3OS0A 3OYGA 2VXZA 4E1PA 2PSWA 2F6CA 3FM3A 1OCTC 2CW0F 2P81A 3K6GA 1WI9A 4BQAA 2VT3A 1E3OC 4G7HF 1SGQI 3QOEA 1S8NA 4HDUA 3K4LA 2VODA 1K83J 1VQNI 3OS2A 1FYBA 3H9JA 2HDCA 1ZREA 3CDIA 1FYMA 2KZVA 2FS5A 3ECHA 3F9KA 2AE6A 2JZMA 1R5ID 2LLKA 4MFPA 3IGRA 3GFLA 1O3SA 4FD7A 2HOAA 3RQ4A 3GCMA 4XORA 2CV1A 2HFHA 2MSYA 5EEHA 3CCQI 2CV2A 3M3YJ 1NMTA 2RV8A 3G3SA 4KSFA 2IQ6A 5M5WJ 2G3AA 4FE4A 2KZGA 3MEXA 4DUKA 1YW8A 4H4KC 3GEZA 3H8FA 2VPLA 4TV7A 1QSTA 5HVFA 3UOEA 1L3LA 1FY7A 1PJRA 4XSXF 2FSWA 4FHTA 2GXAA 2G0BA 2KMRA 3OIPA 4RAGA 3E6DA 1F2PA 4IEJA 1W5TA 2AJ6A 2DA4A 1VQ4I 1B87A 1O7FA 3GTLJ 4XONA 3L2RA 2KIMA 1IXSB 1H89C 3F8FA 4XQFA 2Q04A 1YITI 1YOVB 4AVZA 4ZX8A 5TGTA 4CGLA 2XVCA 1XGNA 2R0QC 1JKPC 4IXAA 4JX4A 5E3OA 3ZMZA 3CMMA 4M72A 1YG2A 1N78A 2IS4A 3BJIA 1PTQA 1FBSA 3LSRA 4K30A 4XKWA 1MMSA 2KRFA 4CRYB 3CT9A 1YGHA 1SD7A 2REFA 2CU7A 4R8HA 3GB0A 1R6RA 1IY5A 1FARA 3TDZC 2VONA 1MDMB 5I4MA 1V3FA 3E1SA 2BZTA 4A5NA 4OAEA 4Z65A 3WTVC 4A24A 4E8OA 4R87A 4OKOA 4U5YA 3C1DA 4CS0B 2L9SA 1RUOA 5CKTA 4CYNA 2DBBA 2L0KA 2NS7A 4UB8C 3CF2A 5IB9A 2K7LA 1LDKB 4RAZA 3WODF 2CW7A 1ENHA 2Z16A 2Z99A 1XGOA 3DF8A 2O5RA 2H8WA 2HZTA 4RS8A 2RB7A 1W5CC 3JSPA 2ETHA 3F22A 4FBEA 4OWRB 3NH4A 2MFZA 4AVBA 2LKSA 2XPWA 2HYJA 2CQNA 3BG6A 4IOCF 5H84A 3JTKA 4UUTA 4KMUX 1HSJA 2DAOA 3HHHA 4EMEA 5HODA 1K7TA 4P44A 2I79A 2TDXA 4KOVA 4A6EA 4RGXA 5C3EJ 1PVEA 2FD5A 3FHZA 4HV5A 3DPTA 2X6XA 4GCVA 2ZNYA 2KPMA 5AIQA 4KUBA 3B7IA 1TWGJ 3K1PA 3REOA 3T8WA 4W97A 4LX9A 3AG3H 3HUGB 4MBUA 4OC4A 4MEYF 3SJXA 1IIDA 2HB6A 1XIXA 2PJ9A 2GVIA 1X1CA 4II9A 2K3FA 3B3WA 2BOLA 2ZEMA 2DA6A 3KFWX 2HQNA 1YVKA 3F3XA 5LRJA 5AG4A 1DUXC 1J2XA 3BI0A 1CPXA 2H5MA 4C30A 2AO9A 4BQQA 4A93J 3FYNA 2EBIA 4MXUA 2D4PA 4UF4A 1FP1D 2DQRA 4E0AA 2Z1DA 1MSFC 3RPUD 2ENZA 1YREA 3CXPA 3M4OJ 1TW3A 2L9VA 3N97A 2Z33A 4MI4A 3H5NA 2EA2A 3Q3SA 4A3KJ 5B5EC 1AOYA 1M4DA 1I12A 3ISZA 4HNYB 5L3GA 1R7JA 3OOPA 2B58A 3S1RJ 1F57A 3D3SA 2CW8A 4YFJA 3PFOA 3PFEA 1KQ8A 2K9QA 2EK8A 1Q2YA 3RKXA 5IT3A 5IOZA 2RN7A 3GVAA 3HEFA 3JTGA 3UGDA 3HDDA 2Q8KA 3IO1A 3ABMH 1Z8WA 2ODFA 3BTLA 1S3JA 1TOTA 2DF5A 3PFIA 5FKOA 2M30A 5LEKA 3KY9A 2ZFUA 5CVIA 3FXRA 4DBQA 1GV2A 1LDJA 2ELKA 2YS9A 1I1SA 4UY8I 1XGMA 2PLYA 3U9GA 4PXBA 2AHQA 4HSTA 2A20A 2PX9A 2DXIA 3MKWB 1HKTA 3HIFA 2X6WA 2O6GE 3WE2A 1BPMA 2SGDI 1YLEA 3FXMA 3KHXA 4L0ZB 1D5VA 3MZYA 5HS8A 9ANTA 4ZY0A 3CJRB 2CQ7A 2HUZA 1YRNB 4OINF 5E3MA 4P4FA 3H1CA 3VH9A 3ZN1A 1JHFA 3MKZA 2CWGA 4P9FA 1AYEA 4ZI6A 3VYRB 2BO9A 1S5KA 2LBFA 4LB5A 2O3FA 3MRUA 2YPRA 1A5JA 3WC5A 3WU1B 4PFOA 2EZKA 2DA2A 2X1CA 2QGUA 4EGZA 4YU9A 4LQGA 2CS3A 2EIMH 2VE9A 2PJ4A 5LRKA 3TBIA 2BXYA 1Q2CA 2OTLI 3J7YJ 4IHMA 3BJOA 1YS6A 3NAUA 1VQLI 2KT0A 2W1OA 2GANA 3PZJA 3JRIA 1W1WE 1WKXA 2PMZN 3BWGA 4Q7AA 1HDPA 2L7MP 4GDFA 2LFBA 1TIHA 2EBJA 4QPOA 1BC8C 1UELB 4I7HA 1AHDP 3BPVA 1K6YA 2A5YB 1F1ZA 1Z9UA 4P4EA 1T08B 3NQOA 4RMNA 3HOUJ 5JR3A 4L9NA 3GLLA 1BI1A 2EV5A 2XAJA 3IWFA 3LQRA 5TRDA 2Q4YA 1V5EA 1R1UA 3LOCA 2IVMA 3GFJA 1BR1A 1YO5C 2ADUA 2XF7A 3GUDA 2HDWA 5ICCA 3KP6A 1X1DA 2R7VA 4NGNA 4A3GJ 1WRJA 4HEA2 1M8CA 5GCNA 2GIVA 2JUCA 2L4MA 3S2HJ 2R7OA 1ETQA 5JLWA 5K5RA 2OD1A 3M8FA 5HXDA 2DOFA 1YHQI 5F09A 3FC3A 3S9LA 5BPDA 5HLTA 1D0ZA 2DODA 2F5FA 1VDDA 4D7MA 4DIQA 1VQOI 3BR2A 5HDKA 5IOYA 4CGPA 5CQGA 1K6OA 1WH5A 4PDKA 2LVSA 1XC5A 2IS6A 1R5HA 1YE9A 2P6AC 1RTQA 4RGRA 4M3EA 1GVDA 4NHJA 2JA5J 3FF5A 5FLMJ 2BGCA 2XGCA 3CP8A 4C3IJ 1UUCA 2Y69H 5D8KB 4KMFA 4QBJA 1UB9A 2V8GA 1BIBA 2M7BA 2Q2EA 4A3CJ 1Y0YA 3NARA 1QQIA 2Z3YA 2HWVA 3PBBA 3W6VA 2ODDA 3FECA 2F48A 1HCRA 3BR1A 4XN0A 2DXQA 1T98A 4LIVA 4BYYA 3CMYA 3BJAA 1IN6A 3RSNA 1LE8A 1UJ8A 2DMTA 3TO7A 3H5ZA 3PGPA 1R4MB 1S5LC 3I59B 3I0TA 3VSLA 4UWJA 3ZQCA 3IH3A 5D4RA 4B10A 3H0DA 2NOGA 3DV8A 3FEDA 1HW1A 4MFJA 3L2WA 2ECBA 2A6HF 4EEFG 4JK1X 5CPRB 2ZFWA 4QTRA 1XA6A 1BOBA 4FISA 2JBKA 5FO5A 4IVNA 1ULMA 2BV6A 1JTYA 4MNUA 1MJBA 2Q1ZB 4BJ6C 4I01A 2B4BA 2QSGX 2DPDA 2WAQA 2EPFA 3UFFA 3SDBA 2KIQA 2PJ3A 3ZN0A 2ZCWA 2UXNA 4ZGYB 2FE3A 1IUFA 5K8PA 3ML6A 2JVGA 3MAJA 1FJLA 4L9MA 3UKGA 4OVOA 3D4UA 4B5PB 1SD6A 4A3DJ 2MABA 3LWUA 3BT9A 4RLFA 2X6OA 3FXTA 1QPMA 4P55A 2GOXB 5FKLA 1KMAA 4WXHA 3LA3A 4CGZA 2LY2A 2M87A 3GTOJ 5AG5A 3DR6A 4JZ0A 2XASA 1ETYA 3K4JA 2JPBA 4NDLA 4KN4X 1WPKA 3MWMA 5JHFA 5JHWC 1Y0NA 2QM3A 1RO5A 2CQKA 2XAHA 3IC1A 4E70A 3H36A 4CYOA 1ZGJA 2OJED 4RI1A 2HC9A 3VODA 2JT1A 1EH6A 1HDUA 2RDPA 1AMPA 2M5WA 2CFXA 1TIQA 2QZ8A 1U6GA 2LRDA 1FBUA 4M9XA 4A0ZA 1SEUA 2JVHA 4U7DA 4UNOA 1QZEA 2VJJA 3GLXA 2NYQA 4J19A 4II2A 3IRRA 2PDOA 2FF4A 1B72B 2L9RA 1YK3A 4KOTA 3K2AA 1LEBA 2YU9J 2GFQA 1YYVA 3QQAA 2IL4A 5CCLA 3JSOA 2O28A 3SXNA 5C82A 4MHYA 2ZXHA 2KKOA 2W84A 3FJUA 3GTJJ 2PMHA 1WKMA 5IT9K 3IEHA 2IS2A 2EH3A 4NC8A 2GREA 3BLNA 4CA0A 2DI3A 2PI0A 5F08A 1W36C 4EM0B 1R1VA 3EO4A 4OAYA 4UXHA 3QNVA 1WWXA 1M1EB 4G94A 4IQ4A 4R79A 4LLNA 3VARA 5K8OA 5L3FA 3IWWA 1U0JA 3D66A 3KQXA 1JXSA 3I3LA 2R5ZB 2OZUA 5K8MA 3KP4A 5B66C 3CO6C 3DDDA 3F0AA 3H92A 3R61A 2IEKA 2IPQX 3ZQ7A 4ZTJA 2ZW4A 1X3WB 2FOWA 2FT0A 2VC1A 3Q9VA 2E71A 4S05A 1XMXA 2HQAA 1M4LA 3S9MA 2DFHA 5AG6A 1JE8A 5F0HA 5EGOA 1PUFB 1FP2A 2PMZA 3QWPA 1T56A 4KVOE 4A3MJ 4IPAA 1MH4A 2H94A 4UCNA 1QNTA 4OIPF 4E7SA 2HOEA 2Q7SA 3A9LA 3D1NI 2V26A 2ELJA 1MNEA 5TISC 5IYDJ 3E7LA 3K9TA 2DTRA 4X6AJ 1IC8A 2DK5A 2Q4ZA 2K9HA 5D8LB 1ETKA 3J7ZI 1LR8A 4K3NA 2ZOFA 4MHGA 2K85A 3GX4X 3NFZA 4GFBA 3ROUA 4XRSA 2O4HA 3TCVA 1YW9A 1SC7A 4B13A 2OAZA 2ZEOA 1OLTA 2XPUA 1JJ8C 4KSAA 2ID6A 2VN2A 4B43A 1WSUA 1S7OA 4FQGA 3RU0A 1RETA 4PJMA 1I1DA 4MO7A 2FXFA 2FJ1A 3FMSA 1A6QA 3M7GA 1TC3C 4MGRA 4U9ZA 3W3CA 4BQNA 1FX7A 2HXIA 3T8RA 2CWHA 4MLOA 2EFWA 5E79C 4TWEA 4M73A 1IXRC 2JMWA 2ZMEB 5LRSA 2XEGA 3AAFA 2ARPF 5E20A 5M3FJ 2IJZA 3FB3A 3HUVA 2B4DB 2MGQA 3N05A 3PIOF 4FAIA 3JUWA 1VKCA 2BSWA 2VBWA 2IGKA 3KP2A 5J6XA 4BHBA 4BXFA 3CCJI 4E7KA 4FD5A 3S9NA 4C2MJ 3FDYA 2BVMA 1LANA 3LSMA 4PSWA 1YX5A 1MBEA 1DU0A 2DLLA 3FH4A 2ZC2A 1R23A 2L54A 3F6OA 4D0PA 3FXJA 1B8IA 2NXNB 4N9HA 3GTPJ 4M6XA 1VHSA 3DGVA 3CMEI 2E19A 1P4NA 1Q2DA 1GYTA 4EFDA 1MBKA 3CXSA 1JGGA 4V19K 2EJRA 4XN3A 1V5GA 4A0XA 4Y52J 4WK8F 4G1PA 3IC7A 2HQ5A 1T0FC 4LIUA 2ZNZA 1Z4RA 4I76A 1W36D 1Y9WA 2EA4A 3BCAA 3DPUA 2ZJ2A 3SJMA 2VRWB 3I9SA 1ULKA 3IFEA 4H6UA 4OC0A 4KDPA 3B2YA 1LOKA 2Q0OA 1ETWA 1F4KA 2DEAA 2QENA 4JQFA 4HLYA 3R4KA 4AIHA 3KLNA 3TO6A 4B4CA 4C2TA 4ZZLA 1XG1A 2GIZA 4PK4A 4ENKA 2L3DA 4MCSA 5JQ4A 1EKEA 2QQBA 3RPUA 4L8AA 1FTZA 3BDDA 3CZ6A 2Z3MA 3LQQA 4LFUA 1G6NA 1O4XA 3RCOA 2M8GX 1DGRM 4Y13A 2E5NA 2NS8A 4PJLA 1ZR4A 3FBIB 2L2OA 4FX4A 2B5GB 3JRUA 2WA0A 5BOXA 5IT9Z 3SXOA 1LRZA 4NGRA 2Y9YA 3K70D 2PIZA 4OLLA 3S16J 2C6CA 3O2PE 1Y6IA 2Q51A 3LFKA 1REPC 2E5RA 1H9GA 3JAMZ 2LSOA 1P92A 3HGGA 2NVYJ 3MEKA 4OP4A 4NCZA 4CCLA 4EMSA 1VQMI 4NQWA 4ENJA 1TNTA 3NE8A 2B0LA 1U8RA 3TKYA 3K69A 4UEZA 1KQ0A 5FJ8J 1Z1DA 5FKKA 1M44A 1TXRA 3AFHA 2OOTA 3UY5A 4A12A 2VKEA 1WQ2A 2JN6A 4RB2C 3C2HA 5EJCA 4CCOA 1X1AA 4XL9A 1XSDA 3JRCA 3HOZJ 4LMYA 1OPCA 2STWA 2JBJA 3FK7A 4XNHB 5CNPA 1Y56A 2NRAC 2QSHX 2KISA 2J8RA 5HVGA 3KKWA 3G73A 3C2GA 5E3RA 1QHGA 4KIFA 4KISA 4A0YA 4OIRF 2PEXA 3JCUC 2EWBA 4UEEA 5LGNA 1WJEA 1Z3XA 2DTZA 4LK0F 4IKFA 4HF0A 4XOPA 2JA1A 2REEA 3C3WA 2CF4A 2XIGA 2B0UC 3CPXA 3QP5A 1OISA 4LITA 2R7DA 5HNHA 5HOOA 4R9MA 1EE3P 4HYEA 4YFXF 2LTPA 2XGXA 5K7FA 5E8GA 3LSPA 1JKOC 1X4PA 2PIYA 2GXGA 3F5BA 3W6SA 3I1UA 2J9RA 3U1DA 1IN5A 3GZ5A 2EV0A 3MMYB 3PNVA 5J1UA 2GKRI 2G9DA 4NGPA 4UIAA 5DCMA 4CAXA 2W4SA 1L0CA 3FM5A 5DDGA 3ZMSA 3OYHA 1VTNC 5LRRA 1XCBA 4JXQA 3M9AA 2QQ8A 3QYFA 2P4WA 1CX8A 4FD6A 2DOEA 4QSHA 5EG0B 4CYCB 2VOPA 2ORVA 1YQEA 4LD5A 5EX0A 1HDQA 1T39A 2XAGA 4BJTA 5H86A 1A6IA 1GXPA 2GLJA 4RM2A 3OS1A 1H0MA 4HW0A 4BBRJ 1ZRDA 2V6EA 2EIKH 4WWVA 1ELMP 4CZCA 2UWMA 3FIXA 1JJ6C 1JGSA 1QVTA 1YTPA 1XJOA 1TWFJ 4JX5A 1VNDA 2F3CI 2PJ6A 3TW7A 3LSTA 3C18A 4BL0B 3D5SC 3EYYA 1FMWA 4ZYHA 2WTEA 1VQPI 1YI2I 4HAMA 3NH8A 4RM3A 3F8KA 2LYCA 3SJEA 3L00A 3O8GA 1SGRI 1VQ7I 2LF8A 1N75A 2A3SA 4HX8A 3SJFA 4MCRA 4YELA 5FFXA 4A3BJ 1MH3A 2FBHA 2W00A 5DTDA 4AD9A 2QYOA 3GMEA 2HYGD 1W4MA 2PR8A 4BKXA 3KX2A 4XMYA 2HTSA 4UUVA 4BAYA 2P5VA 3Q9SA 3W6KB 4DZJA 2R7TA 2E1NA 4L9JA 3FX3A 4G6QA 1KU2A 3HZJA 1BW6A 2GBYA 3MD2A 4Y7NJ 1XF8A 1P4XA 2OC6A 1Z6RA 3ZOBA 3R96A 4F92B 3J80K 2KRCA 3FBUA 3QAHA 2LK2A 5JI6A 2XGEA 1X4OA 4AIJA 7CPAA 1BOAA 1U78A 5KHDA 4J01A 4MPIA 2C6PA 1B59A 1HQCA 4OC3A 3FKJA 4S04A 1BI2A 1OCOH 3LA7A 4I09A 5DYMA 5H2FC 5HMNA 3H8EA 3CLQA 3SZPA 4BH9A 1SGEI 2YGWA 4PGGA 3KGQA 2BY3A 3A4CA 3CESA 3TW6A 1ZLKA 3E5UA 2L7ZA 2IT0A 2VJ5A 3ULQB 1PCEA 1MK4A 1UHSA 3IP4B 1JKRC 1VQ5I 1SGYI 3RIRA 3TEDA 4HNWB 3VDUA 2QLZA 5TJJA 4MTEA 3CDXA 2I5UA 4TNUA 2V9PA 5DUKA 2FNFX 3PB6X 4Q36A 4M6VA 1NG6A 4BJ5C 3IRQA 4UB6C 1YS7A 3K4MA 3LMMA 3R5DA 1QQ9A 1R3NA 4F8ZA 4UFXA 4EM1A 3CCLI 4OMEA 3CTAA 3WC6A 1W5SA 1VQ8I 5J3LA 5LYFA 1BI0A 1PYVA 4L9TA 2J8NA 3TOAA 1ACIA 4M6GA 3PM1A 3ABKH 4O23A 2LKXA 4IHWA 1P9GA 4UCMA 3ZQHA 5BMZA 2QCOA 3CUQA 1NUBA 1ZARA 2MC3A 3IL2A 5F0CA 2EWNA 1FIPA 3SGQI 1Z67A 5B1AH 2QQDA 4JBAA 4MHZA 1EF4A 2BW3A 2R5YB 5F49A 2V8HA 4OAZA 1XDSA 3D7DA 5LEJA 2JW6A 5KVRA 5J1RA 3H5AA 2FA5A 3G1MA 3TDUC 2OVOA 3GBGA 3T9YA 2ACJA 2XRCA 4NF1A 1CQTA 4HNXB 4BE1A 3OL0A 4MRIA 4F6AA 5ELYA 2OB0A 4A3EJ 3HOSA 1K78A 2B3VA 2KCXA 2DMNA 2NU1I 3RYOA 1V5FA 4SGBI 2HQYA 1Z0XA 4BY1J 3HSEA 1ZG1A 2OBPA 4H6ZA 3TP3A 2IXSA 2WAFA 2X9DA 3HOYJ 1CP6A 1BL0A 2FL4A 3CDLA 3KASA 3PB7X 1WJCA 5D8NA 2UZ3A 1KQ9A 3RI4A 2VQLA 4B47A 3TQNA 4OC1A 1MW7A 2V6CA 2YU3A 3OYEA 1P6RA 4IHSA 1X19A 3WU2C 3IU2A 1JWQA 4AMLA 4BUPA 2ZJPF 1V0CA 2J9AA 2VXKA 1F43A 2OF7A 3OYFA 1X1BA 3M8EA 1TBOA 1YR0A 3CCUI 1Y1CA 2XB0X 1TUSA 2KRHA 2PRBA 4IHVA 3G1OA 2CQQA 3PSIA 4LB6B 3W2AA 3R6SA 3W6JB 3PSFA 2F5DA 3OYNA 4YWYA 2QQ9A 1RFHA 2E35A 2GQQA 2G0EA 5DAEA 3ISXA 3L9FA 5L3CA 4Y3OA 2FOKA 5E1XA 1ZG3A 3QTLD 3KZYA 3EPZA 4MEXF 2XEIA 1I50J 1D1AA 4RBOA 1R36A 1POGA 3ASNH 2GXBA 5D5WB 5F48A 3ZQFA 2HU9A 2QUFA 1QA6A 2TCTA 2Y2ZA 2LY9A 1MD0A 2VE8A 3G4SI 3DTEA 2ATRA 5AGEA 4O6JA 1ZN2A 3KETA 2Q4VA 1ON1A 3S2DJ 1QGPA 2DDAA 1CF7A 2WYRA 3R0AA 3HM5A 1HEEA 5KCMA 1T8IA 3S1QJ 4YIFA 1HBXG 1J4JA 2Y30A 2IA2A 2IMOA 4FX0A 2FU4A 2N71A 4D5CA 4YRVA 3D2MA 3WT4A 4I0BA 1VI0A 2PMUA 4DYOA 2V8VA 2VBYA 3KLOA 1J59A 3JR9A 3VDPA 3SI0A 2VL8A 4OIOF 4BS9A 3S6GA 1W4RA 3R9EA 1D1BA 1ODDA 3DBLB 1I27A 2A05A 2K9MA 3WTUC 1KUVA 4LUAA 4MFDA 2IGOA 2JA2A 1S20A 1IW4A 5DWMA 4XR6A 1KZFA 2R7WA 4ZJZA 4A69C 1IGBA 1TKHA 4GO1A 4HQEA 2L4AA 2BEIA 2NYXA 3GFMA 4MFKA 3S6KA 2GU2A 2W7NA 5KNLA 3JRFA 3RKWA 2Z3NA 1ZG9A 2JYYA 3P9CA 5LYIA 1P4AA 2O8XA 5FLXK 4D9JA 1D8JA 4UUSA 4KS9A 2XV4S 4ETSA 2CQXA 1R9TJ 1XOVA 1FT9A 1OYWA 2DFIA 3OYIA 1IN8A 1DPRA 1UAAA 1S7LA 4N4NB 4XSZF 2XEFA 2GOMA 5LHIA 2KJCA 4BEHB 1R22A 2XRNA 3PQKA 1TURA 2ZW7A 1MJAA 2FIAA 2EZIA 4R1HA 3JRBA 4L5IA 1TL8A 2QQEA 1IY7A 3G8WA 5AG7A 1G4DA 2LEOA 5KAIC 2NU0I 1LQ1A 4RAYA 1FTTA 3KZIC 2CG4A 3ABLH 5K8NA 4W9YA 1UWYA 3T1BA 3J81K 3ZRGA 3OXGA 3HOXJ 4I6ZA 3KP3A 5GADJ 1W7PA 2O7OA 5DS9A 1ARMA 3TTHA 5ICEA 3WTZA 1S72I 2NOJB 3BR6A 3HRMA 2V53A 3FK6A 4KJZA 4Y4RA 1CE3A 2ERWA 2VKVA 2AQEA 3IAM2 2EVNA 2X3TA 5EBVA 4CRZB 1P9ZA 2D1VA 4QB9A 5K7ZA 3D7GA 2GKVA 1LVKA 3RPQA 3KHZA 1FSEA 3ASOH 1YFHA 4XPDB 3KZZA 4MIMA 4ZH4F 2CJSC 1R58A 4JCVE 2ARHA 3N5FA 2QBYB 2DYRH 2RC4A 1Z3YA 4IF5A 3SHFA 2STTA 3PP9A 2NU3I 2Q0YA 1OVOA 3IKTA 3VATA 2O8KA 2OCEA 1FOKA 1R00A 3ZZIA 1CT0I 4UFVA 4A2UA 5IP7J 2DN0A 4B48A 1LB2A 5G22A 4F0XA 3KCCA 2XB5A 2P6SA 3BXMA 4LGWA 4PJNA 4LG0A 1K4JA 2IGNA 2OQRA 4ZC3A 1YLFA 4PQAA 3E5XA 3A01A 1SQHA 2KMOA 3Q0WA 1AKHB 3BR3A 4UXIA 1UHWA 5KK1A 2QMLA 3B3CA 3K4BA 2FMYA 3CQZJ 1VQKI 3PO3J 4IRHA 4MQVA 4IHYA 1OYYA 3M1EA 2HOTA 3DXJF 2P6FA 2IRFG 2LNBA 3L2UA 2EUIA 4L9VA 4M71A 3V8JA 4ZTFA 2ZPAA 5KTCA 2LUYA 3B8GA 2C1CA 2ANPA 1OR7C 5ERIA 2H6CA 3A1YA 3M8JA 2YSRA 3CCVI 3LD2A 3PEIA 1OR7A 2BEOA 4R6TA 2RNJA 4F55A 3J7AO 1H8LA 1M4IA 3BP8A 1Z4EA 3R9FA 4I98B 2M3AA 2EK5A 4LK1F 4UEFA 1ETVA 4U88A 4E7HA 2R7QA 4MJ8A 3S3OA 3WU0A 3VB2A 5AIPA 3A02A 2WVJA 3CLOA 1U5KA 3R60A 4AB7A 2QF7A 4UVAA 1HLVA 3CO7C 3LAJA 2R8VA 1RESA 3PO2J 1QZZA 4RB0A 2HQRA 3DEEA 4AU7A 3MN2A 4QLCU 1AKHA 4UVBA 4R3KA 1HSTA 3A01B 4KOUA 2ZXWH 1KU7A 4LG0B 2ELHA 4L5JA 3S15J 1ZGWA 2QQ0A 4FKDA 5JGFA 2L9NA 3N4MA 1ITYA 2H09A 1S7KA 4LQ6A 5FUXA 2RREA 2KL4A 1IN4A 1CPSA 2EFOA 2CTCA 3HRUA 2VASA 2BUEA 2Y75A 3RO0A 2XKOA 3RYPA 2QBYA 3I9V2 3CZXA 1BJZA 3BQYA 2H8RA 3SXYA 4HLXA 4D5FA 4M3SA 2A61A 2R7HA 3LMSA 2CNMA 1A36A 2M4GA 2KQRA 4II3A 4EJVA 1MBGA 1LKXA 3BY6A 1OYVI 4PUSA 4C3JJ 1IYKA 1RXTA 4RAFA 1W7PB 2YNCA 2A69F 3D7HA 1ORKA 1XMKA 2XKPA 2X52A 2AFMA 1FNNA 5DM7F 2W24A 3WC7A 2COMA 2XAFA 3DKYA 1P4WA 1YJ9I 1SGDI 1R4NB 2MA3A 3WG7H 1ZRFA 3OYJA 1HW5A 3K4KA 5CLSA 1O3QA 1FAQA 2DB6A 1FOYA 3B73A 4XRMA 3SI2A 3QYEA 2RNGA 2JQ7A 3HSFA 1XE4A 1DE4C 2F5VA 4HNTA 1R49A 1Y7RA 2Z3PA 1BI3A 4S0HB 4BEHA 2ELIA 2BVLA 4OADA 2PJBA 9WGAA 1NSAA 1RUNA 2HEOA 2F4OB 2ZB9A 2E2HJ 3OIOA 1K79A 4XLNF 3L2NA 2Q44A 1FOWA 3K70C 4IO9F 5DUIA 1SAXA 4PXDA 4B6ZA 2VC0A 5HH1A 2M0CA 3GKRA 4UUSB 2AFXA 4FETA 1QSOA 4PSXA 1S60A 3DLJA 1RI7A 1Z7LA 1SFXA 3C2BA 1IDZA 2DPTA 2OR4A 2VI7A 5BPIA 3WTSC 1DTDA 4A32A 3TFYA 4XKCA 4G9YA 1VHEA 3BZKA 3V7CA 3E3VA 3LSIA 1MIJA 2P0WA 3IWGA 3LSHA 3SZTA 1ZGAA 2IJLA 3NWTA 5GAGJ 3ISPA 1LFWA 2R7RA 3BTCA 4P96A 1IO2A 1I5ZA 3TE4A 2O53A 2PRQA 1GV5A 5J8FA 2ESHA 4G7ZF 1WWZA 2O0YA 3ESWB 5ED4A 1X4SA 4XPLA 2A6TA 4CGOA 5EZGA 3CD6I 3E0KA 3H3UA 4E1RA 2YNCC 3FF3A 4OIDA 2E34A 2W57A 2MLKA 1FPQA 1K61A 3B3TA 4KN7X 1P2FA 4X0GA 3FIWA 2JPCA 2NAZA 3AKZA 3P9IA 4PJJA 2M9HA 2DJNA 2JRTA 2K02A 3MKYB 4C68A 3V7SA 1CF7B 2Y0SA 4JX6A 2E1MC 4GGGA 4ESJA 2PJ7A 3SEQA 3S32A 1UMQA 1S3ZA 4WP4A 5IY5H 2E60A 2HTJA 1E0EA 3TX8A 1WJDA 2OD5A 1ZH5A 2M4KA 4XRFA 1TT0A 4HNUA 2EO8A 3BJ7A 3QU3A 3D8PA 4XNHC 4F0YA 3ZMDA 1PUEE 5KTAA 2MD0A 3ERED 2XRLA 4IF4A 1ONVA 3OYLA 1VHOA 1XDUA 2OZHA 2UV1A 4WWCA 2JEVA 1TQIA 2ZEDA 3R0JA 1PYTB 1LUJB 2EV6A 5F04A 3H9QA 2Y0SN 5L3BA 4CCKA 4X3RA 3TOBA 3BLYA 4P4IA 1UVFA 3TC8A 3Q5FA 3JVNA 1M1DA 2VKHA 2BHYA 1TZLA 3GUXA 4E6KG 1Z05A 4Y33A 5F1JA 3QPSA 2PJ1A 5DS0A 3SEZA 4C2XA 1T2KA 1Z2IA 1IW7F 2ZEPA 5JM6A 3KEOA 5BS6A 4ORFA 4AVCA 2YR2A 2HVQA 3K10A 1WI3A 2KIFA 3BG7A 4C7IA 4M9ZA 2JWTA 4EQQA 1F9NA 1ZG7A 2HKOA 3WTXC 1WJFA 3V38A 4CDGA 1J75A 4AG7A 5J4YA 3KYLA 1Y1BA 2ZO4A 3ABUA 1O3TA 4UXNA 2SGQI 1K78B 2X0LA 3IH2A 2F2EA 2NVUB 4IX7A 2CTBA 5DV5A 2E73A 2DPUA 4E2AA 2DMPA 3HKZA 2PVVA 4RN7A 4XKVA 2QQCA 4NFRA 1XGSA 2HPMA 5A28A 2DT5A 3HJEA 5DEQA 2V1CC 1GHEA 3QYBA 3S3NA 2R5YA 3EYIA 2FX0A 2BW3B 1CP7A 1QSMA 3WG9A 2PJ8A 1WHUA 4F93B 3VWDA 1YIJI 3OYDA 5LD2C 1TQPA 2NS0A 2KMQA 2X4HA 3BPXA 5D4SA 2M34A 4ON0A 2CYYA 1SMYF 3CUQB 1CT2I 3TJQA 2RKHA 4XICA 1CGPA 3EFAA 3COAC 4EVIA 1SANA 3OYBA 3EDPA 3K9UA 4HA8A 3RJPA 5J40A 2K4JA 1Z8XA 4A30A 1PPFI 5H6QA 2WBMA 2K9LA 4NEXA 2QVPA 4EWTA 2V77A 4N4OB 2LD5A 5J47A 3S8PA 2AFSA 2WAQN 2V1NA 3DLLF 1IV8A 3IAS2 1PUAA 4CZZA 2VOOA 5HQ8A 2RQPA 1N77A 1JUSA 4UFWA 1IRGA 1E2XA 2DOAA 2ZKZA 1LEAA 3ZXSA 4BE0A 3E2IA 4HOBA 1XBUA 4GRIA 3BG3A 3OYKA 4U87A 3DU6A 2CH0A 2UUZA 3AG1H 2XSDC 1VIXA 4UBRA 4F52A 4IZZA 3G2BA 1IY6A 5M5XJ 4C2ZA 1BM9A 4UVCA 1CBXA 3FEEA 7WGAA 3E5QA 3PIPF 1D8KA 3AG4H 3S2WA 2MH2A 4Z2YA 3I64A 1G3WA 3P5JA 4FCYA 2QECA 1MBHA 4NGSA 2W25A 5LGUA 2NU2I 1WH7A 3TP0A 2V1UA 4DQ2A 3ABTA 2B9SA 2JZYA 4AYBA 2H6BA 3W2VA 4YFNF 5EZHA 2GLFA 1GXQA 2G7HA 4AVAA 2QJ8A 4EVYA 4UCPA 2RGVA 4NJRA 3JAMK 5FVJA 4BNCA 4R57A 1XMAA 2DDBA 3O6BB 2MD5A 1QSRA 2X1DA 2XDVA 1ZELA 2I8DA 2OZ6A 5HLGA 3QB8A 2MC4A 2HKXA 4RB1A 5BNGA 1XMBA 5G20A 4IRGA 1JUPA 3DBHB 1HXDA 1R0RI 2DW4A 3WE3A 4ZYGA 3MKLA 3HGYA 5GTHC 1SFEA 4J00A 4JJXA 5F0FA 3FXLA 4W1UA 5IP9J 3BJ6A 5FUYA 3IH4A 2ORWA 1YX0A 4G6TB 4ENNA 1FT7A 1BUSA 3TGNA 5FROA 1BR2A 1SD5A 2VT2A 3KEQA 4MQ9F 2K5TA 4IHTA 3D00A 4BHPA 1Q1VA 1WJAA 2PE3A 2ZW5A 1S29A 2XPVA 4O5VA 1STZA 2LH9A 4PV6A 2WZNA 2UXXA 3BZCA 2KMUA 2HNHA 2HDDA 2GM4A 4BD9A 4WJBA 4NUBA 1QBJA 1ERDA 1XFOA 4IL6C 4M3BA 1UG2A 1PCAA 2LREA 4JP0A 2ZXVA 2TRTA 2ENNA 3SJGA 4C7HA 4FE7A 2X85A 2DFFA 4CYCA 5EG0A 3NA6A 1MZBA 4CCMA 4FTHA 2PN6A 2ZEFA 3H0GJ 3H8GA 5B1BH 3F8MA 4ZYQA 1J5YA 2ESNA 5DCMB 4X5KA 5IP6A 2ZJRF 4AUXA 1I6XA 4B8XA 2IGMA 4E7LA 2FRHA 3GTGJ 3CC4I 3UGIA 5EC4A 3BQZA 3K4NA 2CUFA 2N8GA 3QPHA 3EY5A 5ISVA 2K3PA 5CVJA 4MFQA 2IW5A 4XIDA 5J4VA 2Z3OA 5HNFA 1R1TA 3GFIA 3KPHA 3AG2H 3LSGA 3EUHC 4XLFA 5JVGF 5IPAA 2CUEA 1K7VA 2QPOA 4NJQA 4CYPA 1MMNA 3F8NA 4JLYA 3VYUB 5JHUA 4AIDA 5K1YA 2CWEA 4B12A 2N17A 1WGXA 2FNPA 2QKMB 3GO5A 5K7HA 4UV9A 4G12A 4ZX9A 4CUGA 2CNTA 2JA7J 2YQPA 4AC0A 1H88C 5CCMA 2M1BA 1XRYA 3B02A 1AWCA 4CAEA 1AA7A 1Y39A 2KDZA 2EK9A 3UEYA 3NEUA 2VBQA 1X1PA 1TBRR 4KIGA 2L7KA 2KCWA 2PJ2A 5B3SH 2VZZA 4J3GA 4YEJA 1Q9BA 1ETXA 1X2MA 1IYLA 1Y8QB 2E5ZA 4A2ZA 3DWLE 5E3PA 5D29A 5K5OA 2OTJI 2P5KA 5EDNA 4NQWB 4NGTA 3CXLA 2QVOA 4L18B 1AN1I 2V1CA 4H0EA 4E4HA 1FMVA 1QHHD 1ZG5A 2I00A 3CCYA 4BINA 4XKBA 3RZAA 3DBRB 3DEWA 5GPCA 1YIOA 3BI1A 1ZTRA 3CC2I 1Q7LA 1X2NA 2D1HA 2B5GA 2NU4I 5LFAA 3A0HC 2P6EA 3D7FA 6PAXA 5LYDA 4BY7J 3X2QH 3DLAA 1ULYA 2PCUA 1HKSA 4Q47A 2DK8A 3IUOA 2ABZA 4ZYEA 3NH5A 1OBRA 3FKIJ 3OV8A 2P6TA 4DNCA 3ZJ0A 1T95A 1HF0A 4A6DA 1RIOH 3D0SA 3CUQC 5E1WA 1BMOA 2LR8A 4U0YA 1HOMA 4IHXA 1UG0A 2KJBA 1IGNA 4ONWA 4M3FA 3GTMJ 4HG2A 5D6FA 2KP6A 4HF2A 5F46A 1XMTA 1K7UA 3HB9A 1AUGA 3BJ8A 1JQGA 1SD4A 1IUYA 1T0FA 4NB5A 1J09A 2V7FA 2VQCA 3F8CA 1B8IB 3DQVC 1T6SA 2BL1A 3JW4A 1VFCA 3ZP5A 3R9GA 3NWSA 2YUUA 2Y9ZA 4F91B 1SVOA 4DW6A 1IJWC 4G7OF 2GE3A 3GLJA 1IOFA 4LOCA 3VOEA 1GUUA 2WSAA 1QRYA 4A38A 1XBTA 3I5UA 2BY2A 3KE2A 3M07A 1HDLA 5H20A 3GZ6A 3D68A 2WWYA 3GIUA 3MCZA 2V9KA 4RGSA 3QP6A 2VLAA 2PJAA 2B4DA 1CM0A 3EUHA 2AXLA 3HSRA 3JRGA 2FVGA 2V8DA 4AVPA 2D45A 2ISZA 3DNSA 2ZMEA 3HL2A 4KVXA 1SVLA 2HVRA 1IU8A 1LFPA 3VEPA 3LACA 4B11A 4EJOA 3GTKJ 3J7AY 3BOQA 3G71I 1RR7A 5J1YA 1ULNA 2JA8J 1LNWA 3C26A 4XPDC 1G59A 1ZLHA 2F4MB 1SFUA 2IA0A 4KOXA 5I0CA 4PK3A 2M8EA 4PXCA 2SGPI 1ZLJA 2ROWA 5ICFA 1G3SA 5GAHJ 2CY2A 3S14J 2DMQA 2Z9OA 2GA1A 3DKXA 3SFIA 3OWCA 2IS1A 4PFPA 1MKMA 3QRFF 3WGIA 1S7AA 3BROA 1MMDA 4AWXB 1NK2P 3GZNB 3W2WA 3L2VA 3NE7A 1PDNC 5J8CA 5C88A 1TBNA 2X51A 4JYKA 3ZQQA 3OYCA 1QPIA 3DTIA 5D5VB 1IZ1A 1GLNA 3ECOA 4HGUA 4Q38A 2KFDA 3FXUA 3WTWC 3IV5A 3MZHA 3L09A 1PUFA 1B6BA 5HDGA 1U9OA 2ID3A 1TP4A 2RVCA 5IYCJ 2VBXA 3PL8A 5EGOB 1PP8F 4RB3C 3OSFA 1K7AA 4PCQA 3HTUA 1NK3P 2CWFA 1CGII 2SGEI 3VWEA 4CAFA 4AXVA 1Y7EA 3PNYA 1E17A 1RKTA 3D2PA 3Q0VA 3O3KA 2ICWG 3DKWA 1FIAA 2FMLA 3TMOA 2W82A 2ZEHA 2WUUA 4HPSA 5A2QK 4WCGA 4ZDOA 4KT6A 2R5ZA 2XHKA 1LAPA 4BBHA 4JXRA 1MMGA 4C2UA 2ZW6A 2HR3A 1FSHA 1LDDA 4MFZA 3I53A 4M6HA 3JRAA 4E7JA 4MY3A 4F7ZA 1IG7A 4BXXJ 3TO9A 4O3MA 2O9LA 3BZ6A 4Q5SF 2M2EA 2VKDA 1QMUA 3LSJA 1YLOA 2ZMEC 2FBIA 1DS2I 5HVQC 1MBJA 1A35A 2R1IA 3DSBA 3P2FA 3VSKA 4I99C 3VDXA 2BYVE 1KZHA 1WZ2A 2K5CA 1EH7A 3S93A 1LAMA 2VL1A 1D0XA 3ZCOA 4QUSA 4MHDA 1FWZA 1B72A 2B3UA 1V55H 2EZLA 5J1QA 3FSYA 2AXTC 3ZMUA 3PBEA 3HHGA 1QU3A 4QIWN 1GDTA 1UFHA 4P10A 2QSFX 4A94A 2IA1A 4FD4A 1KA8A 1IRFA 3GYHX 1TBQR 4MCQA 5JPHA 2QQAA 5LRGA 4U9YA 1BLLE 4PXEA 4KITB 4BBSJ 4CHUA 3GW2A 5HLHA 3HH2C 4IQJA 5FRMA 2R4GA 2VEZA 3PRTA 1MNDA 3HKZN 2KHMA 2WV1A 4P1WA 1KUXA 2FE7A 3HLPA 1RPWA 3F8BA 4B14A 2HZDA 2XF5A 2GA2A 1E3HA 1BC7C 4GI3C 2CUJA 1FLIA 1OYIA 1RR8C 1TLHB 5HS9A 3SEKC 1Z7UA 1P7JA 1WK4A 4B5PA 2X6YA 3P2HA 1KYZA 3FXOA 1BIAA 5CVVA 1KBFA 1I1GA 1CG2A 4WXCA 1DPUA 2DA7A 5GTIC 4NXYA 4E7IA 4R76A 4R7MA 5DWNA 2EZHA 4I0AA 3KL9A 2WV0A 3A0BC 3BC8A 4G8XA 4LJZF 3UR3C 4ESBA 2QEXI 1R71A 5E3QA 3ONQA 2OZGA 5G1ZA 3GF2A 3HOVJ 1JT6A 2ISYA 2A68F 4G6DA 5ILUA 2W48A 5D5XB 3CCEI 4GS4A 1FEXA 4D7NA 1FYLA 1Y8FA 2WCYA 4R3LA 3K0LA 1HJAI 2AFZA 4KVME 1TW2A 2CGPA 2E1OA 2JK3A 1W3SA 3BR0A 2PQ8A 3DFGA 2DA1A 3HPHA 3LL7A 3PFYA 4KT5C 1LPQA 4BU2A 5IX3A 3RQIA 1WJ5A 2UVOA 3KEYA 2FQ4A 3MVPA 3VWBA 2YNDA 4ZYDA 1IF1A 2DT7B 1BW5A 1UHAA 1HW2A 2N1AB 2V79A 3I59A 3H3ZA 4L89A 4OMZA 2Y31A 4M85A 1BAVA 2JDCA 1Z21A 4BGDA 1LE8B 1ELLP 3B4VC 3HPGA 1GVJA 3WTYC 2Q2EB 4MFLA 2F5IA 2ZOGA 4MHNA 2WY8Q 1F5TA 4BDYA 1XSXA 4KICA 4GM5A 3EUKL 4NSQA 4XBFA 2QKLB 2GLOA 5ILSA 3IWEA 2ME0A 3WGHA 5ICGA 4HZFA 3T8TA 2COBA 3EETA 2H27A 1TWHJ 2VZYA 3KZWA 1OQYA 4BDZA 4L5EA 3F72A 3H3VK 2FBKA 3BR5A 2DIPA 5GPAA 2SGFI 5FLVA 4YG2F 2B8TA 1Z5RA 2R7FA 4EJTA 3QPLA 5FFZA 3FZVA 2Y0MA 1IRZA 1NHAA 2IAIA 3LSKA 1G3TA 2C6GA 1U8BA 4P5OA 2GAUA 4PGHA 4ASNA 3CMAI 4EGYA 2D4OA 1TBXA 4PPZA 1D0YA 1TGSI 2NMTA 3LWFA 3M1CA 4DGWB 2ZXIA 4DYRA 3AL0B 1A2ZA 1XCVA 2X1EA 4DYCA 2ZBKA 2F5EA 1PU9A 3CJNA 3K4CA 1M8BA 3PB8X 4P9UA 3KYCB 2GKTI 4GXHA 2ZEEA 5F47A 2BCOA 2LC2A 3KR4A 3E6MA 4AIKA 1YW7A 2D2WA 4A3JJ 2PJCA 1ZAOA 5FB2A 1B6AA 4GYIA 1UZCA 4GYGA 3I71A 3EC4A 1SGPI 2OA4A 2BOAA 1VQ9I 2Q43A 3T90A 4IK2A 1WGTA 1Z77A 2MLGA 5FGMA 4C3HJ 1CSOI 2MBFA 4FT8A 2WAEA 4HNVA 1EV7A 3RKQA 3BG5A 1BR4A 2PC1A 1LFBA 4XLPF 1CGJI 3I56I 3W6XA 1AU7A 2ZSHB 1UCRA 5HDNA 3FMQA 3GTQJ 1XX5A 5EEAA 2HOSA 3NRVA 1MT1A 2FSRA 2LBFB 4IUSA 4MCPA 4XK4A 3V8IA 2L01A 4U0VA 1N71A 4BE2A 1OMTA 2DKVA 1T38A 1B4AA 5E96A 4NC7A 2OU2A 3IWZA 1YRNA 1KWMA 4JD6A 1ETOA 3WTTC 4ABZA 3I4MJ 3B6CA 1LJ9A 4M74A 4AM3A 1A31A 1OCRH 4DBRA 4RA2A 1BN5A 4IAVA 2BXZA 2LG4A 2XSJC 2X48A 3DP7A 3EXNA 5DD8A 3HG9A 1BBYA 3OOUA 1Z2LA 1SFOJ 2KMPA 1Y1VJ 5E8IA 3PUBA 1J0RA 4HBLA 4K2EA 2DA3A 3WHBA 4KYWA 4UHTA 1XX6A 4RLQA 4KSIA 4B3XA 4LG3A 3OWTA 4M3DA 2LMDA 3ZMVA 4XPKA 2ECCA 2XC7A 2E2JJ 1BPNA 3FNCA 2A07F 1XTAA 3CDHA 3LAPA 2ZEGA 4A33A 2K86A 5DCFA 2VXDA 3MGDA 4DYQA 3WHCA 2NVTJ 1I3AA 4XLHA 4YFKF 1FYKA 4MTDA 1DU6A 2Z11A 1WFXA 1DDNA 2CNSA 2GWRA 2BE5F 2YUSA 4P6YA 1WGCA 2AFOA 3PQJA 4N0BA 3CF5F 1TWAJ 1MSEC 1D5YA 1EA3A 2A5WA 2AQFA 2CJJA 1ZR2A 3KI9A 3WR7A 5GAEJ 3OSGA 3ZQIA 4OMYA 1YJWI 5E17F 3R95A 3RZOJ 3FXKA 4CCNA 4P45A 4Y49B 1V4RA 1IICA 5KTDA 1USTA 1Y8RB 3F21A 3RNZA 2D5VA 2VQGA 4CSWA 1M4GA 5K5QA 2Z0ZA 1Q1HA 2CXAA 5JVTA 3DEUA 2DFEA 4XLCA 5L3DA 4BXUA 5C44J 3PB4X 4C9YA 3ZQLA 4ITVA 2WB1N 2Z5UA 4L0YB 5E3NA 1OFCX 2MH9A 2OPTA 2VI6A 2VIXA 1MMAA 4Y17A 1SGNI 4KA4A 2QIRA 4H89A 1ZYRF 2O03A 5EEGA 2PVWA 3B3SA 2FEZA 2R92J 1IOIA 2W85A 2XUBA 1D3YA 2CO5A 3QU6A 3QAYA 1L0OC 2JEWA 4KLVA 4NGMA 1HPTA 3UNGC 3VPRA 2P7VB 1RZ4A 3OY9A 2R7XA 3HUGA 2L7FP 3E6CC 1FZPB 2V9VA 4GXOA 3IIBA 2MYSA 1DP3A 3BG9A 5JH9A 2PFBA 4KOSA 4E7ZA 3ZGKA 4V2FA 3I55I 1YX3A 2UZKA 4B09A 2VJIA 4RUHA 4XOTA 2AFWA 1IAWA 2KLOA 1R5GA 3RDIA 1Y9KA 1UFMA 1Z8TA 3KIOA 1B1BA 1QO0D 1MNMC 2AFUA 5KAFC 1KONA 4XLEA 4M6YA 3QPTA 3S17J 2JJ7A 2CIJA 2PJPA 5GP9A 3RBUA 4FASD 1APLC 5BQTA 4CICA 4KUMA 2L7XA 5F64A 1LFUP 1HDDC 3DTKA 4RGUA 2K9NA 1QVUA 4I2OA 4OIQF 1B9NA 5CVRA 3Q0UA 3CXQA 5FKMA 3L2QA 4KNYA 2F4IA 4YIRX 2YX7A 2I3CA 2F8HA 2FUG2 1XD7A 2WGCA 1MDMA 4CAWA 1ARLA 2C27A 1OZPA 4EM2A 4CO8A 3VE5A 1NXUA 1YSJA 2VPRA 2P7CB 2CRGA 3IHUA 2FXAA 3H4QA 1N13A 3VYSB 2JTVA 1I3QJ 2R7UA 3S6HA 5CYVA 1K4SA 1S9HA 1JT0A 1TF8A 4HDVA 2X7BA 4LLGF 3ELKA 1ZRCA 2V1XA 2P5LC 2J5PA 4KUAA 1ZHFA 1YTYA 4RS2A 2JSPA 3OXLA 1RNLA 2LDUA 3FMRA 1R79A 2JA6J 1XB4A 5DM6F 2M5XA 2HPIA 3FBNB 2CV0A 3MN8A 5CPAA 2M0MA 1JUMA 3QWLA 5CJ9A 1HEVA 3E6BA 1S7EA 4X2TA 2HS5A 1TNSA 2E7XA 2M45A 2NVQJ 1X74A 1F36A 3LODA 3D5RC 1SAUA 3K1MA 5D6EA 4CCJA 1ZG8A 3PUFA 5LHHA 4KIBA 2POKA 1A04A 5E18F 2Z10A 2EB7A 4F9UA 1USSA 4Z6YA 3JRDA 3RYRA
chains in the Genus database with same CATH topology
2E7WA 5HS7A 5A2QZ 3TT2A 4A31A 2EFQA 4KFCA 1P0HA 5LBQA 3KP5A 4YGOA 4I49A 4EV0A 3CUOA 4ONUA 2WC2A 5A27A 2A6EF 3GXOA 2K4BA 5L3EA 4KOWA 4AG9A 3T5XA 2EFNA 2E1CA 1Z91A 2LKPA 3QOPA 1QSNA 5HLIA 4Y15A 3D5LA 4BMHA 4KORA 3J80Z 4KOYA 2C6YA 5D5UB 4OU0A 2F5CA 1MJ9A 4M9SA 1IXCA 2WPWA 2DU9A 5JFRA 2FNAA 2ZXJA 4HV6A 3VFZA 4OOIA 3K1NA 2JDDA 1YQAA 3KP7A 3E97A 1ON0A 4IRIA 5FD5A 4HKFA 3ZMTA 1U2WA 4EJUA 5FD6A 3DPLC 3IKVA 3N7ZA 2G7UA 1OMIA 4JWPA 5F6FA 1YVOA 1KU9A 1G3YA 1ZO0A 1Z9CA 3K2ZA 1KGSA 4U7BA 3JTHA 4YIIA 2Y48A 3F6VA 2CSOA 3MQ0A 4CAVA 1KU3A 5E1ZB 1OKRA 2R3SA 1TQMA 2A4NA 2HV2A 3FWEA 4IJAA 5LGTA 3HTSB 1B9MA 2FQ3A 1U5TA 1C0WA 2Q7BA 4BHCA 1UHMA 3WGGA 5G21A 1ON2A 3F23A 3U2RA 3V8LA 1O3RA 3J81Z 4KZTA 4I02A 4N9IA 4YRHA 3W91A 3I58A 2PBIA 1TTYA 4EJWA 4PZJA 1FC3A 2DO7A 4QC6A 2LF7A 2XROA 3R1KA 4CXFA 1MGTA 5IV0A 2XAQA 2WPXA 2VQYA 2QWWA 2J5OA 4HQMA 2HGCA 1BO4A 2G3TA 4A95A 2EFPA 3P7NA 2JSCA 1Y0UA 5LLQA 2V1DA 3I54A 1XSVA 4UV8A 1NE9A 4HF1A 1S7NA 2FCKA 1FBQA 4CAEA 1W7PD 3LA2A 1NSLA 4ESFA 4A5MA 1U3EM 3EQLF 3HRTA 1BJAA 3V8KA 4KLWA 1QZYA 1I21A 3HOTA 1S7FA 1R57A 3L2CA 4Y49C 5F1RA 3GY9A 1J9IA 2DQLA 1Z6TA 1DP7P 3RKYA 2J8MA 4U0WA 2IP2A 4CYQA 2L02A 5IB0A 4HX4A 1XEBA 3SFZA 1KYWA 1S6LA 1O57A 1U5TB 5BWAB 2O61A 5LHGA 3V4GA 4WF2A 4ZBGA 1HKQA 3S6FA 1IN7A 3DR8A 1U5TC 4MY0A 4QWQA 4ZZDA 2P6GA 2YX4A 4C2YA 4Q4ZF 3ZPLA 1JHHA 3HYIA 2AS5F 4UWIA 2K27A 4HX7A 4CGNA 3I3GA 3HRSA 5ILVA 4QVTA 3MFKA