1FY7A

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
273
Chain Sequence
b'ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESA1 HISTONE ACETYLTRANSFERASE
publication title Crystal structure of yeast Esa1 suggests a unified mechanism for catalysis and substrate binding by histone acetyltransferases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 81
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fy7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1fy7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1fy7A02
3KEOA 5J8FA 3I54A 3V8IA 4N9HA 4M72A 3ELKA 5DUKA 4L0YB 1YS7A 1TTYA 2OBPA 2JEVA 4YFXF 2H5MA 3F5BA 3O6BB 3F22A 3P9CA 3NEUA 5ERIA 1O3RA 1MJAA 1R58A 1QNTA 3HRMA 5ICGA 4ONUA 2EFWA 1QGPA 2GA1A 3ZJ0A 2Q2EA 2DI3A 4LK1F 2A68F 2H6BA 5ED4A 4L9NA 1ZRCA 3I59B 3TO7A 4KUBA 1J5YA 3GF2A 2UZKA 1ONVA 4MHDA 5LHGA 5K5RA 5D4RA 1XB4A 4QVTA 2PFBA 3RIRA 3GLXA 2UXNA 2GQQA 4ENNA 3FNCA 3CXSA 2CO5A 4OIOF 4EGYA 1P92A 5IT9K 2C27A 2HUZA 3QPHA 5E18F 3D5LA 1Z4EA 4AVBA 2VXZA 1YLFA 3ZN1A 2FT0A 1BI3A 1FYLA 3ZN0A 1GHCA 1IXSB 3T1BA 1L3LA 1E17A 1W5TA 3G3SA 3QAHA 3ABTA 2NS0A 4AIJA 5LGNA 2FL4A 4KA4A 4ZBGA 1ZRFA 2PI0A 2VXKA 2FNPA 1ZN2A 2HZTA 4S04A 4OOIA 2HOEA 4TV7A 3GFIA 4B5PB 2CWEA 2EB7A 1CM0A 2RN7A 1J4JA 4R9MA 1HQCA 4RB3C 1T38A 2VBQA 4KUAA 2V1UA 4JK1X 1K6OA 3E6BA 4HKFA 4NF1A 3DR8A 4A12A 4ON0A 3JW4A 3DDDA 3R9GA 4O6JA 4Y49C 2VBWA 3LODA 4KYWA 3V8KA 2QBYB 3C18A 3ZMSA 2G7HA 4IVNA 1YTYA 2P7VB 1NMTA 4KLWA 1RI7A 1W4MA 1QSMA 3I4PA 2J5OA 4I01A 5K1YA 3HTSB 2BE5F 3W6JB 5AIQA 1S7LA 4PK2A 4HBLA 1S7KA 2D1HA 2P6SA 3S6HA 5CNPA 4IJAA 2K86A 4UBRA 4HNYB 3IL2A 2P6EA 4PZJA 1J2XA 4G8XA 2X4HA 3GYAA 3CO6C 3GZ6A 5F46A 2DXQA 3B73A 2ZO4A 3R4KA 3FYNA 3KP3A 4OIQF 4JD6A 3V8JA 3C7JA 1IAWA 4N0BA 4QC6A 2FRHA 5DCMB 1KZFA 4UV8A 3L2CA 1J9IA 2O03A 1MDMB 1Y9KA 4KMUX 4XLNF 1HSJA 5L3BA 4CAVA 5LEKA 2OQGA 3GX4X 1SD5A 1UHWA 1O7FA 1K4JA 1FSEA 1XMTA 2F5IA 3FMRA 1A04A 2R8VA 3KP4A 3SQNA 2K4JA 3TOAA 1FBUA 3BPXA 4QLCU 1FT9A 2Q7BA 2STWA 3S6KA 3LA2A 3LQRA 3EUHA 2ETHA 1KQ9A 1C0WA 1ON0A 3R0AA 3PQJA 2PSWA 3JAMZ 1EH7A 4P96A 3EFAA 3S2WA 1YGHA 5D5UB 4NCZA 2FE3A 2F5DA 1XSXA 4I0BA 1KU7A 4G9YA 5FGMA 2RNJA 3GW2A 1IYKA 5H6RA 4OINF 3I71A 1FX7A 1IRGA 4BXUA 5DYMA 2M1BA 5FVJA 4H6UA 1G3TA 1IIDA 4CRYB 4BHPA 1HSTA 2K5TA 3PFIA 4EJWA 4NHJA 5BMZA 1K7AA 1J0RA 1R7JA 4U7DA 2VOPA 4Q5SF 2K02A 4R57A 4IRHA 3J80Z 5JR3A 2LDUA 3V7SA 3IC7A 2FSWA 3GY9A 1FPQA 3IKTA 4OIRF 4R3KA 1B1BA 2EV5A 2DBBA 3K0LA 2ESNA 1EV7A 3O2PE 4HV5A 1O57A 3ZZIA 2B3VA 3RKYA 3MZYA 4A5NA 3E3VA 2PBIA 1TBXA 1BI1A 4WWCA 4U7BA 1I1GA 3RKWA 2Y0MA 1U8RA 5F1RA 4CYDA 3W6XA 3U9GA 5LGUA 4AVPA 2RGVA 3SZPA 1EH8A 1MJ9A 4HOBA 4M73A 2HTJA 3DP7A 3K1PA 1YVOA 1UCRA 3K1MA 2FBHA 1S7AA 2Z11A 3IKVA 3F3XA 3BOQA 5D5VB 4A0YA 1QBJA 1IN7A 1Q2YA 1FP2A 2L02A 4ETSA 1S7FA 4GGGA 1WKMA 3F21A 3D0SA 3LD2A 4UVBA 2XAGA 4Q47A 2ZW6A 5LEJA 4CAXA 3JTGA 1DUXC 4N9IA 4YFNF 3FM5A 2F2EA 2VZZA 3DF8A 1UFMA 3J7AO 3WTZA 2ZNYA 3JAMK 4OU0A 1BBYA 2X0LA 1GVJA 2ZXVA 3RJPA 3M8EA 1D3YA 1S6LA 4AG9A 4L9VA 3MGDA 1ZLJA 2RC4A 4WCGA 4NB5A 1YO5C 4KVXA 4LG0A 2P7CB 3Q9VA 1FSHA 1HKTA 2LF8A 2KCWA 2GANA 2A69F 3U1DA 2KJCA 1QPMA 2HQRA 4RGRA 2FE7A 3TE4A 2OD5A 2GAUA 1QSRA 2ZFWA 3J80K 2MLKA 4ENMA 3LWFA 3HTUA 3EYIA 2M8EA 3ZMUA 2A3SA 3ABUA 3KP7A 2VC1A 3WTVC 1WI9A 4GO1A 1XD7A 4Y13A 1NHAA 2B4BA 3R61A 2IA2A 4ORFA 3I58A 3FMQA 1ZYRF 4YFKF 3JTHA 4WF2A 1L0CA 1HW5A 1BOBA 1OYIA 1RUNA 2ZW5A 4M85A 2STTA 3TFYA 3REOA 1STZA 5KK1A 5DWNA 4KLVA 1BIAA 4M9ZA 3LA7A 3TDUC 2A5YB 5CJ9A 4HF1A 3PQKA 1XCBA 4RGSA 2Y75A 1FC3A 2QZ8A 1T2KA 3SZTA 5ICEA 2J8MA 4I0AA 4XPDB 2Q0YA 1Z05A 2LSOA 4RS8A 1AOYA 1RNLA 3CUQA 2D45A 2FS5A 2K27A 3V7RA 1XEBA 1XSDA 4P9UA 2ACJA 1FP1D 1YS6A 3J81K 3LAJA 2P8TA 1LDKB 4U88A 4PGGA 2WV0A 1P4AA 2DQRA 4WX9A 3L00A 2L01A 1TNSA 4QUSA 4IF5A 4I98B 4MTEA 3VB2A 3IRRA 5ICFA 1U6MA 4EM1A 2HV2A 1F5TA 3E6CC 5HS9A 1QSTA 4PSXA 3JSPA 1IXCA 3CLOA 1D8JA 3L09A 2Q04A 3DPLC 5AIPA 1OYWA 2DU9A 2FEZA 2XAFA 4HV6A 2FCKA 3F6VA 2KJBA 4RGUA 1B4AA 5I0CA 4MHGA 3HOSA 2JTVA 2H27A 5ICCA 2XHKA 2V1XA 5D6FA 4B5OA 3IGRA 2FF4A 2CW0F 4BH9A 4M3SA 3BJOA 2W57A 4GYIA 4S05A 2EK5A 2Q8KA 2IA0A 3F8KA 3DNSA 4FX0A 1Z6RA 2Z10A 4BMHA 4L5JA 4DNCA 1O7LA 2FXAA 1B59A 1XMAA 1BI2A 5JI6A 2NAZA 3HRSA 5LGTA 3WGGA 4H0EA 1KYWA 2HGCA 4MQ9F 3VWDA 2Q4VA 1KU9A 2HQNA 2R1IA 2PG4A 2RDPA 4CO8A 5HDNA 2RQPA 2JDCA 2XAQA 1ZARA 2P6FA 5ILUA 3PGPA 3EQLF 1Z7UA 3ZMTA 3GFJA 1ODDA 4OLLA 3RPUA 2W24A 1FWZA 1XMKA 3RYOA 1TQMA 1YG2A 3GZ5A 2FOKA 4HQMA 1V0CA 3ZQ7A 2VONA 1LEAA 5JQ4A 1FBQA 4IHSA 4FD4A 2M45A 3GFMA 3O3KA 1U2WA 1RZ4A 2VZYA 1KUXA 2ZNZA 3CUOA 2LF7A 4LLGF 3K9UA 4J3GA 4XPDC 2E1CA 1F9NA 2IP2A 5F48A 4UNOA 5CVRA 3C3WA 1NE9A 3WODF 4LG0B 2JZYA 5LHHA 3KZYA 3E5QA 2CNTA 2ARHA 3D2PA 2PQ8A 4MNUA 3DSBA 4R87A 3MAJA 5DWMA 3NRVA 1SQHA 2IJLA 4ZH4F 2EUIA 4AB7A 1K78A 1KUVA 2HYFA 2EFQA 2K7LA 5E1WA 5D5XB 4UA3A 3BPVA 4GXOA 1QZZA 4M9XA 4WXHA 3SHPA 4E8OA 5HMNA 4K30A 5H20A 2A4NA 1IN4A 2B58A 2VE8A 2O3FA 4L9TA 5L3FA 3BROA 2PN6A 3T8TA 2E7WA 5C88A 5D8LB 4MGRA 1KU3A 1LQ1A 2ZXJA 3S6FA 5IX3A 1FYMA 1PDNC 1BN5A 4R1HA 4FX4A 5FFXA 3TT2A 3VFZA 4KOVA 4RB0A 4U0YA 4KICA 1YIOA 2AJ6A 4FD7A 1R5GA 4E2AA 2F5FA 3E5UA 2W85A 3CUQB 2EFNA 4ZYHA 4HA8A 1ZLKA 1I6XA 4G7ZF 4KT5C 4ZYDA 1HKQA 2EVNA 3DXJF 2JLMA 4L8AA 4RS2A 2YU3A 3M9AA 1I5ZA 1LB2A 2Z99A 2DPUA 2P5LC 1XSVA 5GCNA 1IN6A 2HTSA 2YSRA 2G0BA 3MQ0A 4EVYA 5ILSA 3M1EA 1RIOH 2E7XA 4YRHA 1S7OA 2V9VA 4G6DA 3P2FA 3BDDA 2D2WA 2IW5A 4KFCA 4M6XA 1XE4A 2F5EA 4UWJA 1FBSA 4WXDA 2MBFA 3QOPA 5DEQA 4NQWA 4I02A 1I12A 1B6BA 1PUAA 4GYGA 2G9WA 3H92A 3QPTA 3VEPA 4PGHA 3KLNA 3I64A 4MY3A 2JPBA 1LDDA 2EV0A 2NNNA 1K79A 2QQBA 4HAMA 4Q48A 2OZUA 2DFIA 2O28A 1WRJA 2FMYA 3I9SA 2FQ3A 4JXQA 1WWXA 3KP5A 3QU3A 3GKRA 3TO9A 3L9FA 1CF7A 4CAWA 1E2XA 2MD5A 4EMSA 1KA8A 4BHBA 5CVIA 4LD5A 5CVVA 3DPTA 4XBFA 2EFPA 1M1DA 3GUDA 2QMLA 4UVCA 4YIIA 1T39A 3G73A 4YIFA 4IHTA 2FU4A 3QP5A 2J8RA 4AVAA 1R22A 3SXYA 2PC1A 4MTDA 4XRFA 4OADA 2XVCA 4KZTA 4KN7X 1Y7RA 2HEOA 4EJUA 3LFKA 2RVCA 2ATRA 2C6YA 2PJPA 4IXAA 4ASNA 2QQ9A 5FLXZ 4G94A 4L9JA 4FHTA 2HS5A 5BPDA 5ILVA 5HOOA 4CGZA 1IUYA 3C1DA 1ZGJA 1IW7F 1U3EM 4O3MA 2KIUA 2DLLA 1Q2CA 2IA1A 4E70A 1GXPA 4U9ZA 1XN7A 3M7GA 4U5YA 4LB5A 1WK4A 4OMYA 2DAOA 3EO4A 4JWPA 5FO5A 2CY2A 2PMHA 3BP8A 5LHIA 3K2ZA 1B6AA 3R96A 3HSRA 1LEBA 4F6AA 3KETA 1IF1A 4OAEA 2JRTA 1PP8F 3MZHA 3OWCA 3C26A 2IVMA 2MH9A 4M9SA 4PDKA 2FIAA 3DR6A 3BJ8A 5EBVA 4K2EA 2R7FA 3HUGA 5J8CA 3B8GA 1YW8A 4WXCA 1HBXG 1FY7A 4EJVA 1J7KA 4CXFA 2OU2A 1SFUA 1K78B 4G7OF 2H09A 3OOPA 5BS6A 4I7HA 2EFOA 3U2RA 1ZAOA 5DD8A 1Q1HA 6PAXA 1VHSA 4KOXA 1UHMA 1Z91A 1MZBA 3KE2A 3L7WA 3VOEA 3GYHX 3KKWA 5DDGA 2DK5A 3FRMA 5A2QZ 1D8KA 5BOXA 4ESBA 3J81Z 1R36A 2VBYA 1SFXA 1IZ1A 1T6SA 1Z6TA 2I79A 2NYXA 3F8CA 3MFKA 4LGWA 1DPRA 1WWZA 4LLLA 4AD9A 1XCVA 3EXNA 4R79A 2NMTA 5E20A 4KVME 1JHFA 4LLNA 3F8MA 2R3SA 5HLGA 2VBZA 1BC7C 2QWWA 2G3AA 4XSXF 3KZZA 1I1SA 2VBXA 4HZFA 2YX4A 3PZJA 3BJ6A 1S8NA 4X5KA 4AIHA 2BUEA 3FB3A 4BNCA 3JUWA 1YW7A 5ISVA 1T0FA 2V1DA 2UXXA 3WTWC 3WGIA 1GHEA 1OZPA 1UFHA 3WU0A 4RGXA 2BBYA 3NQOA 5FLXK 3HHGA 5E96A 3CJNA 2MC3A 3IHUA 5IT3A 3NE7A 1Q2DA 5JFRA 1ZG3A 1XIXA 1ZHFA 3N4MA 2XKPA 5FD6A 3ECOA 3GFLA 1P4WA 2TDXA 2ELHA 5HDGA 2B3UA 2KIMA 4PSWA 1Z9UA 2QECA 3HRUA 2FBIA 5JVTA 1M4IA 2BEOA 3DEUA 3N7ZA 3TDZC 4CHUA 1P0HA 2FNAA 1YVKA 3R6SA 1I1DA 1ZH5A 2VE9A 1XDUA 1G4DA 2O0YA 4MBUA 2XROA 4UHTA 2Q0OA 2ZCWA 1YW9A 1P4NA 3FBUA 5L3EA 1QO0D 5KVRA 4KUMA 2CFXA 4EQQA 4JJXA 1CF7B 2XV4S 3F23A 1R57A 4Q4ZF 4KOYA 4CICA 2A6EF 3K69A 4A6DA 4A2UA 2PDOA 2VI7A 2QUFA 3LSTA 2VT3A 3H4QA 5A2QK 2R98A 3HSEA 3Q5FA 5LRRA 2L4MA 4JQFA 4LX9A 3ZMVA 1BI0A 1W7PA 4EM0B 1U78A 2IPQX 1OR7A 2JPCA 3ZP5A 1SAXA 3EC4A 1LRZA 1XDSA 4MI4A 2QYOA 1USTA 4JBAA 3ZPLA 1BC8C 3KCCA 1DDNA 2X7BA 2GIVA 3P2HA 4WK8F 1O3SA 2XAHA 3T8RA 1BJAA 4LFUA 2HQYA 2OZ6A 1Y0UA 2VQYA 1JXSA 2UWMA 3FM3A 3FIXA 2CNMA 2WPXA 5DD4A 4CZZA 3TTHA 2W84A 5DV5A 2VODA 1V3FA 3CTAA 4JXRA 4HX7A 2ZPAA 1H9TA 2GE3A 4L18B 1IICA 1R1TA 2HDCA 2PRBA 2O6GE 5E1XA 3FXTA 3I0TA 4Z2YA 1JGSA 3WGHA 2ESHA 2M87A 2K4BA 4XLPF 4ENJA 4II9A 5E8GA 3GXOA 2B4DA 5IB0A 5K5QA 2OZGA 3TQNA 4KOWA 3I53A 3MEXA 2VOOA 1TLHB 3M8FA 2BL1A 4CS0B 1R5HA 3KEQA 5DCFA 1P6RA 2XGXA 5EEHA 4M71A 4ENKA 4IRIA 2H6CA 4P9FA 1TW2A 3B02A 2E1NA 1F1ZA 5D8KB 4HLXA 3SXOA 2BYVE 1S3ZA 2XAJA 3P9IA 3K1NA 5CVUA 3RI4A 5L3GA 4LJZF 3FMSA 1YLEA 2Z33A 1IYLA 5L3DA 4EJTA 1JHHA 1XGOA 1MGTA 4PV6A 3D2MA 3D8PA 2CQKA 1BM9A 1FZPB 2QLZA 3EDPA 1V4RA 3WTTC 2KIFA 3R60A 4U9YA 2FA5A 2V79A 3QB8A 2QENA 4OIPF 2GZWA 4HQEA 3D3SA 3S6GA 4LB6B 3RPQA 4KOTA 4XPKA 3VODA 5H86A 4D0PA 1FLIA 4RB2C 4L89A 1TNTA 1SMYF 3GO5A 2WWYA 3RYPA 4MQVA 1IN8A 2IRFG 2FXFA 4R3LA 1LVAA 3I3GA 1FNNA 3V4GA 3BWGA 1Z1DA 1MK4A 2P5VA 3W91A 2ZW7A 3MWMA 4MEXF 2ZJ2A 3WR7A 2IL4A 4YG2F 4DQ2A 1ZG5A 2PR8A 1XGNA 5KTDA 4M6YA 3SXNA 1SMTA 5KTAA 5DUIA 2EA4A 1YX0A 3FXRA 4A0XA 4BQAA 2Y48A 3JSOA 4B8XA 2J8NA 3KFWX 2QIRA 3FXUA 2JSCA 5KTCA 4Y15A 4HLYA 2PEXA 3E0KA 3LA3A 1W5SA 3WTYC 4FD6A 1B9NA 4HX8A 2L4AA 4NSQA 1QZYA 5AONA 4MY0A 4PCQA 1VTNC 2VN2A 5HLIA 2ISZA 1OYYA 1M4DA 2FMLA 1MD0A 1F4KA 2DW4A 1Z9CA 1BIBA 3E6MA 4AWXB 4ZYGA 2ISYA 2OH1A 2MLGA 2PR1A 1ZRDA 1M4GA 1BOAA 2A07F 1W7PB 2XUBA 5F64A 4QB9A 5D6EA 1YYVA 4KOUA 2Z0ZA 5JPHA 2QVOA 5HVQC 2KRFA 3ECHA 1PU9A 1T98A 1ZGAA 4HX4A 2CYYA 2DQLA 1ULYA 1W7PD 3WE3A 3T5XA 1HKSA 1SFEA 3VWEA 1N71A 2Q44A 4BAYA 1S5KA 1U5TA 1KU2A 5EC4A 3FHZA 3ULQB 2ZMEA 4P55A 1RO5A 2EJRA 1YREA 4ESFA 4GCVA 1PUEE 2YPRA 5E17F 2B5GA 2DPDA 2CGPA 1QSNA 4KMFA 1DPUA 2P4WA 3V7CA 1XGSA 3KP2A 4OMZA 2EWNA 5CVJA 1AWCA 1VKCA 3SHFA 5FD5A 2RV8A 4H6ZA 2XASA 1KQ0A 2HFHA 3FWEA 4MJ8A 3IWZA 2GA2A 1TW3A 1FOKA 4NEXA 3TCVA 3QU6A 3COAC 2B4DB 2YX7A 3T90A 5F47A 4AG7A 4H89A 3WE2A 1IN5A 4UVAA 4I2OA 2ZKZA 3F8NA 4KORA 4KVOE 4L5IA 1ON2A 3DKWA 3FZVA 2G7UA 3CXPA 2REFA 1B9MA 2A6HF 1ON1A 2V6CA 3KLOA 5J6XA 5L3CA 1WSUA 5CLSA 1S60A 2AXLA 3ROUA 1QQIA 3ISPA 4YFJA 2OA4A 2BEIA 4I49A 2FIWA 3F8BA 4IRGA 3TO6A 3QP6A 5FFZA 1G3YA 1YFHA 2MH2A 2COMA 4HNXB 1TIQA 4XNHB 2D4PA 1J59A 4KOSA 4KNYA 5K5OA 4L0ZB 1P2FA 4JLYA 2H94A 4LMYA 1B87A 3P7NA 4KIGA 1TQIA 2G3TA 2J5PA 3ZMZA 3HHHA 1H9GA 1R1VA 2HWVA 3RTRA 4U0WA 5FB2A 1D5VA 2EA2A 4EGZA 3BY6A 1Y9WA 1ZREA 2Q4YA 2ADUA 5HH1A 1R23A 4HDVA 4O5VA 1M44A 5F6FA 1Z4RA 1LDJA 3RYRA 2IT0A 2BGCA 3CUQC 4U0VA 3HRTA 2P6GA 4AVCA 2EV6A 4XPLA 2XKOA 3CO7C 1HW2A 3IWGA 4GS4A 4Y17A 4HW0A 4M74A 4R8HA 2YR2A 4I09A 1REPC 2Z3YA 3GVAA 2WC2A 4YGOA 1LJ9A 1QSOA 4KDPA 3H3UA 3F8FA 5D4SA 1NSLA 2F5CA 2CG4A 2HKOA 3KP6A 1O3TA 2LNBA 1I27A 3Q9SA 1YK3A 3R0JA 2D1VA 3MCZA 1J75A 5LRSA 1L0OC 3EYYA 5HLHA 1JE8A 3IWFA 3EY5A 2L54A 4P5OA 2MA3A 3R9EA 2P5KA 2ZW4A 3E5XA 3WTSC 1RUOA 3R1KA 3N97A 5JHUA 4HF0A 3BJ7A 2R7DA 4LUAA 1MKMA 2P0WA 3R95A 1HXDA 2NNYA 4MEYF 2AS5F 4F0YA 1WQ2A 3AAFA 5EEGA 2LKPA 4A0ZA 1O3QA 4UXNA 2OB0A 4HNWB 2VC0A 5E8IA 3TKYA 5F49A 4E0AA 2DK8A 2M5WA 2O61A 4B09A 1SD4A 2HR3A 5LLQA 4RAYA 4HDUA 4ZYEA 3RDIA 2B0LA 2A61A 3H3ZA 1R00A 3I59A 4QBJA 3CXQA 4BHCA 3FX3A 1FYKA 5TRDA 4G6QA 1SD7A 1SD6A 1GXQA 2GXBA 3I5UA 1DP7P 2W25A 5E1ZB 5LBQA 2XRNA 4ESJA 1KUYA 1OMIA 2RKHA 5H6QA 2AE6A 3WU1B 3DV8A 3WTUC 3EETA 3G8WA 2HKXA 3ERED 3WG9A 4UV9A 3BJAA 4NXYA 5IV0A 1P4XA 3RKXA 4HF2A 4XNHC 1U5TB 2ZMEB 2PMUA 2CNSA 3FXQA 2D4OA 3IRQA 4RI1A 2B5GB 2GWRA 3F0AA 4F7ZA 3R9FA 1X3UA 3HIFA 3TGNA 4B5PA 2QQAA 3E6DA 4CDGA 5HS8A 3GWZA 4RAZA 3W6KB 4KN4X 4IUSA 5HS7A 1ZG1A 2OAZA 4KIBA 1U6GA 2GXGA 2O8XA 4EV0A 3HYIA 3TOBA 2REEA 1OKRA 4FT8A 2WPWA 4HYEA 4KIFA 1YQAA 4UUVA 4EM2A 4EVIA 1KGSA 4RB1A 3P9KA 1RXTA 1IRFA 1USSA 1IB1E 2HYGD 2OQRA 3E97A 5TJJA 3T0YA 2QBYA 1TQPA 1KYZA 2L3DA 3BLNA 3K9TA 2Z9OA 4CRZB 1YR0A 4LK0F 3V8LA 3QRFF 4G7HF 3F6OA 2JDDA 5C82A 4A5MA 4IF4A 2KKOA 3CDHA 4EJOA 1S29A 2PLYA 2Z5UA 3ML6A 5IT9Z 4AIKA 2R7HA 2DT5A 5H84A 5BPIA 1EH6A 1S3JA 1CJWA 3FF5A 4IPAA 1I21A 4XSZF 1XGMA 2QM3A 1XF8A 5DCMA 2P6TA 3BZ6A 1G3WA 1LNWA 2BV6A 3OV8A 4BYYA 1MDMA 5HDKA 1OPCA 2FBKA 2FSRA 3UY5A 2NRAC 1G6NA 4ZZDA 4PK3A 1HW1A 4A6EA 2M30A 4FD5A 4UWIA 1CGPA 2BSWA 2VEZA 3T9YA 4Y49B 1IXRC 1KQ8A 2DTRA 3WTXC 2JT1A 1BO4A 5BQTA 1S7NA 3W6SA 1R1UA 3JVNA 3F72A 2CSOA 1PP7U 1G3SA 2XIGA 2OZHA 3SFZA 3ZMDA 1MJBA 3DQVC 2VT2A 3HSFA 3LAPA 3LQQA 3HOTA 2I00A 3G3ZA 5CYVA 2WTEA 1UB9A 5D5WB 1U5TC 2ZBKA 2DO7A 4ZZLA 3DFGA 3PP9A 3GEZA 4QWQA 1H0MA
chains in the Genus database with same CATH superfamily
2CV0A 3KEOA 4A95A 4CYOA 5J8FA 3I54A 3V8IA 4N9HA 4BE2A 4OC5A 4M72A 1ELLP 4IAVA 3ELKA 1MBFA 1VQ8I 1MH3A 5DUKA 2R7WA 4L0YB 2XEJA 1YS7A 4UFXA 1N75A 1TTYA 1JI8A 2OBPA 2JEVA 4TWEA 5DS0A 2CUZA 4PFPA 4YFXF 1X4OA 2H5MA 3O6BB 3F22A 3P9CA 3F5BA 4TNUA 2K9SA 2DDAA 4DOZA 1FTTA 3NEUA 2JVHA 4UEFA 3O8HA 5ERIA 1O3RA 1MJAA 1R58A 1QNTA 1RTQA 1LR9A 1ETXA 3HRMA 5ICGA 4PK4A 3BR6A 5B5EC 3FC3A 4ONUA 2EFWA 1QGPA 2GA1A 3ZJ0A 2M0CA 2Q2EA 2IGKA 1TBNA 1ETOA 1V5GA 2DI3A 3BLYA 4LK1F 2A68F 3OYIA 2H6BA 1BAVA 3ZRGA 3FJUA 5ED4A 2DMTA 3D00A 3OR2C 3H5AA 4L9NA 5EG0A 3S8PA 2DN0A 3I59B 3TO7A 1ZRCA 2IBDA 4KUBA 1J5YA 3GF2A 1HDPA 1ONVA 2XPWA 2XB0X 2UZKA 4MHDA 4P4EA 5LHGA 5K5RA 3RBUA 5D4RA 1XB4A 4QVTA 2BW3B 2PFBA 3RIRA 1ETWA 3GLXA 3OYAA 1R3NA 3WC7A 4UY8I 2UXNA 2GQQA 4ENNA 4XRSG 3FNCA 3CXSA 3H5RA 2CO5A 4OIOF 4EGYA 1P92A 5HVHA 3W2WA 2HB6A 4CCOA 1YOVB 5IT9K 1VQNI 2C27A 1VNDA 3QPHA 2HUZA 4ZI6A 2YNEA 5LRKA 2EINH 5E18F 3D5LA 1UHAA 1Z4EA 3DEWA 4AVBA 2VXZA 1YLFA 4M3EA 4DYRA 4IKFA 3ZN1A 2FT0A 4PJMA 2X1DA 2Y0SN 4A33A 1BI3A 1FYLA 3ZN0A 1YI2I 1GHCA 1IXSB 3T1BA 3G71I 3BR0A 1L3LA 1E17A 3HKZN 4IL6C 3TMOA 1W5TA 1YJWI 1QPIA 2Q1ZB 3G3SA 3QAHA 3ABTA 4ZTJA 2NS0A 4LQGA 4AIJA 5LGNA 4CAEA 2FL4A 2DMNA 1X1BA 3LSRA 5M5YJ 2ELIA 4KA4A 1JGGA 4ZBGA 1ZRFA 5IY5H 2PI0A 2VXKA 2FNPA 1ZN2A 4PQAA 3BQYA 2HZTA 4S04A 4OOIA 2HOEA 4TV7A 2ICWG 4UB8C 3GFIA 5G21A 2OOTA 4B5PB 2VASA 4U87A 1WCMJ 2CWEA 4XLFA 5FLMJ 2LD5A 2EB7A 1CM0A 2RN7A 1J4JA 1O4XA 4KSAA 1CQTA 4R9MA 1HQCA 1DS3I 4P6YA 4RB3C 2GM4A 4BUPA 3VDXA 3I1UA 3ABKH 1T38A 3BTLA 1BL0A 2VBQA 4QTRA 5KNLA 4KUAA 2V1UA 4JK1X 4A31A 2AXTC 2M4GA 1K6OA 1LFUP 2JN6A 2ZOGA 3E6BA 1WJBA 4HKFA 1ZLHA 3OIOA 3OSGA 2J9AA 2ZELA 1ZG7A 3NA6A 4NF1A 4C68A 3LSPA 3DR8A 2OVOA 4A12A 2PJRA 4ON0A 2VJIA 3JW4A 3PSIA 2HC9A 3JRUA 3KASA 3DDDA 2WSAA 3R9GA 2ERWA 4HPSA 1ZELA 4O6JA 4O23A 4Y49C 2GLJA 1TZLA 4CGMA 1JTXA 2VBWA 3HGYA 5F0HA 3LODA 4KYWA 3V8KA 4CUGA 2QBYB 3C18A 5FRMA 3ZMSA 2G7HA 4IVNA 2QSGX 1YTYA 2P7VB 1NMTA 2X52A 4KLWA 1RI7A 1W4MA 1WGCA 2HOAA 1QSMA 3I4PA 3CC7I 2J5OA 1H88C 4B10A 2HYJA 2JYYA 2JWTA 4I01A 4BGDA 1FT7A 3KHZA 2HXIA 5K1YA 1W1WE 2BE5F 2HDWA 1B8IA 3HTSB 4OC1A 3I4NJ 3W6JB 2H8RA 5AIQA 5IYDJ 2JUCA 2KDZA 2PIZA 1S7LA 4RLQA 2Z2SB 4PK2A 4ZY1A 3LSJA 3S17J 4AXVA 4HBLA 1S7KA 3OY9A 2D1HA 4YWYA 2P6SA 2BY0A 3S6HA 4UIBA 1Y6IA 5CNPA 4IJAA 2K86A 1NSAA 1J09A 4UBRA 4HNYB 4A3DJ 3IL2A 2P6EA 4XK4A 3VE5A 3U1KA 4PZJA 2WB1A 2SGPI 1J2XA 1P7IA 4G8XA 1S72I 2Z16A 3DLLF 2V1CA 2X4HA 1V1IA 3GYAA 3K4NA 4G6TB 3CO6C 3GZ6A 2BZTA 2ENNA 5F46A 2DXQA 2E2JJ 1IDYA 3JRHA 4A3KJ 3B73A 5HI7A 2E1MB 2ZO4A 3R4KA 1UUCA 3FYNA 4MHYA 2LP0A 3KP3A 4OIQF 3FXTA 1VQ7I 2L7KA 2V9PA 3LMSA 4JD6A 4A32A 3B6CA 3V8JA 2P6AC 2WAEA 3C7JA 1IAWA 4N0BA 4QC6A 1FTZA 2FRHA 5DCMB 3H9QA 1KZFA 4UV8A 3L2CA 2X3TA 3GTQJ 2OJED 1J9IA 4M3DA 2O03A 4A2ZA 1MDMB 2QGUA 3D68A 1DS2I 1Y9KA 1TC3C 4KMUX 4XLNF 1K4TA 3JRCA 2DMPA 2ZEHA 1Y1CA 1HSJA 5L3BA 4CH7A 5F08A 4KITB 2RQQA 4GFBA 3HLPA 4CAVA 5LEKA 5G1ZA 3PBBA 2OQGA 4MFLA 3GX4X 4Y3OA 5EF6A 4UXIA 1SD5A 2DA2A 1UHWA 4IQJA 1O7FA 1K4JA 2I10A 2KL4A 2PJBA 2X6XA 1FSEA 1T0FC 1XMTA 1GVDA 2HPIA 1EE3P 2F5IA 3FMRA 2MABA 4DYOA 1A04A 2R8VA 3KP4A 5G20A 3SQNA 2AQEA 2K4JA 3TOAA 1FBUA 3PUFA 1DE4C 2Q43A 4Q7AA 3BPXA 2DDBA 4QLCU 1SVLA 4NFRA 1FT9A 1OCRH 1Q1VA 1TKHA 2Q7BA 2ARPF 2STWA 3H35A 2K3FA 2F7VA 3S6KA 3K4KA 3AFHA 4II3A 3LA2A 3LQRA 3B35A 3EUHA 1KQ9A 2ETHA 1C0WA 4BQOA 3B3CA 4CGOA 1ON0A 1BR1A 2GOXB 4UEZA 3BG5A 3R0AA 3PQJA 3ZQIA 1IUFA 2PSWA 3SI1A 3JAMZ 1EH7A 4P96A 3EFAA 1MH4A 3S2WA 4RBOA 5KAFC 1YGHA 5D5UB 4E7HA 2PJ8A 4NCZA 4M3GA 3GTMJ 2IEKA 2FE3A 2F5DA 2YQPA 1XSXA 4I0BA 1KU7A 3QAYA 2NVQJ 4G9YA 5FGMA 3A03A 3H8EA 2RNJA 1X4PA 1JT6A 3GW2A 5H6RA 1HPTA 1IYKA 4OINF 1MMDA 5DTDA 4MLOA 2XF7A 3I71A 4DZPA 4E6KG 4BDZA 1JKQC 2EPFA 1ENHA 3G1MA 5HLTA 1FX7A 1X58A 2R7TA 2VQCA 1UVFA 1Z7KB 1WJEA 1IRGA 2C6PA 4IHWA 4BXUA 5DYMA 2M1BA 5FVJA 4H6UA 1G3TA 2K9LA 1IIDA 4CRYB 3BC8A 4MCQA 2XB5A 4BHPA 1HSTA 2BUSA 1W5CC 3TJQA 2K5TA 3PFIA 4EJWA 3BXMA 4NHJA 5BMZA 2Q2EB 3CJRB 3HOUJ 4EWTA 3CMAI 3GBGA 2K5CA 5EZHA 2Z3OA 1D1AA 3M8JA 1K7AA 1WGXA 1J0RA 2K3PA 1R7JA 4U7DA 2VOPA 4Q5SF 2K02A 4R57A 1QMUA 1N77A 4IRHA 3J80Z 3BG3A 2Z3NA 5JR3A 5EG0B 3BG9A 3CCQI 3D7HA 2N8GA 2LDUA 1CE3A 1NUBA 3V7SA 1SFOJ 3Q0VA 3PSFA 3IC7A 2FSWA 3AKZA 2JA1A 2R7OA 1MT1A 3GY9A 4P10A 5K8OA 1QA6A 1FPQA 3IKTA 1U8BA 4OIRF 4R3KA 2R7ZJ 3W2VA 1B1BA 2EV5A 4PPZA 2ME0A 2J87A 2DBBA 3IUOA 3K0LA 2ESNA 1EV7A 3O2PE 1IW4A 1WGTA 3IO1A 4HV5A 2QSHX 1O57A 3ZZIA 2NU3I 2B3VA 5D8NA 3RKYA 2BY3A 3D7GA 3MZYA 4A5NA 1A35A 3VYSB 1X1PA 3E3VA 1CGJI 5EGOA 2PBIA 3IP4B 1TBXA 1R43A 2ZEEA 2HI3A 1IV8A 1BI1A 5E3MA 2JVGA 4XN0A 2EQRA 4WWCA 1Z2LA 3BI1A 1S20A 3GIUA 3ABLH 2M7AA 1N25A 4F3QA 4U7BA 1WJCA 2DMUA 1I1GA 3E0JB 2KMPA 4C2MJ 2TCTA 3FK7A 4MFEA 3RKWA 4C3HJ 3OYJA 1YJ9I 2VQGA 2WVJA 2Y0MA 1AUGA 3VSKA 1U8RA 5E3PA 5F1RA 2YNCC 4CYDA 3W6XA 2O53A 2CWGA 1RC9A 3NWSA 2NU2I 1BMOA 4FBEA 3U9GA 5LGUA 3G4SI 2QKMB 4AVPA 2RGVA 4J01A 4MHNA 5LRGA 3ZCOA 3K4CA 3SZPA 1X4SA 2Z3KA 1EH8A 1MJ9A 4HOBA 4M73A 3KQZA 4A39A 2HVQA 2E1MC 2HTJA 3MKWB 5JGFA 2GFQA 3DP7A 1WJFA 3K1PA 4R8FA 1V55H 2DYSH 1S7EA 2M34A 1CHOI 1YVOA 1UCRA 3K1MA 1YLOA 4CAFA 2FBHA 1S7AA 2MG4A 3BR2A 3IKVA 3CF5F 1AKHA 3F3XA 3BOQA 3G2BA 4XLEA 1DU0A 5D5VB 4A0YA 1TBRR 5EYRA 2CUJA 1QBJA 1IN7A 1VQ9I 1Q2YA 2VKHA 1FP2A 2L02A 4ETSA 3ONQA 1S7FA 4GGGA 2W0TA 2MC4A 4JYKA 2YU9J 2SGQI 5AG7A 1WKMA 3CCRI 3F21A 3S1NJ 3I9V2 3D0SA 3LD2A 4UVBA 3Q3SA 1LE8A 1M8CA 1X2NA 2XAGA 2ECCA 4Q47A 2ZW6A 2PJRB 5LEJA 4FCYA 3DKXA 2W00A 4CAXA 3JTGA 2DT7B 1DUXC 4N9IA 4IOCF 2QF7A 4RLFA 3FHNA 4YFNF 3FM5A 2ZEOA 2F2EA 2VZZA 3DF8A 2OV7A 3PB7X 1UFMA 3J7AO 3WTZA 5IYCJ 4CYNA 2ZNYA 3NARA 3ZR8X 3JAMK 4ZDOA 4OU0A 4C2UA 1BBYA 2X0LA 4F92B 1VDDA 1GVJA 2ZXVA 1LVKA 2QKLB 3SEKC 2ZEGA 3RJPA 1QZEA 1XMXA 2CW8A 1SC7A 2HOSA 2H1KA 3CD6I 3M8EA 2J9RA 1D3YA 1S6LA 3MMYB 3B3WA 1PJRA 1WJ5A 4AG9A 4L9VA 2OPTA 1JUMA 4W97A 1B8IB 1CX8A 1I6HJ 1FNOA 1QVUA 3MGDA 3CLQA 2N71A 3PDNA 2V8GA 4B14A 1ZLJA 2RC4A 4WCGA 4NB5A 1YO5C 2LFBA 2DMQA 3PM1A 3JTKA 4KVXA 3S2DJ 1VQPI 3QNVA 4LG0A 1K61A 2P81A 3K4BA 3CCEI 4OC0A 3IAM2 2BXZA 2P7CB 1X19A 4HRIA 1TF8A 3Q9VA 1F57A 1FSHA 1HKTA 2OD1A 3PEIA 2LF8A 1XMBA 2KCWA 4GM5A 1UG0A 2CUFA 4X1EA 2GANA 2A69F 4H4KC 3QWPA 3U1DA 4JP0A 2KJCA 1QPMA 4DIQA 2HQRA 4RGRA 5LD2C 2FE7A 2W48A 2OD5A 2POKA 3TE4A 2GAUA 1QSRA 2ZFWA 3LSGA 3LSKA 2PJ7A 2AQFA 3J80K 2IS2A 4NGMA 2MLKA 4ENMA 4KT6A 1VQ5I 2E2IJ 3LWFA 1IV6A 3OXLA 1NTCA 3HTUA 3EYIA 2M8EA 3HOXJ 2KFDA 2QCOA 3ZMUA 3LNQA 4BDYA 4RUHA 1LR7A 2A3SA 5JH9A 2XGDA 4UIAA 3ABUA 3NH8A 3M1CA 4IHMA 3KP7A 2LK2A 2VC1A 3WTVC 1XBUA 1WI9A 1H0ZA 2CFOA 4GO1A 3PFYA 1SVMA 1XD7A 4AMLA 4Y13A 5DM7F 2HZDA 1NHAA 2B4BA 3H0DA 3R61A 2IA2A 1EJ9A 4ORFA 3I58A 4B48A 3FMQA 1ZYRF 5ELYA 3HM5A 4YFKF 3JTHA 3L2RA 1Z77A 1YJNI 2B0UC 4E1RA 4WF2A 2ZEFA 4PFOA 4V2GA 3SJFA 5AG6A 1L0CA 1HW5A 4A94A 2PMZA 1BOBA 1OYIA 1RUNA 4LOCA 3OXGA 2ZW5A 4M85A 2STTA 3TFYA 3REOA 3UGDA 2JJ7A 3PUBA 1STZA 5KK1A 5DWNA 3DU5A 4ZGYB 4KLVA 1BIAA 3A02A 3LA7A 4M9ZA 3TDUC 2A5YB 3C2GA 5CJ9A 4QPQA 2EIMH 3OYNA 3PQKA 4HF1A 4IOAF 1XCBA 4RGSA 1SVOA 2Y75A 1FC3A 2QZ8A 3QYFA 4FASD 4Y7NJ 1T2KA 3PL8A 1XTAA 2XPUA 3SZTA 5K7FA 5ICEA 3S1RJ 3W2AA 4I0AA 2J8MA 4XPDB 2Q0YA 1Z05A 4A3IJ 2WAQA 2LSOA 4RS8A 1AOYA 5M5WJ 1RNLA 3CUQA 3HUVA 3FXKA 2D45A 1CPSA 2FS5A 2IGNA 2K27A 3V7RA 1XEBA 3OMYA 1T08B 3LSHA 1XSDA 1MBGA 3WABA 4ANJA 4P9UA 1Z8TA 2ACJA 3DTEA 4OMEA 3HZJA 2AFUA 4HG2A 1FP1D 1FAQA 2JXDA 4E1PA 3S3MA 1Y1BA 2ZOFA 2VRWB 1AA7A 1YS6A 4XLAA 3J81K 1Y8QB 3LAJA 4NGSA 2F4OB 2P8TA 1IJWC 1LDKB 4U88A 4PGGA 2WV0A 3L2WA 3UOEA 1P4AA 2W7NA 2DQRA 4WX9A 3L00A 2L01A 4CGPA 1RR8C 1XBTA 3UGIA 1TNSA 4QUSA 4IF5A 4I98B 4MTEA 1D5YA 3VB2A 3IRRA 5LYDA 5ICFA 3HOZJ 4XKBA 1U6MA 1QQ9A 1TP4A 4EM1A 3HPHA 2HV2A 1F5TA 3E6CC 5HS9A 3VYTB 1I3QJ 5K7ZA 1QSTA 4PSXA 1IY6A 1QVTA 3S2HJ 4I76A 4BD9A 1RPWA 5FKKA 3TP3A 1RESA 2CRGA 4HPQA 5GPAA 1IXCA 3JSPA 1R71A 3CLOA 1D8JA 1SGNI 3TW7A 2R5YB 2LR8A 4UUTA 3L09A 2Q04A 3CJTB 3DPLC 5AIPA 1OFCX 3N05A 1OYWA 2DU9A 2O4HA 2FEZA 2XAFA 4D7NA 3KY9A 3HXLA 4HV6A 2XEFA 2FCKA 4FE4A 3OWTA 1YMEA 3BTIA 7CPAA 1RKTA 3FIWA 3F6VA 3MVPA 1WVRA 2KJBA 4QIWN 4RGUA 1B4AA 1WTJA 2DA4A 1MMSA 4MHGA 3LMMA 3HOSA 2NU0I 2JTVA 4WJBA 1JWQA 2KMOA 2H27A 5JHWC 1HDUA 5ICCA 2XHKA 3IH4A 3NAUA 2Z11A 2V1XA 3ASNH 5D6FA 4B5OA 3HC7A 3IGRA 5FKNA 2FF4A 2CW0F 1XJOA 4BH9A 2CIJA 1BR4A 4GXHA 1TBQR 4XRMA 3J7ZI 4M3SA 3BJOA 1VQMI 3VDUA 1Z3YA 3FXOA 5EGOB 2W57A 1BPNA 3NH5A 2L7MP 4GYIA 4S05A 2BY1A 2EK5A 1PTQA 3QPSA 3RCOA 2Q8KA 4JZ0A 2IA0A 3F8KA 5HVGA 3DNSA 4FX0A 1Z6RA 2Z10A 4BMHA 3IH2A 4L5JA 4DNCA 3DKYA 3A4CA 4AYBA 1O7LA 2LC2A 2Y69H 1BUSA 2FXAA 3KZIC 1PYTB 4E7JA 1B59A 1LFBA 1XMAA 4BY7J 3S1QJ 4HNVA 3HOYJ 3BJIA 1Y0RA 1BI2A 2H8WA 5JI6A 2NAZA 3HRSA 4CA0A 2R93J 4BJ6C 3LWUA 4JX5A 3M07A 1XC5A 5LGTA 4AM3A 2PJ1A 3WGGA 3G6EI 1RFHA 3I56I 1A2ZA 1WJDA 1DQUA 3PB6X 4MFZA 4RM2A 4H0EA 2CJSC 1KYWA 2K40A 2NSMA 2HGCA 4XORA 4MQ9F 3RAMA 1X3ZB 1OVOA 3VWDA 1NK2P 2Q4VA 1KU9A 2HQNA 2MW8A 2ZJRF 4X6AJ 5KCMA 2R1IA 2PG4A 2RDPA 4CO8A 5HDNA 2RQPA 1AKHB 2XAQA 2JDCA 1OCZH 1ZARA 2DA1A 4FE7A 1MNDA 1X2MA 1Z7UA 3EQLF 1MW7A 5ILUA 2P6FA 3ZMTA 3OS1A 2C6GA 1LAPA 2FVGA 2EZHA 3GFJA 3K4MA 1ODDA 3NH4A 3ZQHA 3J7AY 2DOEA 1PVEA 2IS4A 4OLLA 2JSPA 3RPUA 3OVOA 2W24A 1FWZA 2NU4I 2HPMA 4H2KA 1XMKA 1LE8B 1JJ8C 3VYRB 3RYOA 4XKVA 1TQMA 1KMAA 1FARA 1MMNA 1YG2A 3GZ5A 2Q51A 3A9LA 4W9YA 2FOKA 4HQMA 1V0CA 3ZQ7A 1UWYA 1U9OA 4DW6A 2VONA 1LEAA 3VH9A 5JPHA 4OC4A 2X48A 4XOTA 4NJQA 1CGII 4N4OB 2N17A 4V19K 5JQ4A 3LSMA 1FBQA 1ORKA 4IHSA 2M45A 4FD4A 1HA8A 1MMGA 3GZNB 3GFMA 3O3KA 1H8AC 1APLC 1WZ2A 2G9DA 4LQ6A 3S32A 1U2WA 3LSIA 4CZCA 2Y2ZA 1RZ4A 2M0MA 1GLNA 2VZYA 5GAGJ 4XR6A 2RIJA 1KUXA 1SGEI 3B3SA 2ZNZA 1SANA 3CUOA 2LF7A 4LLGF 2Y31A 3K9UA 4J3GA 3HGGA 4XPDC 2VI6A 2GBYA 2E1CA 3FH4A 1F9NA 2IP2A 4UFVA 1DGWY 5C44J 5F48A 5A28A 2Z1DA 3WHBA 3JRAA 4UNOA 2ZSHB 3C3WA 2WV1A 5CVRA 2PRQA 2BY2A 1NE9A 4DGWB 3WODF 1PYVA 4XKWA 3UNGC 4LG0B 1E0EA 1AHDP 2JZYA 5LHHA 3KZYA 4CCLA 3HL2A 2PMZN 2CXAA 4BE0A 2LOOA 2NU1I 4ZC3A 3E5QA 2XSDC 2PJ3A 2CNTA 3RU0A 4CCKA 2XC7A 4XLHA 4HGUA 3ZQFA 2ARHA 3D2PA 4F9UA 1X1AA 5FKMA 2ZEDA 2PQ8A 4MNUA 3DSBA 4R87A 3K70C 1R0RI 3MAJA 5DWMA 2MD0A 5HODA 3NRVA 1IGNA 2IJLA 1SQHA 4ZH4F 2EUIA 4AB7A 1K78A 1KUVA 2F5VA 2HYFA 1HOMA 4LIUA 2EFQA 2M5XA 2K7LA 2EBJA 5E1WA 5D5XB 4UA3A 2NYQA 3BPVA 2NS7A 2WAQN 3ZQLA 1IGBA 4GXOA 4Z6YA 4KJZA 1GDTA 2DA6A 2QEXI 2FUG2 1QZZA 3FKJA 4M9XA 4ZDPA 4WXHA 3SHPA 3OL0A 1BLLE 4A3JJ 5FRNA 2L2OA 1X10A 4E8OA 5HMNA 1R4MB 1YQEA 4K30A 2KMQA 5H20A 2A4NA 1IN4A 2B58A 2EZIA 2O3FA 2VE8A 2I5UA 4L9TA 5L3FA 1XS9A 3BROA 4NUBA 2QSFX 1VQKI 5FUYA 2PN6A 3OL4A 3T8TA 2E7WA 4PXCA 5C88A 4C9YA 4XRSA 5D8LB 1E3OC 2LYCA 4MGRA 2CV1A 1KU3A 1LQ1A 2ZXJA 1LR8A 3S6FA 3W3CA 3T8WA 5IX3A 1FYMA 4MFDA 4ONWA 1PDNC 2HVRA 4J19A 3PRTA 4JX4A 1BN5A 4R1HA 3S1MJ 4FX4A 5FFXA 2A20A 3TT2A 4XQFA 3VFZA 5CBMA 3FBNB 2UV1A 4D1QA 1NG7A 4WP4A 2CTBA 4HSTA 4RB0A 3CDIA 4BL0B 4U0YA 3FMCA 4KOVA 2BOLA 2EZKA 2VJ5A 4LIVA 4X3RA 1WI3A 5EX0A 4PJLA 3UEYA 2GREA 4KICA 1YIOA 2AJ6A 1JKOC 4FD7A 1R5GA 4K3NA 3VDPA 2GIZA 3BZCA 4E2AA 2F5FA 3E5UA 5F0CA 5HNHA 3CUQB 2AO9A 2W85A 2EFNA 4ZYHA 1ZR2A 1YW4A 2JBJA 1YX5A 1T56A 4HA8A 5FKOA 2QJ8A 1ZLKA 1I6XA 2MFZA 3OXFA 4G7ZF 4KT5C 4ZYDA 1HKQA 2VXDA 3DXJF 1MBJA 2EVNA 2JLMA 2YU3A 3M9AA 4L8AA 4RS2A 3G1OA 1I5ZA 3MEKA 2ABZA 1LB2A 2Z99A 3PB4X 1W36D 2DPUA 2P5LC 1XSVA 5GCNA 1IN6A 2HTSA 2YSRA 4QPOA 1IRZA 2G0BA 3IV5A 3MQ0A 4EVYA 1D1BA 3M1EA 5ILSA 4DBRA 1RIOH 1HC8A 1TWFJ 5CCLA 1Z0XA 4Z65A 3DBLB 1TBOA 2E7XA 1G59A 4YRHA 1S7OA 2V9VA 4XKCA 4BS9A 1UHSA 1ULMA 2WCYA 1GT0C 3K10A 4G6DA 2GXAA 3BDDA 3P2FA 2D2WA 2IW5A 4RA2A 4KFCA 2R7SA 3RNZA 2E5ZA 1VQ4I 1BJZA 2L9SA 4M6XA 1XE4A 5LYIA 2F5EA 3HH2C 2GOMA 3MRUA 2W1OA 1LOKA 4B12A 4AC0A 3D1NI 4C2TA 1HJAI 4NGQA 4UWJA 1FBSA 1WPKA 2MBFA 4WXDA 4CYPA 4AYBN 3QOPA 5DEQA 1QU3A 4NQWA 4I02A 1I12A 2XDVA 1YW6A 1B6BA 3UKGA 1XFOA 3BHXA 1PUAA 4GYGA 2L5QA 1D0ZA 1OISA 2G9WA 4NDLA 3H92A 2DODA 1NG6A 3QPTA 3VEPA 3GTGJ 3OSFA 4PJJA 1WH5A 2HU9A 4PGHA 3UFFA 4RDUA 1WKXA 4F8ZA 3KLNA 4XM3A 1LPQA 5JLXA 4G12A 4MPIA 3EUKL 3I64A 1N13A 2AFZA 4MY3A 2JPBA 1LDDA 1FOXA 2X85A 2EV0A 1EF4A 2NNNA 1CBXA 2PJAA 1K79A 2LUYA 2HQAA 2ANPA 1PCEA 4JX6A 2QQBA 2K85A 2M2EA 4HAMA 4A3BJ 1DU6A 4Q48A 2OZUA 4NNJA 2DFIA 2O28A 1WRJA 2LRDA 3D5SC 3A2KA 3HOVJ 3PIOF 1W0TA 2FMYA 1HF0A 1XA6A 2FQ3A 1F2PA 3I9SA 3L2NA 4JXQA 1IOIA 1WWXA 1FMWA 3D7FA 3KP5A 3J7YJ 3QU3A 9ANTA 3CP2A 2JW6A 1KBFA 3GKRA 2DOAA 2L7ZA 3TO9A 3L9FA 1CF7A 3EPZA 3PNYA 2E71A 4CAWA 1E2XA 2MD5A 4EMSA 1KA8A 1YX3A 1Z67A 4QSHA 4BHBA 2DJNA 4LD5A 2WADA 5CVIA 5CVVA 2WA0A 3DPTA 5F1JA 4XBFA 2EFPA 5GAHJ 4RAFA 2NXNB 4OAZA 4FWUA 1M1DA 3GUDA 2QMLA 4UVCA 4YIIA 1T39A 1SGRI 2M4KA 5EJCA 4YIFA 3G73A 3HOWJ 1AU7A 4IHTA 3SI0A 2FU4A 3QP5A 2J8RA 3M4OJ 4AVAA 1R22A 2CJJA 2DYRH 2TRTA 3SXYA 2PC1A 3JRDA 4YU9A 2JEWA 4MTDA 4EATA 3CMEI 3PGPA 4XRFA 2ME6A 4OADA 3OYGA 2XVCA 4KZTA 4DUKA 4UXHA 4KN7X 1Y7RA 4MXUA 3FECA 4WWVA 4B6DA 2A05A 4M6VA 2HEOA 4OIWA 4EJUA 3LFKA 2RVCA 3QQAA 4A3EJ 3B6AA 4DZJA 4E7SA 2ATRA 2JA8J 2VL1A 4DJAA 2C6YA 5CQEA 4NC7A 2PJPA 3V42A 2R0QC 4HNTA 3SGQI 4I99C 1K7TA 4IXAA 4MO7A 4ASNA 4BXXJ 2QQ9A 4A69C 2CTCA 3U21A 2SGDI 3KL9A 5FLXZ 4NGPA 4G94A 4L9JA 5LRJA 1KWMA 3QPLA 2F48A 4FHTA 2HS5A 5BPDA 5ILVA 5HOOA 4CGZA 1IUYA 3C1DA 1ZGJA 4A24A 1IC8A 1IW7F 1U3EM 1Z21A 3I3LA 1R49A 4O3MA 2KIUA 3RPUD 3OYKA 2DLLA 5GP9A 1Y1WJ 1JT0A 2IA1A 4E70A 1GXPA 1Q2CA 2RFHA 4U9ZA 1XN7A 3M7GA 1W3SA 3A01A 4U5YA 4LB5A 5I0CA 3C2BA 2QA4I 1WK4A 1OCPA 5EX3A 1HDLA 4OMYA 2DAOA 3EO4A 4JWPA 4YELA 5FO5A 4BU2A 2CY2A 2PMHA 1LFWA 1T95A 4IK2A 1FJLA 5JM6A 3BP8A 2X6WA 5LHIA 3K2ZA 1IOFA 1FOWA 4MIMA 1B6AA 3R96A 2AFSA 1R9TJ 5J1UA 1W36C 3KQXA 3PB9X 3CCMI 2X1CA 3HSRA 1H89C 1LEBA 3KETA 1Z8WA 4F6AA 4B47A 3CJQB 2I8DA 1K4SA 1IF1A 4OAEA 3QYEA 3FVLA 2FX0A 2JRTA 2X9DA 1PP8F 3CMMA 3MZHA 1A6QA 1OBRA 3OWCA 4MCRA 3C26A 2IVMA 2MH9A 3V38A 4M9SA 1PTRA 4PDKA 3HJEA 2FIAA 3DR6A 3BJ8A 3H9JA 4K2EA 5EBVA 1LANA 3D4UA 2R7FA 2C6CA 1B72A 3GLLA 3HUGA 5J8CA 1Y39A 3B8GA 2IS1A 1YW8A 2IGOA 4WXCA 1HBXG 1FY7A 1I3AA 4EJVA 2V53A 1J7KA 1YTPA 4CXFA 2OU2A 3SJMA 1SFUA 1FOYA 1K78B 2VQHA 4G7OF 2H09A 1X1DA 1JTYA 3OOPA 5BS6A 2L7FP 4I7HA 2EFOA 3U2RA 1ZAOA 1DTDA 3RO0A 1ETYA 1U9NA 5DD8A 2GLOA 2V4JC 2DT6A 2PIYA 1Q1HA 6PAXA 1VHSA 4KOXA 4ZY0A 2RREA 2PE3A 1UHMA 1Z91A 1MZBA 3KE2A 3L7WA 2L0KA 3VOEA 3GYHX 3KKWA 1ZR4A 5DDGA 3CCSI 2DK5A 3FRMA 5A2QZ 3HG9A 1PUFA 1R79A 2E5RA 2V1NA 1SEUA 1D8KA 2GKVA 5BOXA 2A5WA 4ESBA 2CQQA 2XEIA 2R4GA 2VKDA 3J81Z 4G1PA 1R36A 2VBYA 2YUSA 1SFXA 4BQNA 1IZ1A 1T6SA 1Z6TA 3P5JA 2I79A 2PCUA 2NYXA 1TUSA 3F8CA 4M6HA 2VJ4A 3MFKA 4LGWA 3SYTA 5DAEA 5J47A 3GB0A 1DPRA 1WWZA 4LLLA 3OYBA 3CF2A 1Z7LA 2JA5J 4AD9A 1IU8A 1XCVA 3EXNA 4R79A 2NMTA 4KS9A 5E20A 3FDYA 1TF9A 3RQ4A 4J00A 3F9KA 4KVME 1HCRA 3TW6A 5E3QA 1JHFA 1H8LA 4XN3A 4LLNA 3TX8A 3F8MA 2CH0A 1R6RA 2R3SA 3L2UA 5HLGA 2YNDA 4BBHA 2VBZA 1BC7C 2MGQA 4FQGA 2QWWA 2G3AA 4XSXF 2HNHA 1LFPA 2ZXHA 3KZZA 4D7MA 1I1SA 2K9MA 2V8HA 2L7XA 2DFHA 2VBXA 1TXRA 4HZFA 4F52A 2YX4A 2FJ1A 2E19A 1V5EA 3PZJA 3DCFA 3BJ6A 1QRYA 1S8NA 3S9NA 2OC6A 2F4IA 4OC2A 3LL7A 3O8GA 1VHOA 4X5KA 3MKYB 4AIHA 2BUEA 3FB3A 4BNCA 3JUWA 1IDZA 1WJAA 4NBQA 1YW7A 2DFEA 1T0FA 2V1DA 3SDBA 1F43A 3D66A 5ISVA 2UXXA 4UUSA 4UCPA 3WTWC 3FXMA 3WGIA 1GHEA 2LY9A 1OZPA 1UFHA 3WU0A 3DLAA 2ENZA 1GUUA 4RGXA 2KHMA 2BBYA 3NQOA 4X0GA 3HHGA 3OYCA 5FLXK 5E96A 3CJNA 3CMYA 2MC3A 3IHUA 3TP0A 1XG1A 4HEA2 5IT3A 3PBEA 4L5EA 3NE7A 3FSXA 1Z3XA 2LY1A 1Q2DA 5JFRA 5LFAA 1X1CA 4P4IA 3WU2C 3QOEA 1PPFI 1ZG3A 1XIXA 3RZAA 5J3LA 1ZHFA 4UXJA 2CW7A 3N4MA 2XKPA 3I4MJ 5CPAA 5HVFA 3TBIA 3KIOA 2IAIA 5FD6A 3DTIA 3ECOA 3GFLA 4EMEA 2O8KA 5KHDA 1P4WA 4BJTA 5LYLA 2TDXA 3L2VA 2ELHA 4IHVA 5HDGA 3H0GJ 2B3UA 1IO2A 2KIMA 4PSWA 5EZGA 4IX7A 3DLJA 3SGBI 1MSFC 1Z9UA 2QECA 3HRUA 2FBIA 3VWBA 4MHZA 5JVTA 1M4IA 2BEOA 3DEUA 1JKRC 3N7ZA 3TDZC 2VKVA 4CHUA 1P0HA 2FNAA 4YEJA 4C2YA 1YVKA 3BG7A 3QODA 3R6SA 1YRNA 2L9NA 1MBKA 2C1CA 1Y56A 2ZXWH 4XLCA 2F4MB 1I1DA 1ZH5A 2VE9A 2DTZA 2K9NA 2PVWA 3FBIB 1XDUA 1G4DA 3OS0A 2CWFA 2O0YA 4BKXA 2CU7A 1ARLA 4MBUA 3OR1C 2XROA 4UHTA 2Q0OA 3WG7H 3BTCA 4D9JA 4M6IA 5K8MA 4P4DA 3DPUA 4E4HA 2ZCWA 3K4JA 1YW9A 2ELJA 2KIQA 4ZTFA 1P4NA 1ZGWA 3FBUA 5L3EA 3CP8A 2CF4A 1QO0D 5KVRA 4KUMA 3GTKJ 2IS6A 2CFXA 4DBQA 1TGSI 5K8NA 4EQQA 2KZGA 4UB6C 4JJXA 1T8IA 1CF7B 2XV4S 3F23A 1R57A 1TWCJ 4Q4ZF 4KOYA 4CICA 3OYFA 4A3LJ 2A6EF 1POGA 3K69A 1GYTA 2BO9A 4A6DA 4A2UA 1ZK8A 2PJ0A 2PDOA 3JRGA 1HLVA 2NS8A 2VI7A 2QUFA 3MZ8A 4OAYA 3SJGA 2L9VA 3LSTA 4CSWA 2VT3A 4BQQA 3H9GA 2EBIA 3S15J 3H4QA 5A2QK 1FMVA 3HSEA 1ZQ3P 3Q5FA 2R98A 5LRRA 2BHZA 4RN7A 2LBFA 2L4MA 2DXIA 4JQFA 2XPVA 4LX9A 5IP6A 3GLJA 3ZMVA 1BI0A 1W7PA 1TT5B 4EM0B 1U78A 2IPQX 1OR7A 2JPCA 4AIDA 3ZP5A 4ABZA 1SAXA 1BW5A 3EC4A 3B3VA 1LRZA 3GOXA 3B3TA 1XDSA 4MI4A 1M8BA 4NC8A 2ZXIA 2OTJI 3CESA 2QYOA 1USTA 4CGLA 3KR4A 1CSOI 4JBAA 2XSJC 3ZPLA 1TIHA 1BA5A 1BC8C 3KHXA 3KCCA 1DDNA 4BXFA 3KI9A 2X7BA 2GIVA 3QTLD 3P2HA 4FKDA 1GV2A 2K9QA 2X51A 4WK8F 4P45A 3KGQA 2E5NA 2DCEA 1O3SA 2V26A 2XAHA 4XMYA 3JRIA 2LREA 1BJAA 4LFUA 3T8RA 2OZ6A 3DWLE 3VSLA 1TKJA 2HQYA 4R7MA 1Y0UA 3RQIA 3A01B 4GI3C 4B1RA 2VQYA 1Y8RB 3SDGA 1JXSA 1OYVI 2UWMA 4DYQA 3FM3A 3KEYA 1W4RA 3FIXA 3OYLA 2CNMA 2WPXA 2DOFA 4A3MJ 5DD4A 3KR5A 4CZZA 3TTHA 3H5ZA 2XGEA 2GKTI 2W84A 2ZC2A 5DV5A 3CPAA 3AL0B 2VODA 1V3FA 5THWA 5IP7J 3CC2I 1ERDA 1TKFA 3ZOBA 3OIQA 2B7EA 2BOAA 2X6YA 3BTJA 3CTAA 3CXLA 2R7XA 3E7LA 4IHYA 5E79C 2FNFX 1YE9A 5D29A 1WH7A 4JXRA 4HX7A 5FROA 2ZPAA 1H9TA 2E1OA 2GE3A 3CCYA 1UJ8A 2UVOA 2BHYA 4L18B 1IICA 1R1TA 2HDCA 2PRBA 2O6GE 5E1XA 1B72B 1K7VA 3HUGB 1R4NB 2VB6A 3I0TA 1JGSA 4Z2YA 2ESHA 2M87A 2K4BA 3WGHA 2B9SA 4OIDA 4XLPF 4ENJA 2B63J 4II9A 4CYCA 5E8GA 3ZQGA 3GXOA 3S93A 2B4DA 2OR4A 5IB0A 1P9QC 1TT0A 1JQGA 3BR1A 5K5QA 4B4CA 3TQNA 2OZGA 3I53A 3MEXA 4KOWA 1QHGA 2JA6J 2VOOA 1TLHB 1V1HA 3M8FA 2Y30A 4KISA 4Y52J 2V1CC 2BL1A 2WGCA 1RKWA 4CS0B 1R5HA 3KEQA 5DCFA 3KYCB 2Z3PA 3CDLA 1P6RA 2ODFA 2ZFUA 4AUXA 2SGEI 2XGXA 5EEHA 4M71A 4PXBA 4ENKA 2NVYJ 4IRIA 5JLWA 5E3NA 2H6CA 1SFKA 4P9FA 1TW2A 3JRBA 2LKSA 2JUGA 3B02A 4NC6A 4NGTA 4JCVE 2WBMA 1PUFB 1LAMA 1I39A 1TWAJ 2EWBA 2E1NA 1WHUA 2NVUB 1JJ6C 5DM6F 5K8PA 2NOGA 2DKVA 1F1ZA 4B43A 3ZXSA 4B6ZA 1MNMC 5J4VA 1LKXA 4HLXA 5D8KB 3SXOA 2BYVE 3ZGKA 1S3ZA 5JHFA 2XAJA 3P9IA 5KAIC 2VUMJ 2ORWA 3K1NA 4FETA 5CVUA 4A3GJ 1Y8FA 3RI4A 3BZKA 5L3GA 4PUSA 4LJZF 3GTOJ 5C4JJ 3UR3C 4B3XA 4C30A 3D5RC 3FMSA 1YLEA 2Z33A 1IYLA 1RETA 3K2AA 5L3DA 1OCTC 1JHHA 1XGOA 3GCMA 4EJTA 3D67A 2VIXA 3JCUC 2K9HA 4UCMA 1MGTA 3KX2A 3IU1A 3DEEA 3MD2A 3OYEA 2LLKA 1TURA 2UZ3A 4PV6A 2XGCA 3EUAA 1SAUA 3D2MA 3N5FA 3D8PA 3PFEA 2CQKA 3VYUB 1BM9A 1FZPB 2I3CA 3E2IA 4Q38A 1OCCH 1VIXA 1S5LC 1XOVA 3CQZJ 3IU2A 2QLZA 3FKIJ 3EDPA 1V4RA 3WTTC 2KIFA 3I55I 2KT0A 3R60A 4U9YA 3MKLA 3AG2H 2FA5A 2V79A 1BR2A 3QB8A 4CPAA 2QENA 4OIPF 4MFJA 3Q0WA 5GADJ 2GZWA 4HQEA 3R5CA 3D3SA 3S6GA 3K6GA 1OCOH 4LB6B 3EUHC 3RPQA 4KOTA 3VODA 4BACA 4XPKA 8CPAA 5H86A 2UUZA 4W1UA 4D0PA 1FLIA 4RB2C 2AFMA 4L89A 1TNTA 1SMYF 3GO5A 5FUXA 4ZYQA 1ARMA 4EFDA 2WWYA 4UUSB 2A6TA 3RYPA 2HOTA 4MQVA 1IN8A 3RKQA 1Q7LA 3S3NA 4KSFA 4R76A 2IRFG 2FXFA 2V8DA 4Q36A 4R3LA 3FF3A 1LVAA 2D5VA 3IWWA 5CQGA 2KLOA 3HEFA 1Y1VJ 2QVPA 3I3GA 1FNNA 3NWTA 1X3WB 3V4GA 3BWGA 1Z1DA 1MK4A 1G8XA 2P5VA 3W91A 2ZW7A 2IGMA 3PNVA 2VL8A 3PIPF 3MWMA 4MEXF 2ZJ2A 1Z8LA 4BJ5C 3WR7A 2IL4A 2LVSA 4A30A 4YG2F 2ORVA 4DQ2A 1ZG5A 1ETVA 2EH3A 3IAS2 1XGNA 1V54H 4LG3A 1RRJA 2PR8A 5A27A 1D1CA 3IEHA 4ZY2A 2F8HA 1CT4I 1K7UA 2E60A 2ZSIB 1OLTA 4OVOA 5KTDA 4M6YA 4ZDLA 2LEOA 3SXNA 1IRXA 1SMTA 5KTAA 1VI0A 2F6CA 4HNUA 5DUIA 2EA4A 4IHXA 1YX0A 4BBSJ 3FXRA 1YRNB 4A0XA 2HVSA 4BQAA 1ZG8A 1AYEA 2Y48A 3JSOA 4I6ZA 4B8XA 2J8NA 2WY8Q 3HPGA 1TWGJ 2VJJA 3KFWX 2SGFI 2QIRA 4A93J 3FXUA 2JSCA 5KTCA 4Y15A 2EZLA 4HLYA 2PEXA 3E0KA 3LA3A 5F0FA 1W5SA 4IO9F 3WTYC 4LITA 4FD6A 3WT4A 1B9NA 1M4LA 4HX8A 2L4AA 4NSQA 3AL0C 2JQ7A 4CYQA 1QZYA 5AONA 4P4FA 4MY0A 2N52A 5E3OA 5G22A 4PCQA 1VTNC 1ZTRA 2VN2A 4F55A 2PJ4A 2OCCH 5HLIA 1JUSA 4BE1A 2ISZA 1OYYA 4PJ0C 2ROWA 1M4DA 2FMLA 5GTHC 1MD0A 1F4KA 2O9LA 3MN2A 1G2HA 2DW4A 3BCAA 3S3OA 1Z9CA 3HDDA 1BIBA 2V8VA 1FIPA 3PJRA 1ULKA 4P44A 3ZQQA 3E6MA 4AWXB 2LBFB 3BR3A 4ZYGA 2ISYA 3IJ3A 2OH1A 2MLGA 2PR1A 3VPRA 1PJUA 4M3BA 1ZRDA 1M4GA 1OJLA 1BOAA 5EEAA 2A07F 1W7PB 4GRIA 2XUBA 4AU7A 1MBHA 4EEFG 3CPXA 3KZWA 5F64A 1Q9BA 4QB9A 5D6EA 3OYMA 2EIKH 2PVVA 1YYVA 1CP7A 2Z0ZA 2CQNA 2G0EA 4KOUA 2QVOA 2MYSA 4RMNA 4XOPA 5HVQC 1AN1I 5AG4A 2KRFA 3ECHA 4MCSA 2DEAA 2WZNA 2DA3A 5B3SH 5HNFA 1PU9A 1T98A 1ZGAA 2W82A 4HX4A 4V2FA 1XPXA 2CYYA 2DQLA 2Z3LA 2ZEPA 1ULYA 1W7PD 3WE3A 2V6EA 1FYBA 4FUUA 3T5XA 2CV2A 1HKSA 1SGPI 1T33A 1I50J 1SFEA 3VWEA 2EIJH 1A5JA 2GU2A 3WC5A 1YHQI 2HDDA 1A31A 1ZKGA 3A1YA 1N71A 2Q44A 1X12A 3BQZA 2ZB9A 4XNFA 4BAYA 1S5KA 1U5TA 1KU2A 5EC4A 3FHZA 3ULQB 2ECBA 3KYLA 2ZMEA 4P55A 2B8TA 1RO5A 2EJRA 1YREA 4ESFA 1CG2A 3OIPA 3QYBA 4GCVA 4RM3A 4Y4RA 4DYCA 1PUEE 2YPRA 5E17F 2B5GA 2DPDA 2CGPA 1QSNA 4KMFA 1DPUA 2EK8A 4YIRX 2ID6A 2P4WA 1E3PA 3V7CA 4X2TA 1UELB 3H8FA 1XGSA 3KP2A 1HEVA 4OMZA 2EWNA 4KSIA 4PXDA 1P9ZA 5CVJA 5IB9A 4FAIA 3L2QA 1AWCA 3FK6A 2M7BA 5C4XJ 1VKCA 3SHFA 3AG4H 3SJEA 2PJ6A 2CMPA 5FD5A 2RV8A 4H6ZA 2XASA 2JRMA 1KQ0A 2HFHA 3FWEA 2LTPA 2LKXA 3TC8A 4MJ8A 2ZJPF 3SFIA 5C3EJ 2R7QA 3IWZA 3H36A 2GA2A 1TW3A 2O7OA 4C3JJ 3L1PA 1FOKA 3IFEA 4NEXA 3TCVA 4CYCB 3QU6A 4OP4A 3COAC 2B4DB 2YX7A 2JA7J 1TWHJ 3T90A 5F47A 4AG7A 4GDFA 1JUPA 1HDQA 2Z3MA 4H89A 1VGYA 4A38A 3HBLA 3WE2A 1SGYI 3CDXA 3K7AJ 1IN5A 5F09A 1S9HA 3W6VA 4UVAA 4I2OA 2ZKZA 3F8NA 5H2FC 1F2OA 4KORA 5IOYA 3AG1H 4KVOE 2CQXA 1Z5RA 1VQLI 4L5IA 1ON2A 3DKWA 3FZVA 2G7UA 3CXPA 2REFA 1B9MA 2CQ7A 1IG7A 2A6HF 1ON1A 2V6CA 2AFOA 3KLOA 5J6XA 1MBEA 5L3CA 1WSUA 5CLSA 3M3YJ 1S60A 2Y9ZA 3IC1A 2AXLA 2RNGA 3ROUA 1QQIA 3X2QH 3ISPA 2KQRA 2OA4A 4YFJA 5M3FJ 3GTLJ 1ZLIA 4NGNA 1SGQI 2BEIA 4I49A 2QQEA 2FIWA 4UCNA 3F8BA 2DF5A 4IRGA 3TO6A 4B13A 3QP6A 5FFZA 1G3YA 1YFHA 5J1QA 2MH2A 4IZZA 2BXYA 2COMA 1TIQA 4HNXB 4XNHB 3E59A 2YGWA 4MFPA 2D4PA 4F9VA 1J59A 2BCOA 4KOSA 4KNYA 4Y33A 3V7ZA 5K5OA 4XONA 1P2FA 2OCEA 4L0ZB 4JLYA 3C2HA 5CPRB 1KBEA 2H94A 1M1EB 3QWLA 5E3LA 4LMYA 1B87A 5EMIA 3P7NA 4KIGA 4UF4A 1TQIA 5GTIC 2G3TA 5HXDA 2J5PA 2KISA 3ZMZA 1V5FA 3HHHA 3OYHA 1H9GA 1R1VA 1KZHA 2HWVA 2JK3A 4U0WA 3RTRA 5FB2A 5TGTA 1D5VA 3OL3A 2EA2A 4EGZA 4BEHA 1NH3A 1KONA 2LMDA 3BY6A 2KMUA 5F27A 2R5ZA 4FTHA 2JZMA 2IXSA 2PJ2A 1Y9WA 1ZREA 4F0XA 1YSJA 4UEEA 2E34A 5B1AH 3K4LA 5IPAA 2Q4YA 2GLFA 2ADUA 1VFCA 2R5YA 5HH1A 1VQOI 1R23A 2KPMA 1R5ID 4HDVA 3BI0A 4O5VA 1M44A 5F6FA 1Z4RA 5LYFA 1LDJA 2DFFA 3RYRA 2IT0A 2NVTJ 3GTJJ 2BGCA 3CUQC 4CCJA 4U0VA 3HRTA 5J4YA 2P6GA 4AVCA 1Z8XA 2EV6A 2ZENA 4XPLA 2R7UA 2VPRA 2XKOA 4A3FJ 3CC4I 2NVXJ 3H3VK 4ZJZA 1ITYA 4MFQA 3CO7C 4OC3A 1HW2A 4M6GA 2ID3A 3IWGA 3WC6A 4GS4A 4Y17A 5E3RA 1IY7A 2VPLA 4HW0A 4M74A 1ELMP 2KP6A 3CCLI 2AFWA 4R8HA 2YR2A 3HB9A 4C7IA 4I09A 2ZJQF 1REPC 3ZQCA 2QQCA 3H8GA 2PJCA 2Z3YA 1OR7C 4RAGA 3GVAA 2WC2A 4YGOA 1LJ9A 4BY1J 1QSOA 2XRLA 2L8EA 4KDPA 3H3UA 3F8FA 4M3FA 5D4SA 3FX6A 1NSLA 3TL4X 1P7JA 4DJLA 2F5CA 2O5RA 3A0BC 5CKTA 2CG4A 2EILH 2HKOA 2IMOA 4SGBI 3KP6A 1YU6C 5FKLA 1MIJA 1O3TA 1GV5A 3FEEA 2LNBA 1I27A 3Q9SA 3IIBA 2YUUA 2QQ0A 1YK3A 3R0JA 2D1VA 1NXUA 3MCZA 2GVIA 1J75A 5LRSA 3VARA 1L0OC 2QYVA 1VF9A 4IQ4A 3EYYA 5HLHA 1JE8A 2V9KA 3IWFA 1OMTA 3EY5A 1UZCA 5HQ8A 1AMPA 2EO8A 2L54A 4P5OA 2FQ4A 2MA3A 3A0HC 1YIJI 3R9EA 2P5KA 2XF6A 2ZW4A 3S9LA 2M3AA 5B66C 2DA7A 4MMOA 3E5XA 3WTSC 2PJ5A 1RUOA 3R1KA 1F36A 4II2A 3N97A 5IP9J 2ODDA 2AHQA 9WGAA 2XRCA 2QQ8A 5JHUA 2M8GX 2WYRA 2CS3A 2JBKA 4HF0A 3BJ7A 1UG2A 3KPHA 3MN8A 2R7DA 2COBA 3NFZA 1MKMA 4LUAA 4B11A 1LUJB 2P0WA 3R95A 3G1LA 4E7ZA 2R7RA 1HXDA 2NNYA 4MEYF 4XL9A 2AS5F 4F0YA 1UMQA 1WQ2A 3AAFA 5EEGA 2WAFA 2LKPA 1D0YA 3RZDJ 1CT2I 4A0ZA 1O3QA 1XRYA 4UXNA 3R5BA 2OB0A 4HNWB 2LH9A 2VC0A 1U5KA 5E8IA 1IY5A 3TKYA 2IJZA 5F49A 1E3HA 4L9MA 4E0AA 2DK8A 2M5WA 1ETKA 2WB1N 3RSNA 2KRCA 2O61A 2WUUA 4B09A 3PNTA 3CCVI 5J1RA 1SD4A 2HR3A 5LLQA 1PCAA 4NJRA 4E7LA 3Q0UA 4RAYA 3UEJA 4HDUA 4ZYEA 3DTKA 3RDIA 1YITI 3ISXA 2B0LA 2A61A 3H3ZA 3BT9A 5FJ8J 3CZ6A 2VQLA 4YRVA 4C3IJ 2VLAA 2DPSA 1R00A 4N4NB 4ZYAA 4D5CA 3I59A 4QBJA 4B44A 3CXQA 5K7HA 1DGRM 4BHCA 3GTPJ 3FX3A 1FYKA 5TRDA 2BW3A 1SD7A 4G6QA 3H5NA 1SD6A 1GXQA 2W4SA 2GXBA 3I5UA 3ERMA 1LCPA 5B1BH 1DP7P 3LACA 2W25A 4E7KA 5E1ZB 7WGAA 5LBQA 2Q4ZA 1TOTA 4OKOA 1NK3P 3OYDA 4C7HA 2JA2A 2XRNA 4ESJA 1KUYA 2LY2A 1OMIA 2RKHA 3GMEA 5H6QA 2HXOA 2X6OA 2AE6A 1DP3A 2BVMA 3WU1B 3DV8A 3WTUC 3EETA 2Y9YA 3G8WA 4NQWB 5BWAB 2HKXA 3ERED 3FEDA 1D0XA 5GAEJ 4ZX9A 3WG9A 4UV9A 3BJAA 2JMWA 3GUXA 4NXYA 3JR9A 2N1AB 5IV0A 1P4XA 3KYDB 3RKXA 4HF2A 4XNHC 2QPOA 1U5TB 1UVGA 2ZMEB 1FIAA 2PMUA 4P1WA 2CNSA 5CCMA 3H1CA 1CPXA 3FXQA 5FUVA 2DIPA 3CT9A 2D4OA 2H1LA 3BR5A 3IRQA 4RI1A 4E7IA 2LB7A 2B5GB 2QQDA 4NGRA 2GWRA 3F0AA 3B7IA 4C2ZA 4F7ZA 3R9FA 1X3UA 3SI2A 4MCPA 3DBHB 3HIFA 4F91B 2DPTA 1X74A 2OTLI 2VKEA 3E1SA 5GPCA 1HDDC 3TGNA 2R92J 4F93B 2E2HJ 1OQYA 4B5PA 3SEZA 2QQAA 3E6DA 3OOUA 1EA3A 4CDGA 1ULNA 5HS8A 3B4VC 3GWZA 4IEJA 1VHEA 3CCUI 4MRIA 3K2KA 2XEGA 2X1EA 4RAZA 3W6KB 4KN4X 3WHCA 2KRHA 4IUSA 2LG4A 1BPMA 5HS7A 4CGNA 4JYWA 2RAEA 1ZG1A 5FUWA 5F04A 2OAZA 3PB8X 4KIBA 3TEDA 2Q7SA 1U6GA 4FISA 2GXGA 2O8XA 4EV0A 4XIDA 3SEQA 4MHPA 4XICA 1FEXA 2GKRI 3DU6A 2Y0SA 3HYIA 2IQ6A 3JREA 3TOBA 2REEA 3SJXA 1OKRA 4FT8A 2WPWA 6CPAA 1QHHD 1BW6A 4HSRA 1JKPC 3ABMH 4HYEA 4KIFA 5I4MA 1YQAA 2ELKA 4UUVA 1VZ0A 4EM2A 1A36A 2KCXA 3HKZA 1Y0NA 5BNGA 4EVIA 2XF5A 1KGSA 4RB1A 3P9KA 3DBRB 1RXTA 1IRFA 1USSA 1CT0I 5JVGF 5FLVA 1IB1E 2HYGD 2OQRA 2PX9A 3E97A 4OWRB 5TJJA 3T0YA 2BVLA 1TQPA 2QBYA 1P9GA 1KYZA 3S16J 2L3DA 3LOCA 1ZG9A 3BLNA 3K9TA 2Z9OA 3PO2J 2NOJB 2RB7A 4BBRJ 1MNEA 3ESWB 1VQ6I 1YR0A 4LK0F 4CRZB 3V8LA 5M3MJ 3QRFF 3RZOJ 4P4JA 4G7HF 4A37A 3S14J 2V7FA 5AGEA 2L9RA 3R5AA 3BCBA 1EKEA 3AG3H 3PO3J 3F6OA 3JRFA 2JDDA 3S9MA 4PXEA 4A5MA 5C82A 4IF4A 2KKOA 3CDHA 2KDOA 1S29A 4EJOA 4CCNA 3R5DA 2PLYA 2F3CI 2Z5UA 4P4BA 3D7DA 3ML6A 2YNCA 5IT9Z 5DS9A 4AIKA 4ITVA 3SZGA 1W0UA 5J40A 1MSEC 3OS2A 2R7HA 2KZVA 5J1YA 2DT5A 4D5FA 2KMRA 4B3AA 5H84A 5BPIA 4BEHB 3K70D 1EH6A 2DJIA 2R5ZB 1UAAA 2R7VA 3MKZA 1S3JA 2HQ5A 1CJWA 3FF5A 4IPAA 2CWHA 1I21A 4XSZF 1XGMA 2QM3A 3FXLA 1XF8A 3FISA 3VATA 5DCMA 4BINA 4JOMA 4R6TA 2P6TA 2AFXA 3F0CA 3NE8A 1N78A 3BZ6A 1G3WA 1LNWA 2YS9A 4A3CJ 5EDNA 3CZXA 2BV6A 5IOZA 3OV8A 4BYYA 1MDMA 5HDKA 1HEEA 1OPCA 2FBKA 1XX6A 1K83J 3IH3A 4C2XA 2FSRA 3FXJA 1Y0YA 2NRAC 3UY5A 1G6NA 4ZZDA 4PK3A 1HW1A 4MFKA 4ZX8A 4A6EA 2M30A 1A6IA 3FSYA 2V77A 2ZEMA 2DA5A 4FD5A 1WFXA 1CGPA 2BSWA 3PFOA 4UWIA 2VEZA 1XX5A 3ISZA 5AG5A 5TISC 2WY7Q 4Y49B 3T9YA 4CCMA 1IXRC 4S0HB 1KQ8A 2DTRA 2FD5A 2PJ9A 3ASOH 2FOWA 2XAUA 3WTXC 2JT1A 1BO4A 5BQTA 1S7NA 1SGDI 3UGLA 3W6SA 2CUEA 1U0JA 1R1UA 1K6YA 2EK9A 3JVNA 3F72A 2E73A 2OF7A 1Z2IA 2E35A 1CP6A 1RR7A 4UFWA 2CSOA 1PP7U 3CCJI 2DB6A 3DGVA 3LFUA 1G3SA 4AVZA 2XIGA 2OZHA 3IWEA 1ACIA 1ZO0A 3BG6A 3SFZA 3ZMDA 2OUMA 4X8IA 1MJBA 3DQVC 2VT2A 5IYBJ 3HSFA 2MSYA 3LAPA 3LQQA 3HOTA 2I00A 3G3ZA 1TL8A 2M9HA 5CYVA 2E36A 1MMAA 2WTEA 1UB9A 5D5WB 5M5XJ 1OMUA 1U5TC 1Y7EA 1ETQA 2DO7A 2ZBKA 4ZZLA 2ZMEC 3DFGA 3B2YA 4PJNA 3GEZA 3PP9A 4QWQA 1H0MA
chains in the Genus database with same CATH topology
4CYOA 3KEOA 4A95A 5J8FA 3I54A 3V8IA 4N9HA 4M72A 3ELKA 5DUKA 4L0YB 1YS7A 4UFXA 1TTYA 2OBPA 2JEVA 4YFXF 2H5MA 3F5BA 3O6BB 3F22A 3P9CA 3NEUA 5ERIA 1O3RA 1MJAA 1R58A 1QNTA 3HRMA 5ICGA 4ONUA 2EFWA 1QGPA 2GA1A 3ZJ0A 2Q2EA 2DI3A 4LK1F 2A68F 2H6BA 5ED4A 4L9NA 1ZRCA 3I59B 3TO7A 4KUBA 1J5YA 3GF2A 2UZKA 1ONVA 4MHDA 5LHGA 5K5RA 5D4RA 1XB4A 4QVTA 2PFBA 3RIRA 3GLXA 2UXNA 2GQQA 4ENNA 3FNCA 3CXSA 2CO5A 4OIOF 4EGYA 1P92A 5IT9K 2C27A 2HUZA 3QPHA 2YNEA 5E18F 3D5LA 1Z4EA 4AVBA 2VXZA 1YLFA 3ZN1A 2FT0A 4A33A 1BI3A 1FYLA 3ZN0A 1GHCA 1IXSB 3T1BA 1L3LA 1E17A 1W5TA 3G3SA 3QAHA 3ABTA 2NS0A 4AIJA 5LGNA 4CAEA 2FL4A 4KA4A 4ZBGA 1ZRFA 2PI0A 2VXKA 2FNPA 1ZN2A 2HZTA 4S04A 4OOIA 2HOEA 4TV7A 3GFIA 5G21A 4B5PB 2CWEA 2EB7A 1CM0A 2RN7A 1J4JA 4KSAA 4R9MA 1HQCA 4RB3C 1T38A 2VBQA 4KUAA 2V1UA 4JK1X 4A31A 1K6OA 3E6BA 4HKFA 4NF1A 4C68A 3DR8A 4A12A 4ON0A 3JW4A 3DDDA 2WSAA 3R9GA 4O6JA 4Y49C 4CGMA 2VBWA 3LODA 4KYWA 3V8KA 2QBYB 3C18A 3ZMSA 2G7HA 4IVNA 1YTYA 2P7VB 1NMTA 4KLWA 1RI7A 1W4MA 1QSMA 3I4PA 2J5OA 4B10A 4I01A 5K1YA 3HTSB 2BE5F 3W6JB 5AIQA 1S7LA 4PK2A 4HBLA 1S7KA 2D1HA 2P6SA 3S6HA 5CNPA 4IJAA 2K86A 4UBRA 4HNYB 3IL2A 2P6EA 4PZJA 1J2XA 4G8XA 2X4HA 3GYAA 3CO6C 3GZ6A 5F46A 2DXQA 3B73A 2ZO4A 3R4KA 3FYNA 3KP3A 4OIQF 4JD6A 4A32A 3V8JA 3C7JA 1IAWA 4N0BA 4QC6A 2FRHA 5DCMB 1KZFA 4UV8A 3L2CA 1J9IA 2O03A 4A2ZA 1MDMB 1Y9KA 4KMUX 4XLNF 1HSJA 5L3BA 4CAVA 5LEKA 5G1ZA 4MFLA 2OQGA 3GX4X