1FY7A

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
273
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ESA1 HISTONE ACETYLTRANSFERASE
publication title Crystal structure of yeast Esa1 suggests a unified mechanism for catalysis and substrate binding by histone acetyltransferases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 81
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fy7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1fy7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1fy7A02
3CXQA 1Z1DA 3RKYA 5HLGA 2L3DA 2CY2A 3W6SA 1G3YA 4PCQA 2REEA 2K4BA 5DDGA 1S7AA 2X4HA 2Z11A 2K5TA 4R9MA 4LG0B 4H0EA 4LX9A 1KGSA 2FIWA 1Z9UA 3ISPA 4CS0B 4EJVA 2NMTA 1CF7A 2I79A 2ZPAA 3GYAA 4L8AA 3FM3A 2FU4A 4CYDA 1Y9KA 3TOBA 2P6TA 2QYOA 4PSXA 4CZZA 3EO4A 1HKTA 3BPXA 2OU2A 4MQ9F 2ZNZA 1LJ9A 4CDGA 2PMHA 1YR0A 2ADUA 1DPRA 4XLPF 2BEIA 3ML6A 4R57A 3WE2A 2FMYA 1S60A 1BO4A 1PDNC 2HFHA 4RB3C 2B58A 3SFZA 1IN7A 1UHWA 4KYWA 1JE8A 3BJ8A 4PK3A 1WWXA 3O2PE 1MK4A 4G6QA 1R5HA 5CLSA 3C3WA 4HQMA 5D4RA 2EJRA 4H89A 3V8KA 1QSTA 4GGGA 4KIBA 4L5IA 4H6UA 2OB0A 3I5UA 2FNPA 5D8KB 3HUGA 2HZTA 2P7CB 4IPAA 1CM0A 4ENKA 1IW7F 2DAOA 2UWMA 1KQ0A 1ZN2A 3W6XA 2WC2A 2MH9A 3V7RA 3M7GA 2Q8KA 2E1NA 2PFBA 3DQVC 4ZH4F 4OADA 4UV9A 2XKPA 5H86A 4AVAA 4IHSA 1WKMA 2W85A 3FMQA 4KOYA 4IVNA 4M9ZA 4NCZA 1IZ1A 1QZZA 4OU0A 4ESFA 2Q04A 2ZW6A 5DWNA 3EYYA 2EV5A 3SXOA 4ESBA 4FD5A 1RUNA 2M30A 4LB5A 3FIXA 2A61A 1M1DA 4KN7X 2J8MA 2ZBKA 1S5KA 2EFNA 4MHDA 2HOEA 2B3VA 4EM0B 4LLLA 3F8NA 1O7LA 4U0WA 1I1DA 1M4GA 4A5MA 3DXJF 1J5YA 3FWEA 3FB3A 2XVCA 2MLKA 5E18F 2FBKA 5IX3A 1XF8A 3FXRA 4OMZA 3ZMDA 2OQRA 4I01A 1M44A 3ULQB 3FNCA 2YR2A 5FFZA 2IPQX 1J4JA 1Y9WA 1QO0D 4JXRA 2LKPA 5FO5A 1XCVA 1LDDA 5F1RA 2HUZA 3EY5A 5EEGA 1SD6A 1YVKA 2FEZA 3WGGA 3LD2A 4EJOA 1GXPA 4M73A 1EH7A 2JTVA 2ATRA 4QUSA 3E5QA 1S7KA 2FL4A 4YIFA 2JDDA 2JDCA 2IA1A 1F4KA 4L5JA 1B1BA 4KICA 3IWFA 3W6JB 1PUEE 4UWJA 5AIPA 4E8OA 1W7PB 2VODA 3DPLC 1V3FA 5J6XA 4KN4X 1XE4A 2NS0A 1AOYA 2VEZA 5D4SA 4L0YB 2B4DA 4NF1A 3CUQB 2CG4A 2C6YA 1Q2YA 3REOA 1J2XA 1O57A 4NSQA 1U2WA 4AD9A 2HV2A 2G7UA 1JHHA 1XN7A 5JPHA 2BGCA 4N9HA 3VODA 5FD6A 4BQAA 2FBHA 2RQPA 4L9TA 3ZMTA 4XNHC 4KIFA 1I6XA 4ZZLA 1GHEA 3IKTA 2PR8A 3SHFA 1YW7A 4ZZDA 1D5VA 3K1MA 3F3XA 4ZYEA 2CYYA 3R1KA 4BNCA 4JD6A 3HSEA 3V8IA 1O3SA 1GXQA 4UBRA 1WRJA 1KUXA 2Q4YA 5D5WB 2O3FA 2BSWA 5JQ4A 3AAFA 2NNYA 2R8VA 5D6EA 4CRYB 1REPC 4LG0A 4Y49B 3KLNA 1W5TA 2K02A 1QPMA 2FSWA 2P7VB 4HX7A 1P0HA 5HMNA 4XRFA 5ICEA 2PJPA 1IUYA 2ZO4A 4UV8A 3S6HA 3ZN0A 2EWNA 4L9JA 5LBQA 5CJ9A 3DPTA 1L3LA 2GA2A 5H20A 2Y0MA 2HGCA 2NRAC 2LF7A 4OAEA 3TQNA 3SZPA 5F64A 1TQMA 3PZJA 2OQGA 3ABUA 1U8RA 4RS2A 3BJ6A 1SMTA 1LDJA 2FE3A 1U78A 2WWYA 3TDZC 2XHKA 4S04A 2W84A 1FOKA 3WTWC 4HNXB 2ZW5A 2F2EA 4A0YA 2QMLA 3WR7A 1JHFA 1KUVA 3F6VA 3GKRA 4LK1F 3I59A 5L3FA 4KOUA 2J8NA 1P4WA 4P9FA 3E97A 4UXNA 2O61A 2GWRA 2OZGA 1P2FA 1BBYA 3F0AA 4A0ZA 1S29A 1P4AA 4KA4A 5FLXK 5K5QA 2VQYA 4I02A 3LSTA 3WTSC 1CF7B 2W24A 1UCRA 2LDUA 1Z6RA 2DO7A 2M45A 1ZAOA 3O3KA 4RI1A 3HRTA 4IXAA 5HOOA 1KQ8A 5EEHA 3DNSA 4KZTA 5TRDA 4OINF 3P9CA 1YREA 3Q5FA 1YGHA 5DEQA 2HS5A 4FD4A 3TTHA 3K2ZA 3I58A 2AXLA 2Q44A 3WG9A 4M9SA 1KYWA 4P9UA 1T38A 4U9YA 2QECA 3LQRA 2GIVA 5DUIA 4OIQF 1FY7A 5E1ZB 2A68F 5ICFA 2LNBA 2QWWA 4U0VA 2CNSA 2PRBA 3RPQA 4EGYA 3KP3A 3L09A 2VE9A 4KOTA 3T90A 5LEJA 4Q4ZF 4LMYA 5IV0A 3PQJA 3HTSB 2XV4S 3H92A 4A2UA 1BN5A 3KZYA 1ZLJA 2P5LC 5LRSA 3KFWX 4PSWA 3IRRA 3CO6C 4BYYA 4EGZA 4EJTA 4KVXA 4U0YA 1L0CA 2F5IA 2BUEA 4CAVA 1IXCA 3MCZA 3K9TA 3WE3A 5ISVA 1MKMA 4MQVA 1K79A 4LFUA 1S7FA 5D5XB 1S7LA 3F8FA 5H84A 2HTJA 4HDVA 1FBUA 2MD5A 3MZHA 1I12A 4M72A 4RGXA 4PDKA 5LGNA 4BH9A 3D5LA 1FBSA 1XSXA 3B73A 1Q2CA 4ONUA 4E2AA 3E3VA 1ZG5A 2M1BA 3RIRA 2OBPA 1MZBA 1G6NA 3DSBA 3HTUA 1FSHA 4B8XA 2Q2EA 4AIKA 4BMHA 2DK8A 3K0LA 3VEPA 1Z4EA 2IA2A 3E6CC 1YVOA 2ZKZA 5C82A 2MA3A 3KP6A 1J9IA 2B4BA 4AWXB 3CUQC 4XSXF 1TBXA 1P92A 4EV0A 3KP5A 2COMA 1O3QA 1SAXA 2DXQA 5FFXA 5LHGA 3J80K 3JSPA 1YFHA 5DYMA 1DDNA 2Z99A 4HX8A 2G7HA 1OYWA 3KP7A 2HTSA 1T0FA 3GO5A 3RDIA 1B87A 4AVBA 1YW9A 2LSOA 4RB2C 2CFXA 3I3GA 1W7PD 2HQYA 4I49A 2Z33A 3LQQA 1UFMA 2H6BA 3F72A 1RUOA 1BI0A 4MY3A 4JJXA 1XEBA 1LRZA 4LLGF 3GFMA 2HR3A 5F46A 3MZYA 1R22A 3H3ZA 5L3BA 4LUAA 4R79A 1I1GA 3EYIA 2EV6A 4Y49C 2PI0A 4DQ2A 4M6XA 5KTCA 3VWEA 4LGWA 2EUIA 2VE8A 4PGHA 1K6OA 3JW4A 5E17F 4Y13A 3ZPLA 4Q48A 3FYNA 3D0SA 2CNMA 4KIGA 6PAXA 2QUFA 3L7WA 3TKYA 3DR8A 1O3RA 2PG4A 3LA3A 1Z9CA 4WXHA 4KVME 3L2CA 4PGGA 4JBAA 5EC4A 2R7HA 4M6YA 2P6EA 3P9KA 2VZYA 3QPHA 5IB0A 3EUHA 1KU9A 3RKWA 5LHIA 1ZHFA 3R6SA 4MEYF 5BQTA 5D5UB 3WU1B 2EFWA 4BHBA 2UXNA 1YW8A 4M3SA 1IXRC 3D8PA 1K78A 2QBYB 3SQNA 4UA3A 2NYXA 1R7JA 1FBQA 3MEXA 2HQRA 1D8KA 2AS5F 1TQPA 4O3MA 5ILSA 1S8NA 2M5WA 3TFYA 1KU7A 4F0YA 5JR3A 2QQBA 1S7OA 5HS9A 2IL4A 4R3LA 4QB9A 3I59B 4ZYHA 4RAZA 2FS5A 4EJUA 4LJZF 1FLIA 2D4OA 2ACJA 2ZNYA 3VFZA 4XSZF 2GXBA 1IN6A 2L4AA 2V9VA 1G3SA 2Y48A 3LFKA 1MJ9A 2F5CA 2Z0ZA 2CNTA 4M71A 2Q0OA 3WGHA 1EV7A 2L54A 4ASNA 2RNJA 2XUBA 2F5FA 4ENNA 3N97A 4A6DA 3U1DA 3QU6A 3BP8A 1WK4A 3BDDA 4EMSA 3FHZA 4Q47A 4I0AA 2PMUA 1P6RA 5IT3A 1IN4A 3N4MA 4ESJA 3VWDA 1Y0UA 4UVBA 5CYVA 4M74A 1R36A 1E17A 4TV7A 2BEOA 3JAMK 4A5NA 2IW5A 1MD0A 3UY5A 1ON2A 1H0MA 4L0ZB 2XAFA 4KT5C 2QLZA 1A04A 3S6KA 1FX7A 1YLEA 3PQKA 1RI7A 3QPTA 4OLLA 5E20A 2V6CA 3FBUA 1HSJA 3FRMA 3G3ZA 2HYFA 4KLVA 1BI1A 3J7AO 2P6SA 4BHCA 3T0YA 2RC4A 1Z7UA 3EETA 1P4XA 4U5YA 1SFEA 4HOBA 1FC3A 4HDUA 2VN2A 4L89A 2DFIA 2CQKA 2VONA 1VKCA 3ZQ7A 2Z3YA 2HEOA 2MLGA 2P8TA 4GCVA 1S3JA 4XPDB 4WK8F 2D45A 3SXYA 3FMRA 2DT5A 1I21A 5HVQC 5HLIA 1B6AA 2E7WA 5JFRA 3E5XA 1FP1D 4Y15A 4EJWA 5F49A 3ZJ0A 2DK5A 3K1NA 1ON0A 1OYYA 2EVNA 2STTA 1UB9A 3VOEA 2HDCA 3TO6A 1ZH5A 1S3ZA 3ZN1A 4KUAA 5GCNA 1FYMA 4G6DA 1FYLA 2B0LA 1Z05A 5EBVA 2L01A 1BOBA 1BI3A 2KJCA 2B5GB 4U7DA 5ILVA 1FT9A 2L02A 3MWMA 3RI4A 1L0OC 1QQIA 1HBXG 5HH1A 4XLNF 3E6MA 4KDPA 2REFA 3G3SA 4ON0A 2O0YA 2A5YB 3ECHA 3BLNA 4NEXA 2ZJ2A 2Z5UA 1ZLKA 3DR6A 2VT2A 3WTVC 2DI3A 1WSUA 3FMSA 3TT2A 2MH2A 4L18B 1TW3A 4XBFA 2M87A 3JTHA 4JK1X 4B5OA 2PN6A 1IXSB 2JT1A 4LLNA 3F8MA 2CGPA 2FRHA 1MDMA 3I53A 3VB2A 1JXSA 2A6HF 3F8CA 3R61A 4HLXA 4EQQA 1TNSA 3RYPA 4HF1A 4HNWB 2VBYA 2EA4A 3J80Z 5DV5A 3PFIA 5D8LB 1R1VA 2LF8A 2MC3A 5CVUA 2QBYA 1YX0A 3K9UA 5DD4A 1U3EM 1VHSA 5F6FA 2QQ9A 1O7FA 5HLHA 2H94A 1CJWA 3U2RA 1LNWA 2PBIA 2R7FA 1QZYA 4KFCA 4RGRA 5JI6A 3KZZA 2XAQA 1YO5C 2VI7A 1ULYA 3J81K 1IAWA 1LEBA 4AG9A 4BHPA 2V1DA 1IN8A 3EC4A 3GY9A 4ZYDA 3K1PA 3FXUA 1J7KA 1SFXA 3LAJA 2O8XA 1R58A 1ZRCA 1U5TB 1C0WA 2YU3A 1LVAA 5E8IA 5ED4A 2ZXVA 3BZ6A 2PQ8A 1CGPA 1VTNC 3TE4A 1BIAA 5J8FA 1W4MA 3WTYC 4HNYB 4JLYA 2WPXA 1XMAA 3LA2A 3DKWA 3M8FA 5L3EA 1TIQA 1IRFA 1PP7U 1K78B 4DNCA 1I5ZA 4RB0A 2KIFA 2G3AA 4BAYA 1UHMA 3C7JA 2IVMA 3WGIA 3GFLA 5FB2A 3GWZA 2GA1A 2P4WA 1Q2DA 2Y75A 2EV0A 5HDKA 1UFHA 1B4AA 1LEAA 1SD7A 3F23A 2HWVA 3T8RA 3HOSA 1KA8A 3I71A 4UVAA 3IC7A 2ZMEB 1XB4A 2OH1A 3WTTC 4UVCA 1YYVA 3KETA 2WPWA 2K7LA 3WU0A 4YFXF 2KCWA 4H6ZA 4AVCA 3BPVA 2UZKA 3DP7A 3JTGA 2OAZA 4M85A 2GQQA 4ENMA 3QOPA 3C1DA 2M8EA 5LEKA 3TO9A 2JLMA 4GXOA 4Y17A 2ISZA 4E70A 1R23A 2G3TA 1R1UA 5BS6A 4N0BA 2EFOA 3Q9VA 1LQ1A 1MJAA 4CRZB 5BPIA 1IICA 4IJAA 4RB1A 1R1TA 4XPKA 3R9EA 4PK2A 4Z2YA 3F6OA 3NEUA 3GEZA 4AVPA 3EQLF 5LGTA 1IIDA 3KLOA 3GW2A 4A6EA 4L9NA 4KOXA 2HKXA 1B9NA 1J0RA 2ELHA 4OIRF 1MJBA 1YK3A 2B5GA 4KORA 4RGSA 4IRGA 2CW0F 4WWCA 4XPDC 3KP4A 3JAMZ 2V1UA 4BXUA 3ZMSA 1SD4A 3BOQA 1DUXC 2FA5A 4WCGA 3I0TA 4OIPF 1R00A 2QM3A 3DF8A 2IT0A 2RN7A 1KUYA 4RGUA 4MTDA 3MAJA 4AIJA 2EFPA 4G9YA 3R0JA 4R87A 2R98A 4I7HA 2Z9OA 3CXPA 4IUSA 3KCCA 3P2HA 2P5VA 4ZBGA 4HX4A 2DLLA 1YLFA 3TO7A 2JEVA 1TNTA 5CVIA 3K69A 4HW0A 4JXQA 1IN5A 3HRUA 1KQ9A 2J5PA 2WTEA 2IJLA 4CGZA 5LGUA 4CAWA 2CSOA 5LRRA 4PV6A 4LK0F 3TOAA 2WV0A 4L9VA 1LDKB 1S7NA 4F6AA 3B8GA 2IRFG 4G7HF 2PR1A 2XGXA 2G9WA 3G73A 5BPDA 2EA2A 3IWGA 2KKOA 4G94A 3V8LA 3F8BA 1SFUA 3JUWA 4LB6B 5ILUA 3I54A 5I0CA 2RGVA 1I1SA 1KYZA 2KRFA 4YG2F 3CXSA 2VBQA 2OZHA 2ESHA 3NE7A 2EFQA 2X0LA 1M4DA 3ZMVA 3FM5A 5AIQA 1SMYF 1U5TA 3I64A 5IT9K 4QC6A 1FSEA 1DP7P 3CLOA 3HYIA 4HA8A 4FT8A 2ZFWA 2IA0A 4II9A 1MDMB 4I98B 2VXZA 5E1XA 3GFJA 3QP5A 4EVIA 2OZUA 1DPUA 3KP2A 1YQAA 3T9YA 1U6GA 2VXKA 3DEUA 2NAZA 3BY6A 1T98A 2RDPA 2FSRA 1PU9A 1XGSA 2FT0A 5DCMB 5D6FA 3GF2A 5FVJA 1ON1A 4K2EA 2TDXA 1OPCA 2EB7A 1HW1A 1EH8A 1KU3A 3E6DA 2FQ3A 3HHHA 1U5TC 4PZJA 5TJJA 2FXAA 1BM9A 5HS7A 3COAC 1OZPA 2ZMEA 3JVNA 4CO8A 4GYGA 3E0KA 4MEXF 5DWMA 4QLCU 1HKSA 4A0XA 2X7BA 4KOWA 3HRMA 1XGOA 3WODF 1J59A 3HRSA 4R1HA 3DV8A 2D4PA 4RAYA 4GS4A 3E6BA 3I4PA 1XMTA 3J81Z 3R9GA 3MGDA 4JWPA 2PSWA 1HSTA 2P5KA 3F22A 5F48A 4FX4A 5A2QK 2QIRA 2DW4A 4ETSA 3V4GA 2D2WA 2V1XA 1ODDA 1TW2A 1SQHA 1V0CA 5HDNA 1HXDA 4GYIA 3V7SA 3IL2A 2YSRA 2P6GA 5BMZA 1RO5A 4YFNF 5FLXZ 2ESNA 3H4QA 1Z4RA 1FP2A 2GZWA 2FXFA 5FD5A 4KNYA 2A69F 2DPUA 3GYHX 3GUDA 4QWQA 2A4NA 2VT3A 4MI4A 2GAUA 2ZXJA 1XMKA 5KTDA 4LD5A 4AG7A 2Z10A 3M8EA 5KK1A 1QSRA 3SHPA 4UNOA 3LWFA 3HSFA 2DPDA 2ARHA 3W6KB 3RJPA 2KIMA 4S05A 1ZGJA 2A6EF 3KEOA 3T8TA 2FOKA 2D1VA 4CXFA 5AONA 4G8XA 3Q9SA 3IWZA 2QVOA 1YTYA 3KEQA 3H3UA 3QAHA 2A07F 3R9FA 2V79A 4WF2A 2XASA 1BC8C 1BIBA 2H09A 3BWGA 1O3TA 3FXQA 2HQNA 3BJOA 3RKXA 3E5UA 3FZVA 2XROA 4CHUA 2R3SA 3QRFF 3P7NA 3BJ7A 2CWEA 1W5SA 5JVTA 4X5KA 1G4DA 3HIFA 5JHUA 1F5TA 2G0BA 3CTAA 3GZ5A 5K5OA 1HKQA 3M9AA 3F21A 5E96A 1ONVA 4YIIA 4B5PA 4ORFA 1NHAA 2FBIA 3ELKA 5DD8A 3C26A 4G7ZF 2OZ6A 1K7AA 3MFKA 4YFKF 4P55A 1X3UA 4HBLA 2RVCA 5H6QA 2BBYA 5LLQA 4Q5SF 1XIXA 4O6JA 4HQEA 4QBJA 1WI9A 1IYLA 1QGPA 4HV5A 2Q4VA 1OYIA 3MQ0A 4CICA 2GE3A 1BI2A 1RXTA 4HYEA 4FD7A 4IF4A 2GXGA 2QZ8A 4M9XA 1BOAA 3FXTA 1NE9A 3P2FA 2DQRA 3HOTA 4KMFA 2VC1A 4A12A 3T5XA 3R4KA 1OR7A 3R0AA 4HAMA 4NQWA 3W91A 3CDHA 2O03A 2XAGA 2PEXA 2F5EA 2Q7BA 4ZYGA 2O6GE 3GVAA 1M4IA 3PP9A 3ERED 1E2XA 3HSRA 1KU2A 2W57A 1J75A 2JZYA 5E1WA 3OWCA 1XDUA 2JRTA 3U9GA 3LODA 1OKRA 1XSDA 2BV6A 4YRHA 2STWA 2Q0YA 1OMIA 5FGMA 2KJBA 1Y7RA 3KE2A 2I00A 3P9IA 4R8HA 1HQCA 1FZPB 4IRHA 3IHUA 2H5MA 3GXOA 3S6FA 1KZFA 2A3SA 5DCMA 4O5VA 3SZTA 1USTA 3ECOA 2XIGA 5L3GA 4I0BA 2P0WA 3M1EA 5E8GA 4WXDA 4AB7A 4RS8A 4IRIA 4FHTA 2E1CA 3R60A 5F47A 2OA4A 1ZRDA 2CO5A 3DFGA 2K4JA 5J8CA 1N71A 2DBBA 2L4MA 2PC1A 3EXNA 3JSOA 3RYOA 3QU3A 4OIOF 5CVJA 2XAJA 2BYVE 1K4JA 1H9TA 2YPRA 4I2OA 4U7BA 3O6BB 1SD5A 4EVYA 1HW2A 2R7DA 3G8WA 2MBFA 4EM1A 4R3KA 4G7OF 5L3DA 2W25A 1NSLA 2ZCWA 3I9SA 2PLYA 1BJAA 1ZG3A 3HHGA 4XPLA 4YFJA 4MGRA 1QSOA 4WX9A 2H27A 2P6FA 2R1IA 3DDDA 5L3CA 1XDSA 3RYRA 1IF1A 2YX7A 1Z6TA 3WTZA 1I27A 1ZGAA 1T39A 1MGTA 1RNLA 3D2MA 5IT9Z 4P5OA 2FIAA 1LB2A 3QP6A 1G3TA 5C88A 4HZFA 4HKFA 1XGNA 4I09A 3V7CA 3ABTA 1YG2A 2VC0A 2VBZA 1T6SA 3C18A 5ERIA 5LHHA 3CJNA 5ICGA 3GLXA 4KLWA 1XD7A 1FNNA 1XCBA 4UUVA 3S2WA 3PGPA 3QB8A 5CNPA 1ZRFA 3FX3A 4OOIA 4KOSA 1ZYRF 2C27A 2NNNA 3B02A 3GX4X 1H9GA 2K86A 2OD5A 1GVJA 1YS6A 2B3UA 4MJ8A 2VBWA 1R57A 2YX4A 3TCVA 3T1BA 4MY0A 2XAHA 3FF5A 2E7XA 1WWZA 1JGSA 2JPBA 2AE6A 3RTRA 2XRNA 4KMUX 1BC7C 1F1ZA 4ENJA 4IF5A 2GANA 3SXNA 1ZARA 5K5RA 5KTAA 1Q1HA 1YIOA 3CO7C 5KVRA 1WQ2A 2H6CA 2ISYA 4F7ZA 1D3YA 2DTRA 1B59A 4IHTA 1GHCA 4KUMA 4EM2A 1QSNA 2RKHA 3F5BA 3R95A 2ZW7A 3OV8A 5K1YA 2UXXA 2BE5F 4P96A 5A2QZ 2JSCA 1IYKA 1W7PA 5H6RA 2QQAA 1ZG1A 3TDUC 3OOPA 1XGMA 1P4NA 1YS7A 2IP2A 1PP8F 3LA7A 3CUQA 2J8RA 1Z91A 3BROA 4J3GA 1IRGA 1QBJA 4HF0A 4HLYA 3ROUA 4U9ZA 1RZ4A 3GZ6A 2O28A 4AIHA 4N9IA 4U88A 3EFAA 4NXYA 2FCKA 3ZP5A 4MBUA 3IGRA 3ZMZA 2HKOA 5CVVA 3ZMUA 3WTXC 3F8KA 1QNTA 2KIUA 1V4RA 4HF2A 1HW5A 1ZREA 2J5OA 3LAPA 3L9FA 4D0PA 3S6GA 5DUKA 2VZZA 3N7ZA 3RPUA 4B09A 2FE7A 1STZA 2JPCA 1FPQA 2QENA 4NB5A 1USSA 3BJAA 1QSMA 2BL1A 1S6LA 1G3WA 4MHGA 4CAXA 3IKVA 4NHJA 4K30A 3CUOA 4XNHB 4UHTA 2RV8A 2FMLA 1TQIA 2VBXA 3R96A 1FYKA 1RIOH 4HV6A 1TLHB 4FD6A 1TTYA 1IB1E 1FWZA 3WTUC 4JQFA 1PUAA 2F5DA 1F9NA 2FNAA 4UWIA 4MNUA 5CVRA 1D8JA 4OMYA 4QVTA 5BOXA 4B5PB 3TGNA 4E0AA 2VOPA 3IRQA 3EDPA 4WXCA 2B4DB 1EH6A 1U6MA 3KKWA 1AWCA 2XKOA 3L00A 1B9MA 3NRVA 2VOOA 2ZW4A 4MTEA 4YGOA 4FX0A 3D2PA 2EK5A 2ETHA 3NQOA 2FF4A 5D5VB 2HYGD 3D3SA 4KOVA 1NMTA 2D1HA 1R5GA 5DCFA 2DQLA 4GO1A 2AJ6A 3V8JA 2DU9A 2K27A 4KVOE 3GFIA 2PDOA 1XSVA 1B6BA 5ICCA 5HDGA 5HS8A 1T2KA 3ZZIA 4KUBA
chains in the Genus database with same CATH superfamily
2EZIA 2IGNA 4BQNA 1SC7A 3CXQA 1Z1DA 3O8HA 3RPUD 4XKBA 3RKYA 5HLGA 4CGMA 2L3DA 2CY2A 1MBFA 3W6SA 2WAEA 1G3YA 4PCQA 3PL8A 1X2NA 2K4BA 2VQLA 1R0RI 2REEA 5DDGA 4G1PA 1S7AA 1O4XA 4XLEA 4B43A 2X4HA 2Z11A 3L2QA 2G0EA 2K5TA 1PJRA 4H2KA 4R9MA 2DIPA 4LG0B 3CD6I 4H0EA 4LX9A 1LE8A 1KGSA 2FIWA 1LAMA 2ZELA 1JJ6C 1Z9UA 3ISPA 3HGYA 4CS0B 4EJVA 4E7LA 1XG1A 2NMTA 1CF7A 3VARA 2I79A 2ZPAA 2MGQA 3LSGA 3GYAA 3FM3A 2FU4A 3K4CA 4CYDA 2K9SA 1DS3I 3TOBA 1CT2I 2P6TA 2SGQI 3QTLD 2QYOA 5GTIC 3PUBA 1TZLA 4PSXA 1U9NA 4CZZA 3EO4A 3RO0A 1HKTA 2K5CA 3ZQCA 5IOZA 1BUSA 1QQ9A 4NGTA 3BPXA 2OU2A 4MQ9F 4XRMA 1R4MB 2ZNZA 1LJ9A 3LSJA 4CDGA 2PMHA 4A3MJ 5M3FJ 2ADUA 1YR0A 1FTZA 2ME0A 1DPRA 4XLPF 2BEIA 3ML6A 4R57A 3OL3A 3WE2A 4HPQA 3AL0C 3PFEA 2FMYA 4RBOA 1S60A 2ECCA 1BO4A 1BJZA 1PDNC 2HFHA 3IH4A 3WHCA 3AG1H 4P4EA 2ZOFA 5I4MA 4RB3C 2B58A 3SFZA 3G1LA 2BHZA 4NDLA 4ABZA 1HF0A 3SI1A 1IN7A 1UHWA 3MVPA 4KYWA 2WY7Q 1V5EA 3FXOA 3NAUA 3NH8A 3OIPA 1JE8A 3BJ8A 1WWXA 3O2PE 4PK3A 1BW6A 2AO9A 5THWA 3JRIA 1D1BA 1MK4A 1OVOA 5HQ8A 5FUYA 3VSKA 4G6QA 1R5HA 5CLSA 4UF4A 3C3WA 1SGQI 1UMQA 4HQMA 2XGEA 5D4RA 4FKDA 4DYOA 2EJRA 2PJ3A 4A3FJ 2Q43A 4H89A 3CXLA 3HOYJ 3V8KA 4EFDA 3KYLA 1IY6A 2DA7A 4GGGA 4KIBA 1QSTA 4FTHA 4L5IA 4B44A 4MPIA 2OB0A 4H6UA 3I5UA 2FNPA 3N05A 3J7YJ 3VDPA 3S14J 4AIDA 5D8KB 2BW3A 1R9TJ 4TWEA 2CUEA 3HUGA 4D5FA 2QQ0A 2OR4A 4P4DA 2HZTA 4E7HA 2P7CB 1ZR2A 3NH5A 3PFOA 4IPAA 1CM0A 4ENKA 3BR2A 1IW7F 2DAOA 3WC7A 3DLAA 2UWMA 1Z21A 1F57A 1KQ0A 3KZWA 4YWYA 2ZEHA 1ZN2A 3W6XA 2WC2A 2CF4A 2MH9A 3V7RA 3M7GA 2Q8KA 2E1NA 2PFBA 3DQVC 3H1CA 4ZH4F 2PJ2A 5C44J 2LB7A 3RU0A 4OADA 3HBLA 4UV9A 2XKPA 1YRNA 5H86A 4AVAA 2QSHX 4IHSA 2W48A 1WKMA 2W85A 3FMQA 3LMMA 2V7FA 1ZELA 4KOYA 3CMYA 1MNEA 4IVNA 4M9ZA 4DBQA 4NCZA 3DTKA 1IZ1A 1QZZA 2ZMEC 4OU0A 2KCXA 4ESFA 1A5JA 2MD0A 2GFQA 3AG4H 2IS6A 2C6PA 2Q04A 2ZW6A 5DWNA 3VYRB 2Y0SN 3EYYA 2DN0A 4G12A 2M3AA 1HCRA 2EV5A 5GAGJ 3SXOA 4ESBA 1E3PA 4M3EA 2XRLA 3CCQI 2GBYA 4FD5A 4UCNA 4MMOA 4E7SA 5HXDA 1RUNA 2M30A 4LB5A 3FIXA 2A61A 4L5EA 1POGA 4ZY1A 5TISC 4KN7X 1M1DA 2J8MA 2ZBKA 3K4BA 5EJCA 1S5KA 2EFNA 4BDYA 1W3SA 4GRIA 2XEJA 4MHDA 2HOEA 2QGUA 2B3VA 3FBNB 4EM0B 4LLLA 3DPUA 3F8NA 3RZAA 3K2AA 2HOSA 2JUGA 4FQGA 4NGRA 1O7LA 4U0WA 4UUSB 1I1DA 4BJTA 1M4GA 2PCUA 4A5MA 5G21A 2WADA 1J5YA 3CF2A 3DXJF 3FWEA 3FB3A 2XVCA 2GU2A 1AHDP 2Y9YA 4NUBA 4AVZA 2MLKA 5HODA 5E18F 2FBKA 3FEDA 1W36D 5IX3A 1XF8A 2Q1ZB 3FXRA 3J7AY 2CIJA 2OVOA 3DEWA 4OMZA 5EDNA 5EZHA 3ZMDA 2DPSA 4F92B 2OQRA 4I01A 1M44A 3ULQB 4CGPA 3FNCA 2YR2A 5FKOA 1XFOA 5FFZA 2L7MP 2IPQX 3NWTA 4YELA 1J4JA 1Y9WA 3HB9A 4MFDA 2E5NA 2CV1A 5GPCA 1QO0D 4JXRA 2K9NA 2LKPA 1YOVB 5FO5A 1XCVA 1XC5A 3MD2A 2ZEMA 1LDDA 5F1RA 2HUZA 3EY5A 1V5FA 2BY2A 2DA6A 1YHQI 3CMAI 3SJXA 1NG7A 1Y0YA 3TEDA 5IPAA 2LG4A 4D1QA 5EEGA 4GDFA 2R7TA 1SD6A 1YVKA 2FEZA 3BTIA 3WGGA 4P6YA 2EZHA 2IMOA 3LD2A 2BOLA 2JSPA 4EJOA 1GXPA 3L2WA 3CJRB 2LVSA 4M73A 1EH7A 2JTVA 2ATRA 4QUSA 3E5QA 1S7KA 4R8FA 2FL4A 4YIFA 2JDDA 2JDCA 2R5ZB 2IA1A 1F4KA 4L5JA 1NG6A 2JN6A 1A36A 1B1BA 3OYNA 4KICA 3IWFA 3W6JB 2K9LA 3ZR8X 1PUEE 4UWJA 2YU9J 2DOEA 4ZX8A 4QTRA 4XQFA 5AIPA 2Z2SB 3KEYA 4E8OA 2R7WA 5H2FC 1W7PB 3RBUA 2VODA 2VJIA 2WY8Q 3DPLC 2NVUB 1V3FA 5J6XA 4KN4X 2M34A 4CYNA 4M6HA 1XE4A 4XN3A 2CV2A 2E1OA 2MC4A 2NS0A 1AOYA 2VEZA 2X6OA 5D4SA 3HPHA 1VQ5I 2LY2A 1YJNI 4L0YB 2B4DA 4NF1A 3VDXA 3NARA 1LCPA 3CUQB 1ACIA 2CG4A 3S93A 1VZ0A 4M3GA 3BZCA 2C6YA 1Q2YA 4UEZA 3REOA 1J2XA 1O57A 1NTCA 4NSQA 1U2WA 1FJLA 4AD9A 2HV2A 2COBA 1EA3A 2G7UA 1JHHA 1XN7A 4BE1A 5KAIC 5JPHA 2HC9A 2BGCA 2IS1A 4N9HA 4Y3OA 3VODA 5FD6A 4BQAA 4UY8I 3CJTB 1A31A 3FHNA 2FBHA 2RQPA 4L9TA 5M5WJ 2XB0X 3K2KA 3A02A 4B10A 5JVGF 2DJIA 3ZMTA 4YRVA 4F91B 4LQGA 4XNHC 1IW4A 2EBIA 2L9RA 4KIFA 4A3CJ 1I6XA 2ZOGA 1HEVA 2PVWA 4ZZLA 4XIDA 4BGDA 3IKTA 1GHEA 1VHEA 4RAGA 2Q2EB 2PR8A 2LLKA 5IP7J 3SHFA 1YW7A 4ZZDA 1D5VA 3K1MA 3ZGKA 1VHOA 3F3XA 4ZYEA 1MNMC 1D1CA 2CYYA 2CUZA 4UIAA 4UEEA 2N71A 4OVOA 3R1KA 4BNCA 4OAYA 2KDZA 4JD6A 3HSEA 2OOTA 3V8IA 4CYCB 1O3SA 1GXQA 4MRIA 4UBRA 1D1AA 1WRJA 1UELB 1HC8A 2N52A 1KUXA 3ISZA 2Q4YA 5D5WB 2O3FA 3JRFA 2BSWA 5JQ4A 4BD9A 8CPAA 3AAFA 2NNYA 4A2ZA 2R8VA 4O23A 5D6EA 4CRYB 1OISA 3S32A 4HNUA 1REPC 4KOWA 2PJBA 4LG0A 5K7ZA 4Y49B 2K9QA 3KLNA 4BDZA 4P4BA 4F8ZA 1W5TA 1G59A 2K02A 3LSHA 1QPMA 3CCJI 4NGNA 2WA0A 2CV0A 2FSWA 3B3SA 2KMRA 2P7VB 4HX7A 1YITI 2DFFA 1P0HA 5HMNA 2JXDA 1G2HA 4XRFA 5K8MA 3BG5A 5ICEA 1Y56A 3G2BA 3KY9A 3B35A 4A94A 2PJPA 4II2A 1IUYA 1ETYA 5FLVA 3BC8A 2ZO4A 4W1UA 3HH2C 4UV8A 4IAVA 2KMOA 3S6HA 3ZN0A 2EWNA 4L9JA 5LBQA 1ZO0A 5CJ9A 3DPTA 3ASNH 2GA2A 5H20A 1L3LA 4XRSG 2IGOA 3UGIA 2AFXA 3SJGA 5K8PA 2Y0MA 2HGCA 4NFRA 2NRAC 1OR7C 3KX2A 2R7UA 2LF7A 2ERWA 1VQMI 4OAEA 4BEHB 1Y8FA 3TQNA 4E1RA 4OC5A 3HL2A 3SZPA 2L9SA 1Y0NA 4FAIA 5F64A 1TQMA 3JREA 1VQNI 3PZJA 2OQGA 1M4LA 5EZGA 2V26A 3ABUA 4HNVA 1U8RA 4RS2A 3BJ6A 1ARLA 1IDZA 3ZCOA 1SMTA 3HOZJ 1X12A 1LDJA 1TP4A 2FE3A 5C4JJ 2VLAA 1U78A 4EMEA 2QPOA 1S5LC 2WWYA 3UEJA 3TDZC 3RZDJ 1XA6A 2LR8A 2XHKA 4M3DA 2VQGA 1KONA 2H8RA 4S04A 3AFHA 3W3CA 3OYEA 1PPFI 2W84A 1FOKA 4MFPA 2Z1DA 3WTWC 4HNXB 2ZW5A 2F2EA 1BPNA 1ETOA 2R7OA 4HSRA 4A0YA 4WP4A 2QMLA 4KSIA 3WR7A 4F3QA 1JHFA 3SGQI 3F6VA 1KUVA 3GKRA 1I3QJ 1GDTA 4LK1F 4B4CA 1X19A 3I59A 3PNTA 5L3FA 1Y8RB 3E59A 4KOUA 2SGFI 2J8NA 2EQRA 1P4WA 4P9FA 5IYCJ 3E97A 4UXNA 2O61A 2GWRA 4N4OB 1CG2A 2O4HA 2OZGA 1P2FA 1QU3A 1BBYA 3SDBA 3N5FA 2QKLB 1YW4A 1YX5A 3F0AA 4A0ZA 4HPSA 1S29A 5FKNA 4PJLA 1CE3A 4UIBA 1P4AA 4KA4A 3JRUA 2L7ZA 5FLXK 5K5QA 3HG9A 1AN1I 4W9YA 3S9MA 2HVQA 2VQYA 2DXQA 3D7DA 3VE5A 1Z2LA 2NVXJ 4BKXA 5CNPA 2V1NA 4BE2A 4I02A 3LSTA 3WTSC 1CF7B 1VQKI 1X3WB 2W24A 1UCRA 2LDUA 1Z6RA 2DO7A 2M45A 4B3AA 1ZAOA 2PMZN 4XRSA 4IK2A 3O3KA 3IH2A 3K4KA 5A28A 3T8WA 3PSFA 3B3VA 4RI1A 3HRTA 3HZJA 4PXDA 4IXAA 2VRWB 5HOOA 1WJAA 3F0CA 1KQ8A 2CQNA 5EEHA 4LOCA 3DNSA 4KZTA 4X8IA 1Z8LA 1Y39A 5TRDA 4XNFA 4OINF 3P9CA 2VJJA 2B8TA 2RNGA 1YREA 4NGQA 3Q5FA 1QHHD 1YGHA 5DEQA 2HS5A 2BUSA 2JA1A 1SVMA 4FD4A 3TTHA 1YX3A 3K2ZA 3I58A 2AXLA 3KZIC 2Q44A 1QMUA 4AYBN 4RM2A 1N25A 3OL0A 3WG9A 4YIRX 2ZSIB 3EUAA 4JYKA 4M9SA 5LRGA 2Y30A 4KT6A 1WJBA 1F2PA 1ULKA 1KYWA 2AQFA 3CCYA 1T08B 4P9UA 1MSFC 4ZYAA 1T38A 2O7OA 4U9YA 2QECA 3D4UA 2DMTA 3LQRA 2GIVA 4I76A 5DUIA 4IHWA 3U1KA 2X3TA 4OIQF 2JA2A 1FY7A 3HOWJ 3M07A 4XL9A 1Z8WA 5E1ZB 2A68F 5KCMA 3DBHB 5ICFA 2LNBA 1SGEI 2QWWA 3GZNB 3PB9X 3IWWA 4U0VA 2VI6A 3QPLA 3S17J 4YU9A 1RR7A 4UCMA 1Y1CA 2CNSA 2PRBA 3RPQA 2YUSA 4RLQA 2OTLI 3RCOA 2LMDA 4EGYA 3GIUA 3OIOA 3KP3A 4YEJA 3L09A 1VF9A 2VE9A 4KOTA 3T90A 4DZPA 5LEJA 1S7EA 1HJAI 1TURA 2DF5A 2YNDA 4Q4ZF 1LANA 4Q38A 4LMYA 3L2UA 2E2IJ 5IV0A 4C3IJ 2M0MA 3PQJA 3UEYA 3HTSB 4NGSA 1A6IA 2XV4S 2Z3OA 2JA8J 3H92A 4CCJA 4A2UA 1YLOA 1BN5A 1K6YA 3HJEA 3KZYA 2N17A 4FWUA 1ZLJA 3K10A 3D7FA 5CCLA 3ZQIA 2P5LC 3NFZA 2CQQA 5LRSA 3CZXA 3KFWX 4PSWA 3KYDB 3IRRA 3QYEA 3CO6C 3PB4X 4BYYA 1RC9A 4EGZA 1Y6IA 3PM1A 4EJTA 4MHNA 4KVXA 2R7SA 4U0YA 3I55I 4XMYA 4EATA 1L0CA 2F5IA 1KWMA 4UXJA 4Y7NJ 1XTAA 1A35A 3LSRA 2HYJA 3A03A 2BUEA 1DU0A 2HDWA 4CAVA 1IXCA 3MCZA 3K9TA 1GUUA 3GB0A 1IV8A 3WE3A 5ISVA 1MKMA 4MQVA 3S8PA 1K79A 3JRAA 4LFUA 2JVHA 1S7FA 5D5XB 1ZLHA 3RAMA 1S7LA 3F8FA 2LOOA 1WFXA 5H84A 2HTJA 4HDVA 1FBUA 2MD5A 3MZHA 3PSIA 1FOWA 1I12A 4M72A 3FSYA 4RGXA 4PDKA 5LGNA 3SGBI 3FVLA 4BH9A 4B47A 3D5LA 3H5ZA 3FKJA 1IG7A 1FBSA 1XSXA 1QVTA 3B73A 1Q2CA 4ONUA 4E2AA 3E3VA 1ZG5A 2M1BA 2QJ8A 5ELYA 3RIRA 2W4SA 3HLPA 1LFWA 4NGMA 2OBPA 1MZBA 1G6NA 2FJ1A 1M8CA 2GOMA 3DSBA 3HTUA 2F7VA 2VPLA 1FSHA 3BCAA 4MFJA 4W97A 2Q2EA 3ONQA 3PUFA 3V42A 4B8XA 4AIKA 2DK8A 4BMHA 2WGCA 3FXJA 4CYOA 2ENNA 3UGDA 3K0LA 3VEPA 2DYSH 2ZC2A 3W2VA 1Z4EA 2IA2A 3E6CC 1YVOA 4BACA 4IQ4A 1TWGJ 2ZKZA 5C82A 4CSWA 4CCOA 2M8GX 2LREA 2EILH 1AUGA 2MA3A 3KP6A 2UV1A 1J9IA 2B4BA 5CPRB 1PTRA 4UXHA 4AWXB 3SZGA 5E3QA 2ME6A 3CUQC 4XSXF 1LVKA 5DM6F 4I99C 1TBXA 1HLVA 1P92A 4EV0A 3KP5A 3WC5A 2COMA 1O3QA 4Z6YA 1SAXA 2HQ5A 4QIWN 4E1PA 5FFXA 2Y31A 2FUG2 5LHGA 5J47A 3J80K 3JSPA 1YFHA 1D5YA 3LFUA 5DYMA 3FISA 5EYRA 2Z3KA 4RLFA 1DDNA 3BQZA 3VSLA 2Z99A 2R7RA 4HX8A 2VQCA 2G7HA 1OYWA 4XORA 3KP7A 4FASD 2HTSA 2LKSA 2X1EA 1AA7A 1T0FA 4FETA 2K9HA 3VPRA 2XB5A 2V8DA 3GO5A 4UFVA 3RDIA 1B87A 4AVBA 1UVFA 1YW9A 2LSOA 4RB2C 3OS1A 2CFXA 2TRTA 3I3GA 1Y1VJ 1W7PD 1RPWA 2HQYA 1X4PA 5J1RA 4I49A 3QWLA 3B6AA 4H4KC 5K7FA 1FIAA 1TL8A 3S9LA 5E3MA 2M4GA 2Z33A 1UJ8A 2VKHA 3LQQA 5FKMA 2XGDA 1UFMA 2H6BA 2LBFB 3F72A 1RUOA 3KIOA 2SGPI 2R7QA 5CKTA 2PJ5A 1BI0A 4MY3A 2V77A 2OV7A 2WAFA 4JJXA 1XEBA 1LRZA 4LLGF 4A39A 3SJEA 2LFBA 3QOEA 3GFMA 2HR3A 5F46A 3MZYA 3HKZA 2R7VA 1R22A 3H3ZA 1D0XA 4PJNA 5L3BA 4LUAA 4R79A 2QEXI 2E2HJ 4P44A 1I1GA 2KQRA 2DT7B 3EYIA 1LR8A 3CC2I 2EK9A 2ID3A 4MXUA 2EV6A 3BR3A 4Y49C 3WABA 4V2GA 2CTCA 2PI0A 2DDAA 1DU6A 4MFKA 5JH9A 4DQ2A 4M6XA 4UB8C 5K8NA 5KTCA 3VWEA 2DA2A 2N8GA 4LGWA 1T0FC 4PUSA 1HDDC 2VE8A 2EUIA 4BINA 5E79C 2WYRA 1S9HA 3FH4A 4PGHA 1K6OA 3JW4A 1V55H 5E17F 2PJ0A 4Y13A 3ERMA 1R79A 1SEUA 1UAAA 3ZPLA 4Q48A 4XLHA 2HXOA 2HB6A 3FYNA 4XKWA 3D0SA 4B14A 2CNMA 2ORWA 4KIGA 1APLC 6PAXA 1TF8A 5GP9A 2QUFA 3L7WA 1TBNA 1BA5A 1TXRA 3S1NJ 3LSKA 3CQZJ 3TKYA 3DR8A 2XPVA 4A31A 4EWTA 2XGCA 1GYTA 4DW6A 1IOFA 2LUYA 4K3NA 1O3RA 1Z3YA 4IHXA 2PG4A 2F8HA 3LA3A 3IP4B 1NK3P 1Z9CA 4WXHA 4KVME 3L2CA 4PGGA 4JBAA 4B48A 4A37A 2W7NA 1XJOA 2E36A 5EC4A 2R7HA 4M6YA 3I1UA 2P6EA 3P9KA 3OS2A 3JRGA 2VZYA 3OY9A 4F52A 4MCRA 3QPHA 1MBEA 5IB0A 5HI7A 3EUHA 1KU9A 3IO1A 3RKWA 4ZI6A 5LHIA 1ZHFA 3R6SA 2XEFA 4MEYF 5BQTA 3L1PA 5D5UB 1TUSA 1JTYA 1X4SA 3WU1B 3TP0A 2EFWA 3BHXA 2PJ9A 3ZQHA 4BHBA 2KFDA 4AM3A 2UXNA 5AG7A 2H8WA 1YW8A 5FKKA 4M3SA 2NU1I 4IX7A 1IXRC 1P9GA 2PJAA 2LYCA 4NJQA 3D8PA 4UFWA 2ID6A 1K78A 1ELMP 4FISA 2SGDI 2EZLA 2QBYB 2NSMA 2PIYA 3KGQA 5F08A 3SQNA 4UA3A 2NYXA 3PO3J 3HEFA 1Z0XA 3IH3A 1R7JA 1FBQA 3MEXA 2HQRA 2LEOA 2RFHA 1D8KA 3H9JA 1CX8A 2AS5F 2R4GA 1TQPA 5F0FA 5ILSA 1MW7A 1E3OC 3S3OA 1S8NA 4O3MA 4V2FA 2M5WA 3TFYA 4NGPA 1KU7A 2POKA 4F0YA 5JR3A 2QQBA 1JKQC 1S7OA 5HS9A 3FJUA 1GVDA 2IL4A 4R3LA 4QB9A 1SGYI 1Z2IA 3I59B 4ZYHA 1A2ZA 4RAZA 2FS5A 4EJUA 3S3MA 4LJZF 1FLIA 2IEKA 3JRHA 1MMNA 4IL6C 2D4OA 2ACJA 2ZNYA 3SJFA 2M2EA 3VFZA 4C3HJ 4JX5A 3V7ZA 5LRKA 2O8KA 3EUHC 4XSZF 2GXBA 3ISXA 5DS9A 1IN6A 2L4AA 3G1OA 4MHYA 2V9VA 1G3SA 2Y48A 3LFKA 4AC0A 2ZFUA 3K7AJ 1OMTA 1MJ9A 1MMAA 2F5CA 1UUCA 3M8JA 4A3BJ 2V9KA 4CCKA 4MCQA 2Z0ZA 2CNTA 5CCMA 4M71A 2EIMH 2Q0OA 3WGHA 4A3JJ 1U0JA 1EV7A 1BAVA 2L54A 4AXVA 4ASNA 3S9NA 5F0HA 2FOWA 2RNJA 2XUBA 4ZYQA 1W36C 2F5FA 4FCYA 4ENNA 3N97A 2OPTA 4A6DA 3U1DA 2B63J 2YGWA 3QU6A 3H9QA 2ODDA 3BP8A 2HVSA 1WK4A 1H88C 1HDUA 2MG4A 5G22A 3BDDA 4EMSA 1JKPC 2R0QC 3FHZA 3DGVA 3OYMA 3A01A 2KISA 4Q47A 2NVTJ 4I0AA 2PMUA 1P6RA 5IT3A 1IN4A 3N4MA 1LR7A 3BZKA 4ESJA 3VWDA 2WAQA 2KRHA 1Y0UA 2GREA 4B6DA 4UVBA 2DCEA 4M74A 5CYVA 1R36A 5EGOB 1E17A 2DDBA 3G1MA 4TV7A 2BEOA 1OCTC 1K7VA 1MT1A 3JAMK 4MHPA 4I6ZA 3I3LA 1H0ZA 4A5NA 1TIHA 4A3KJ 2DMQA 1JQGA 2IW5A 2VB6A 1MD0A 3UY5A 1ON2A 1H0MA 4L0ZB 2XAFA 4KT5C 2QLZA 4CGNA 1LOKA 1A04A 1T95A 4PJ0C 1M8BA 2EBJA 3S6KA 1FX7A 3OYBA 1YLEA 3RZOJ 3PQKA 2E1MB 4F0XA 2XEGA 1RI7A 3QPTA 4OLLA 4Q36A 2L5QA 4JZ0A 3G6EI 2LC2A 3FXKA 3BI0A 3OYIA 2YUUA 5E20A 4MCSA 5E3OA 2MFZA 2V6CA 2CH0A 2L8EA 3FBUA 5JLXA 2YNCA 1HSJA 3FRMA 3SI0A 3G3ZA 4HG2A 2YNEA 3IAM2 4CAFA 2HYFA 4KLVA 1BI1A 1W0TA 3J7AO 3MN8A 3BR0A 2P6SA 1Z7KB 4MHZA 4XN0A 2JA7J 2DB6A 1FOXA 3KPHA 4BHCA 3T0YA 3ABLH 1YI2I 4RN7A 1QA6A 2RC4A 4ZC3A 1G8XA 3HC7A 1Z7UA 3EETA 4MLOA 1P4XA 1UZCA 3S2HJ 1ZKGA 3GTOJ 1WVRA 4U5YA 1SFEA 4HOBA 2XPWA 1FC3A 1H89C 5EX0A 2EWBA 3LWUA 4HDUA 2VN2A 3I4NJ 4ZDOA 4L89A 4B12A 2DFIA 4R76A 2CQKA 4B1RA 2VONA 1VKCA 2YS9A 3ZQ7A 2Z3YA 2AFZA 2HEOA 2MLGA 2P8TA 4GCVA 1S3JA 4XPDB 3CLQA 1WH5A 4WK8F 2D45A 3SXYA 4FUUA 3FMRA 3W2AA 2XEIA 1LUJB 2DT5A 1I21A 3PEIA 2QQCA 5HVQC 4OIWA 3H5NA 2L7FP 5HLIA 1F43A 1B6AA 1OMUA 2E7WA 4BL0B 5JFRA 3E5XA 3JRDA 3NH4A 2PJ4A 1V54H 1FP1D 1I39A 2CQ7A 4Y15A 3IFEA 4EJWA 5F49A 3ABMH 1PUFB 3ZJ0A 4OKOA 2DK5A 3K1NA 4IHYA 2YNCC 4DJAA 1ON0A 1OYYA 2EVNA 2E34A 1OCRH 2DFHA 2KLOA 4ZJZA 3BXMA 4KSFA 3OSFA 1UB9A 3VOEA 1OFCX 2STTA 3KQXA 2LBFA 2HDCA 3S16J 1P9QC 5C4XJ 3TO6A 5C3EJ 1ZH5A 4ZDLA 1X10A 1S3ZA 3SFIA 3ZN1A 3RQ4A 3PRTA 2X1CA 4KUAA 5GCNA 4C2XA 3Q3SA 1Q1VA 2JA5J 2L9VA 4BJ6C 1MH3A 1FYMA 3FC3A 2GKTI 4LQ6A 4ZY0A 1Z77A 3I9V2 4G6DA 1FYLA 2B0LA 1Z05A 3MRUA 1FMWA 1MBKA 2IGMA 1IDYA 2LD5A 5EBVA 2L01A 1BOBA 1BI3A 2KJCA 2B5GB 4U7DA 5ILVA 2OCEA 1FT9A 2L02A 6CPAA 2BVLA 4M3BA 3MWMA 3H8EA 3RI4A 2JQ7A 1L0OC 1DQUA 1QQIA 1HBXG 4MFLA 4P4JA 5HH1A 1ULNA 4XLNF 3WT4A 3E6MA 4KDPA 1LR9A 2REFA 3G3SA 4ON0A 2KL4A 2O0YA 2A5YB 3ECHA 3H5RA 4D7MA 2PJ1A 3BLNA 4G6TB 4NEXA 3FECA 4C9YA 3TW7A 2ZJ2A 4CYQA 1Z3XA 4F9VA 2HPIA 2F6CA 4CZCA 3LNQA 3ZRGA 1R4NB 2QQ8A 3G4SI 1WH7A 1WPKA 2Z5UA 3OR1C 1ZLKA 3DR6A 2VT2A 4XOTA 3WTVC 1OCOH 2DI3A 4KISA 1WSUA 3H3VK 2CWFA 3FMSA 4AMLA 3TT2A 4BS9A 2MH2A 2ENZA 4L18B 1TW3A 2KZVA 4XBFA 2M87A 3A4CA 1KBFA 3JTHA 4JK1X 4B5OA 2PN6A 1ETWA 1IXSB 3CPXA 5LYDA 3BTLA 2JT1A 1V1HA 4LLNA 3WC6A 3F8MA 2CGPA 4NNJA 2FRHA 3KL9A 3ZQFA 1MDMA 1AYEA 2HVRA 1WJDA 3I53A 3VB2A 2V8GA 2CW8A 1X74A 1JXSA 2A6HF 3F8CA 3R61A 4HLXA 1RRJA 1ULMA 2AFWA 4EQQA 1TNSA 3RYPA 4HF1A 2J9RA 2L2OA 3H0DA 3RNZA 4HNWB 2VBYA 4A3LJ 2EA4A 2O53A 2V6EA 3J80Z 4R6TA 3UNGC 3DLLF 2AQEA 3PFIA 5DV5A 5D8LB 4GI3C 5G20A 4CCNA 3PNVA 3B3WA 1Z7LA 1R1VA 2LF8A 2MC3A 5CVUA 3E7LA 2DA3A 2QBYA 1YX0A 3K9UA 5DD4A 1U3EM 2BO9A 1GV2A 1N71A 3G71I 1VHSA 2YQPA 5F6FA 4P4IA 2QQ9A 1O7FA 3OOUA 5HLHA 2H94A 3C2HA 3VWBA 1CJWA 4MFZA 2ANPA 3U2RA 1PCEA 1LNWA 2PBIA 4LIVA 2R7FA 1QZYA 4KFCA 2DOFA 2FD5A 4RGRA 5JI6A 3AG3H 3KZZA 2XAQA 3MZ8A 1YO5C 1UVGA 4Y52J 2VI7A 5LRJA 1SVLA 1ULYA 1ETXA 3J81K 1IAWA 4PFOA 1LEBA 4E4HA 4AG9A 4BHPA 2XSJC 3NWSA 2V1DA 1IV6A 3B4VC 1YMEA 1J09A 1IN8A 2IAIA 3JRCA 1FARA 3OXGA 2F3CI 3EC4A 3GY9A 1XS9A 4ZYDA 3K1PA 7CPAA 3FXUA 1J7KA 1SFXA 3DBLB 3OYGA 1T8IA 2TCTA 1XMBA 2VKEA 3CCUI 2ELIA 2AFMA 5G1ZA 3K70D 4C7IA 3LAJA 2O8XA 5GPAA 1R58A 4HRIA 4M6GA 3DTIA 1ZRCA 3K4LA 1DS2I 2CWHA 4KITB 3OYFA 5J1YA 1LPQA 1IO2A 1FTTA 1U5TB 2JMWA 5M3MJ 2GLJA 1C0WA 2YU3A 1LVAA 2M5XA 1X58A 2PJ6A 3H8GA 1GLNA 5E8IA 2MYSA 5ED4A 2ZXVA 2GVIA 5J40A 2OTJI 3BZ6A 2BY3A 2HU9A 3TL4X 1TC3C 2ZEGA 5J1UA 2PQ8A 3BR1A 5KAFC 1CGPA 3HM5A 3WG7H 1VTNC 2EIJH 1K4TA 1IGNA 1R6RA 1BIAA 3DU6A 1OBRA 4IHMA 3TE4A 5J8FA 1W4MA 3BCBA 3BTJA 3WTYC 5LFAA 2VJ5A 1FAQA 3QNVA 3R5AA 1HDLA 2XC7A 4HNYB 4WWVA 2NU3I 4JLYA 3DKXA 4DGWB 3H9GA 4FE4A 2WPXA 1VQPI 1U9OA 3GTLJ 4BY1J 2NS8A 4RAFA 3ZQLA 1XMAA 3LA2A 4XK4A 3DKWA 2M4KA 1JKOC 1RETA 2ICWG 3M8FA 4C30A 3VYTB 1TWCJ 5L3EA 1SGRI 3HKZN 2KMUA 1TIQA 1WJFA 5EGOA 4P45A 1IRFA 4B11A 1PP7U 1K78B 4DNCA 1I5ZA 4X2TA 4RB0A 2KIFA 2G3AA 1UHMA 3C7JA 1ZTRA 4BAYA 4OC1A 2HXIA 2IVMA 3GFLA 2XPUA 5FB2A 3GWZA 2ZB9A 3WGIA 2LKXA 2QSGX 2O5RA 2GA1A 4KS9A 2P4WA 3GTPJ 1K83J 3FKIJ 2BOAA 1Q2DA 2Z3MA 1MMGA 1VIXA 3A1YA 2BXZA 2DKVA 2Y75A 2DFEA 3BR5A 3EUKL 2R92J 1PTQA 3RKQA 1NSAA 2EV0A 5HDKA 4P10A 1UFHA 1B4AA 2BHYA 1LEAA 1SD7A 3F23A 2HWVA 3LSIA 1JUSA 3T8RA 3HOSA 2VKDA 1KA8A 3I71A 4U87A 1CBXA 1Y7EA 4UVAA 4A93J 1WGTA 4C2TA 3IC7A 2ZMEB 5FUXA 3IU1A 2MABA 1RKTA 4A69C 3L2RA 1XB4A 4BY7J 2GLOA 2OH1A 4PQAA 3L2NA 4AUXA 1R43A 2GOXB 3WTTC 2C6GA 4UVCA 1YYVA 3KETA 2E73A 2WPWA 2K7LA 3SJMA 2RB7A 1WJCA 3WU0A 3DEEA 2M7AA 4YFXF 2KCWA 4GFBA 4H6ZA 4AVCA 3BPVA 1TKHA 2UZKA 3DP7A 2GXAA 3JTGA 3QPSA 2OAZA 2DXIA 4M85A 1M1EB 2GQQA 1ETQA 2X85A 3CZ6A 4DZJA 4ENMA 2ZEEA 2ROWA 3QOPA 3C1DA 5E3RA 2M8EA 1K4SA 1LKXA 3MMYB 5LEKA 1QVUA 2ZSHB 2F48A 3TO9A 1QPIA 2JLMA 4GXOA 4JCVE 4Y17A 1SGPI 4N4NB 4IQJA 1IJWC 2VL8A 4C3JJ 4CYPA 3AKZA 3ASOH 3CESA 1Y0RA 1ZG8A 3CF5F 2ISZA 2FVGA 4E70A 4R7MA 1CSOI 2V1CA 1R23A 1PCAA 2CS3A 2G3TA 1R1UA 1WCMJ 3FIWA 5BS6A 4N0BA 1IRZA 2EFOA 3A01B 2DODA 3Q9VA 2RAEA 1UG0A 1LQ1A 1MJAA 2HNHA 1JGGA 5BPIA 1IICA 2E1MC 4IJAA 5AGEA 4CRZB 4RB1A 1XBTA 3DKYA 4F93B 1R1TA 4XPKA 1IUFA 1PUFA 2XSDC 3R9EA 1Z8TA 4PK2A 2V9PA 4Z2YA 3F6OA 4X6AJ 2E71A 3NEUA 1DE4C 3GEZA 2B7EA 1PYVA 4HSTA 1ERDA 1RTQA 4AVPA 2ARPF 3J7ZI 5EG0A 3EQLF 2VASA 3K4MA 5LGTA 1IIDA 3OYLA 3KLOA 4EEFG 3SI2A 3IC1A 4ANJA 3GW2A 1QRYA 4A6EA 1B8IA 1ENHA 4L9NA 1HOMA 2OUMA 5LYLA 2V8HA 4CAEA 2A6TA 4KOXA 1Y8QB 2F4OB 2HKXA 2L0KA 4XLFA 3PIOF 1B9NA 1TWFJ 1J0RA 4IEJA 2DA1A 2ELHA 2I10A 4OIRF 4DBRA 3Q0UA 4J01A 1WTJA 3GTJJ 1MJBA 7WGAA 5CPAA 1YK3A 5F09A 1B72A 2DEAA 2WB1A 2B5GA 5J1QA 1MBHA 4S0HB 2RIJA 4OC3A 4GXHA 2B9SA 3A2KA 4KORA 4RGSA 5K7HA 4IRGA 2CW0F 4WWCA 2LY9A 4C2UA 4XPDC 1TKFA 1AKHB 3KP4A 3JAMZ 2V1UA 3HOXJ 4BU2A 4BXUA 2Q7SA 4A95A 3ZMSA 1TBRR 1SD4A 3BOQA 5E3PA 1DUXC 3OYHA 2FA5A 4WCGA 4Y33A 3I0TA 2KT0A 4F55A 4OIPF 1R00A 2QM3A 2UZ3A 3DF8A 2I5UA 2JZMA 2IT0A 2RN7A 4OC2A 2OCCH 3BT9A 2KMPA 2IQ6A 4X0GA 1KUYA 2I8DA 4RGUA 5HNFA 4MTDA 1IRXA 3FEEA 3Q0VA 3MAJA 4AIJA 2EFPA 4Q7AA 4G9YA 3R0JA 2XDVA 4ZTFA 4R87A 5F27A 2R98A 4I7HA 1K61A 5EF6A 2Z9OA 2HI3A 2CJSC 4NC8A 5IY5H 2X6YA 1VQ4I 3BI1A 1Z8XA 3CXPA 4P4FA 5LYIA 2JWTA 4IUSA 3HUVA 5JGFA 3BR6A 2WAQN 2R93J 2XF7A 3KCCA 3QWPA 2XF6A 1NUBA 3P2HA 5IP9J 2P5VA 3MKYB 4UXIA 2PVVA 2VJ4A 4ZBGA 3TC8A 4HX4A 1Z5RA 3O8GA 4II3A 2DLLA 1CT4I 1YLFA 3TO7A 3W2WA 2JEVA 1N78A 3SEKC 1TNTA 5CVIA 3K69A 3BG7A 4HW0A 3OXLA 2ECBA 4JXQA 3TX8A 3QYFA 1IN5A 3HRUA 1KQ9A 2Q4ZA 2J5PA 2JBKA 2WTEA 2IJLA 4CGZA 2VKVA 5LGUA 3GTKJ 4CAWA 2CSOA 1ORKA 5LRRA 4PV6A 4LK0F 4ITVA 9WGAA 5IP6A 3TOAA 2WV0A 4L9VA 3DLJA 1OQYA 4B13A 2Y69H 1FNOA 3FMCA 1LDKB 1S7NA 2IBDA 4F6AA 3D67A 2LY1A 3B8GA 1FIPA 2IRFG 4IOAF 1VQ6I 4G7HF 2X1DA 4QPOA 2OF7A 4X3RA 4TNUA 2PR1A 2X51A 5EMIA 2XGXA 2G9WA 2ELKA 3G73A 3UGLA 4A38A 1CGII 3D1NI 2SGEI 2WV1A 4AU7A 1IGBA 1SGNI 5BPDA 5M5XJ 2EA2A 4L9MA 3IWGA 1XX5A 2QF7A 2HZDA 1I6HJ 2KKOA 5IB9A 2LTPA 4G94A 5CQEA 3V8LA 3F8BA 1SFUA 3JUWA 2LP0A 1IOIA 2A5WA 4LB6B 5ILUA 1WJEA 1CP6A 2E35A 3I54A 1X2MA 3I56I 1VDDA 2NVYJ 2PJRA 5I0CA 4PJJA 4M3FA 1S20A 1WGXA 3BG6A 1NK2P 3F9KA 1XMXA 2RGVA 1I1SA 1KYZA 4OWRB 4A30A 1X1AA 2KRFA 4YG2F 1LAPA 3CXSA 3AG2H 3OXFA 2VBQA 2OZHA 4DUKA 2ESHA 3NE7A 3BJIA 2EFQA 2X0LA 4NBQA 1WKXA 2E60A 3ESWB 1M4DA 3NE8A 3ZMVA 3FM5A 5AIQA 3B2YA 2NXNB 1SMYF 1U5TA 3S1RJ 4DJLA 1OLTA 3I64A 3OYCA 5IT9K 2NVQJ 2WSAA 5B1BH 3PB7X 2ZEOA 3IEHA 1FSEA 4QC6A 1DP7P 1DTDA 3CLOA 3HYIA 4HA8A 1X1PA 4FT8A 4V19K 4ZX9A 2ZFWA 1CT0I 2IA0A 4II9A 1MDMB 4I98B 3VYUB 2VXZA 5E1XA 2KDOA 1UWYA 3GFJA 1ZLIA 2IGKA 3QP5A 4EVIA 1ZGWA 2DA4A 2OZUA 1DPUA 1XPXA 3KP2A 1YQAA 4A3IJ 5D29A 3T9YA 2BVMA 2ZJPF 1U6GA 3IWEA 2VXKA 3C2GA 3DEUA 1Z67A 1CPSA 2NAZA 2ZJQF 2X48A 2XF5A 3BY6A 4Y4RA 1T98A 2DMUA 2RDPA 2JEWA 2EIKH 3DWLE 2FSRA 1PU9A 4PPZA 1TBQR 1XGSA 2FT0A 5DCMB 5D6FA 2Y9ZA 3GF2A 5FVJA 1ON1A 1R49A 5FRNA 1Y1BA 2Z3PA 4K2EA 1UHSA 2TDXA 1LFPA 2Y2ZA 2ZEFA 1OPCA 2EB7A 3E1SA 2EK8A 1HW1A 2KZGA 2GKRI 1EH8A 1KU3A 3E6DA 2FQ3A 1RR8C 1ARMA 1ZG9A 3HHHA 1WHUA 1U5TC 3PB6X 4PZJA 3QQAA 5TJJA 2FXAA 2P6AC 4E7JA 1BM9A 2DMPA 5HS7A 3COAC 2CTBA 1OZPA 2ZMEA 3JVNA 4CO8A 4GYGA 2VIXA 3E0KA 4MEXF 5DWMA 4QLCU 1HKSA 5FKLA 4A0XA 1JI8A 3B6CA 2E2JJ 2X7BA 3HRMA 1XGOA 4MFQA 3WODF 3OR2C 1J59A 3K4JA 3HRSA 1ZG7A 4PFPA 3ZXSA 4BBHA 4R1HA 1H8AC 1YW6A 3DV8A 2PJCA 3DBRB 4IO9F 2A20A 2D4PA 1VGYA 4RAYA 4GS4A 2K9MA 2IXSA 1BPMA 2PX9A 3LSPA 2GM4A 3E6BA 3I4PA 4IOCF 1XMTA 1TT5B 2PE3A 3J81Z 4GM5A 3R9GA 3CP2A 4MO7A 1EF4A 3MGDA 2PSWA 4JWPA 1HSTA 5A27A 3D68A 2P5KA 3F22A 5JM6A 3QAYA 5F48A 4NC7A 4FX4A 1S72I 5B3SH 5A2QK 2L7KA 2QIRA 2K40A 2DW4A 4IZZA 1BLLE 2CUJA 4ETSA 1P7JA 3CCMI 3V4GA 2D2WA 1YJ9I 3FX6A 5CBMA 2V1XA 1ODDA 1TW2A 1SQHA 4BBRJ 1HPTA 1V0CA 5HDNA 1I3AA 1HXDA 4CA0A 4GYIA 3V7SA 3I4MJ 3IL2A 2YSRA 5E3LA 2EZKA 1OCPA 1NXUA 5BMZA 4BQOA 4YFNF 1VI0A 4HEA2 1RO5A 2P6GA 5FLXZ 1SVOA 1EJ9A 2ORVA 4UCPA 2ESNA 4DYQA 2NU0I 5IOYA 3K4NA 1FP2A 1Z4RA 3H4QA 4D9JA 2GZWA 3OYJA 2ZEPA 4OIDA 1R5ID 5FD5A 3L2VA 2FXFA 4KNYA 3R5CA 4ZGYB 2A69F 3H0GJ 2DPUA 2O9LA 3PFYA 3CJQB 3GYHX 3GTGJ 3PO2J 3GCMA 3GTQJ 2DTZA 3GUDA 4QWQA 2VUMJ 3KASA 2A4NA 2VT3A 5B66C 1OJLA 2EPFA 2GAUA 3CMEI 4MI4A 1E3HA 1SFKA 2K85A 2ZXJA 4LITA 4PXBA 2JA6J 1XMKA 5KTDA 4LD5A 5KNLA 2JW6A 1XBUA 4AG7A 2Z10A 3IU2A 3M8EA 5KK1A 1QSRA 1VQOI 3SHPA 4UNOA 3LWFA 2DOAA 1WZ2A 4BXXJ 5F1JA 2A05A 3HSFA 1KZHA 5AG6A 2WBMA 2DPDA 3A0HC 1I50J 2W0TA 2ARHA 1FT7A 3W6KB 3RJPA 2F4IA 2KIMA 4S05A 1ZQ3P 2CWGA 1ZGJA 3VATA 1AKHA 1GT0C 2A6EF 3KEOA 3T8TA 2FOKA 2D1VA 1XX6A 4CXFA 4CCMA 5AONA 4G8XA 2VL1A 3Q9SA 1FYBA 3OYAA 1R71A 3D7HA 3IWZA 2ZXHA 4CCLA 2JBJA 2EH3A 2QVOA 2W82A 4XOPA 1YTYA 4ONWA 1X4OA 3KEQA 1MMDA 3X2QH 2VQHA 3H3UA 1TF9A 2WZNA 3R5DA 3CT9A 3KR5A 2M0CA 2HOAA 3TP3A 3QAHA 2A07F 3R9FA 2V79A 3CCVI 3KHXA 1BMOA 2AXTC 4WF2A 2P81A 2XASA 1BC8C 1BIBA 2H09A 1WGCA 3BWGA 1O3TA 3FXQA 3K6GA 3HOUJ 2HQNA 3BJOA 3RKXA 4A3GJ 1X1CA 1E0EA 2ABZA 3H8FA 3E5UA 3FZVA 5DS0A 4L8AA 3GTMJ 3FBIB 4B3XA 4JX4A 3FXLA 3H36A 4XM3A 2XROA 1LFBA 3MKLA 3IUOA 4CHUA 2HPMA 2R3SA 3QRFF 5HLTA 5AG4A 2CXAA 5B1AH 3P7NA 3BJ7A 2CWEA 3ZQQA 1W5SA 4SGBI 1F2OA 2AFSA 3B3CA 5JVTA 3OS0A 4BUPA 3RSNA 2V53A 3C2BA 1BR1A 1W0UA 4MCPA 3D5RC 3HIFA 5JHUA 5EEAA 1F5TA 1G4DA 4X5KA 5F0CA 1F36A 3CDXA 5EG0B 4BXFA 1Y1WJ 2PJ8A 3H5AA 3CTAA 4MFEA 1VQLI 1N75A 4BBSJ 2G0BA 3SDGA 3GZ5A 5K5OA 3TBIA 2IS4A 3BTCA 3ZQGA 5E3NA 1B8IB 1HKQA 5HVFA 1V1IA 3M9AA 3F21A 2K3FA 5E96A 1ONVA 4YIIA 4B5PA 2PJ7A 2AHQA 2NU4I 1YTPA 4ORFA 3PJRA 1CGJI 1NHAA 2FBIA 3ELKA 2V8VA 5DD8A 3C26A 4G7ZF 2OZ6A 1K7AA 2XAUA 2BY0A 3PBEA 2JYYA 1B72B 2UUZA 2XRCA 2JK3A 3D66A 3BG3A 3OSGA 3MFKA 1YJWI 2CU7A 2IS2A 4YFKF 4P55A 1X3UA 4HBLA 2RVCA 5H6QA 2BBYA 5LLQA 4Q5SF 1XIXA 4O6JA 2GLFA 4J19A 3EPZA 4HQEA 1KMAA 4QBJA 1WI9A 5TGTA 3B3TA 1IYLA 1QGPA 4HV5A 1ZK8A 2Q4VA 1OYIA 3MQ0A 4CICA 1VNDA 1HEEA 2GE3A 3BLYA 1BI2A 1RXTA 2Z3LA 4HYEA 4FD7A 3QODA 4IF4A 2GXGA 2QZ8A 1NH3A 5JHFA 1BW5A 1HDQA 4M9XA 1WJ5A 1BOAA 1EKEA 2DMNA 5BNGA 3PIPF 1NE9A 3FF3A 1MBGA 3FXTA 1RFHA 3P2FA 2DQRA 3GLLA 5GADJ 3HOTA 2LK2A 1BL0A 4KMFA 2VC1A 4A12A 2HOTA 3T5XA 3R4KA 2ELJA 4D7NA 1OR7A 3D7GA 3R0AA 4HAMA 4NQWA 1K7UA 3CDHA 2O03A 3W91A 2XAGA 3HOVJ 2M9HA 2F5EA 2PEXA 1DGRM 4E7IA 4BE0A 4ZYGA 2O6GE 3S1QJ 2Q7BA 4XICA 4UFXA 2L7XA 2R5YB 5J4VA 3GVAA 4UB6C 1M4IA 2RQQA 3PP9A 3ERED 2QVPA 3LL7A 4XLCA 3CCLI 1E2XA 3HDDA 3UR3C 1AMPA 3HSRA 2VXDA 1KU2A 2W57A 1P9ZA 3GBGA 1EE3P 1J75A 3CDIA 2JZYA 5FJ8J 5E1WA 3MKZA 3OWCA 1XDUA 3Q0WA 1BR2A 5GAHJ 1FEXA 2JRTA 3E0JB 3U9GA 3LODA 1OKRA 1XSDA 2BV6A 4HNTA 4RUHA 5FUWA 4YRHA 2STWA 2Q0YA 4XONA 1OMIA 5FGMA 5FUVA 2VPRA 1Q9BA 3S3NA 1ITYA 2R7XA 1DGWY 2KJBA 2QA4I 1Y7RA 3KE2A 2I00A 4RA2A 3P9IA 4R8HA 1CPXA 1HQCA 1YIJI 3KHZA 1TOTA 1FZPB 4CGLA 4IRHA 3IHUA 2WB1N 2H5MA 1JT0A 5BWAB 3K70C 3FK7A 3GXOA 1X1DA 3A0BC 2G9DA 3S6FA 1VQ9I 1KZFA 2F4MB 2A3SA 2FQ4A 1VQ7I 4LIUA 5DCMA 2W1OA 1N77A 4O5VA 3SZTA 4DIQA 1USTA 3S1MJ 3ECOA 4C2ZA 2XIGA 5GAEJ 1GV5A 2W00A 5L3GA 2P0WA 4I0BA 1U8BA 3M1EA 5E8GA 3WU2C 5GTHC 3FXMA 4WXDA 2HQAA 3OL4A 4AB7A 2Y0SA 2ZXWH 4RS8A 4ZTJA 5EX3A 2Q51A 4IRIA 2QQDA 4FHTA 3FK6A 1YE9A 2QSFX 2E1CA 1RESA 3R60A 5F47A 2EO8A 2OA4A 2RREA 4BJ5C 4OC0A 1ZRDA 2CO5A 2X6WA 1JTXA 2CQXA 2K4JA 2DBBA 3DFGA 2L4MA 5J8CA 1JJ8C 3M1CA 1PVEA 2PC1A 3JSOA 2PJRB 3QU3A 1W5CC 4A3EJ 1K7TA 3OYDA 4D5CA 3EXNA 4OIOF 5CVJA 2E5ZA 2BYVE 2XAJA 3SYTA 1K4JA 1H9TA 1D0YA 2YPRA 4I2OA 4C68A 4RMNA 3IV5A 3UKGA 2N1AB 4U7BA 2GIZA 2H1LA 3O6BB 2BZTA 1SD5A 4E7ZA 1HW2A 3JTKA 4EVYA 2NS7A 2KPMA 2R7DA 4UUTA 2MBFA 3OYKA 2NU2I 3G8WA 4EM1A 1TT0A 4R3KA 2M7BA 4G7OF 5L3DA 2W25A 1JWQA 3MKWB 3AL0B 1NSLA 2ZCWA 3GUXA 3I9SA 2PLYA 1BJAA 1ZG3A 3HHGA 4LG3A 4XPLA 3IIBA 4YFJA 4MGRA 4ZY2A 5F04A 1X1BA 1QSOA 2QYVA 4OMEA 2JUCA 4WX9A 1FOYA 3SEQA 2H27A 2P6FA 2R1IA 3DDDA 5L3CA 4FE7A 1XDSA 3RYRA 1IY5A 4B6ZA 5FLMJ 3SEZA 4WJBA 2KHMA 1IF1A 3HGGA 2YX7A 3KI9A 2JJ7A 4DOZA 1IC8A 1Z6TA 3WTZA 5KHDA 4Z65A 1I27A 2CFOA 3JCUC 2C1CA 1ZGAA 3KQZA 3WHBA 5LYFA 3HPGA 1T39A 1LE8B 1MNDA 2DT6A 3D00A 1WI3A 1MSEC 1JT6A 1MGTA 1RNLA 1W1WE 4XR6A 4CPAA 3KR4A 3DCFA 3D2MA 4X1EA 5IT9Z 1CP7A 4J00A 3UOEA 3CP8A 2QKMB 1JUMA 4P5OA 2FIAA 1OYVI 2J9AA 1LB2A 4XKVA 1QHGA 3QP6A 4PK4A 4QSHA 5FRMA 1G3TA 2KP6A 3FDYA 1KBEA 2MSYA 5C88A 4C7HA 4HZFA 4HKFA 1XGNA 3PB8X 3GOXA 4I09A 5FROA 4NJRA 3V7CA 3ABTA 1YG2A 2JVGA 2VC0A 3R5BA 2OD1A 1JUPA 4PXEA 2VBZA 3VDUA 2BXYA 1SANA 1T6SA 3MEKA 3C18A 5ERIA 5LHHA 3IJ3A 3CJNA 5ICGA 4C2YA 3GLXA 4KLWA 1UG2A 1FNNA 1XD7A 1XCBA 2UVOA 2PIZA 4UUVA 5DAEA 3S2WA 4JYWA 3OIQA 3PGPA 2ODFA 3QB8A 4KJZA 2QQEA 1ELLP 1RKWA 1SFOJ 4UUSA 1ZRFA 1YSJA 3FX3A 4XLAA 2FX0A 2NOJB 4QPQA 5AG5A 4A32A 1W4RA 4OOIA 4HGUA 4KOSA 4F9UA 1ZYRF 2C27A 2NNNA 3B02A 4NC6A 4M6IA 3GX4X 1H9GA 4IKFA 4OC4A 2K86A 2OD5A 1GVJA 1T56A 1YS6A 2GKVA 2B3UA 1QZEA 4MJ8A 3CDLA 4FBEA 1OCZH 5HVHA 2VBWA 5CQGA 3CMMA 2YX4A 4OAZA 1R57A 3TCVA 3T1BA 2AFUA 2E19A 3FSXA 1HA8A 4MY0A 2XAHA 1DP3A 3FF5A 5JLWA 2E7XA 1WWZA 1JGSA 2JPBA 3RQIA 4A33A 1FMVA 4ZDPA 2AE6A 1VQ8I 1CHOI 1XRYA 2BY1A 3BG9A 3RTRA 3BQYA 4CGOA 2BW3B 3LACA 1TBOA 2XRNA 3HUGB 4KMUX 5J4YA 2L9NA 5DM7F 3E2IA 2PDOA 3GLJA 1BC7C 4JOMA 2DJNA 3MN2A 1F1ZA 1ETKA 4KSAA 4ENJA 1VFCA 3VH9A 4IF5A 2GANA 2C6CA 3SXNA 1ZARA 5K5RA 5JHWC 5KTAA 1Q1HA 1YIOA 1TWAJ 3CO7C 5KVRA 1WQ2A 2H6CA 3JR9A 2ISYA 5J3LA 3TW6A 1YRNB 3LMSA 5D8NA 9ANTA 3IAS2 4F7ZA 2E5RA 1D3YA 2K3PA 2DTRA 1B59A 4XKCA 2DA5A 3CCRI 4IHTA 4KUMA 1GHCA 2KRCA 2R5ZA 3PNYA 4EM2A 1ZR4A 1QSNA 2RKHA 2MW8A 4PJMA 2ZEDA 1U5KA 3F5BA 3R95A 2D5VA 2ZW7A 3OV8A 5K1YA 2UXXA 2BE5F 2ZXIA 4P96A 2JSCA 5A2QZ 1SGDI 1IYKA 4CUGA 1W7PA 3S15J 5H6RA 4MIMA 2QQAA 1ZG1A 3H35A 3CC7I 3TDUC 3OOPA 1XGMA 1Y9KA 1P4NA 1YS7A 2LH9A 2IP2A 1PP8F 1TKJA 3LA7A 4DYCA 1YU6C 2CMPA 2IJZA 3CUQA 3OVOA 2J8RA 1MIJA 1Z91A 3BROA 4J3GA 1IRGA 1QBJA 3JRBA 4RM3A 4HF0A 4HLYA 4A24A 4JX6A 3ROUA 2H1KA 4U9ZA 3LOCA 3CPAA 1RZ4A 3GZ6A 2O28A 4A3DJ 2NYQA 4AIHA 1ETVA 4N9IA 4U88A 4E6KG 3EFAA 4NXYA 2FCKA 4UEFA 3PBBA 3ZP5A 1AU7A 4MBUA 2V1CC 3ZMZA 3IGRA 2HKOA 2CW7A 5CVVA 1MBJA 3S2DJ 2I3CA 2X9DA 3ZMUA 3WTXC 3F8KA 1UHAA 4DYRA 3NA6A 2X6XA 1BR4A 1X3ZB 1QNTA 2KIUA 1V4RA 2WUUA 4HF2A 2ZENA 1HW5A 1ZREA 2J5OA 3HXLA 5B5EC 3LAPA 3L9FA 4D0PA 3CC4I 2Z3NA 3TMOA 3S6GA 5DUKA 1V5GA 2NOGA 2VZZA 1MH4A 2QCOA 3RPUA 4B09A 3N7ZA 4CH7A 1XOVA 3M4OJ 1OCCH 2FE7A 1STZA 2JPCA 1D0ZA 1FPQA 2J87A 2QENA 2R5YA 5DTDA 1N13A 4NB5A 3VYSB 1USSA 1HDPA 3BJAA 4C2MJ 4CYCA 1QSMA 2WCYA 1S6LA 2BL1A 4JP0A 1G3WA 4MHGA 3CCSI 4OP4A 4CAXA 3B7IA 3IKVA 1Q7LA 4NHJA 4PXCA 3TJQA 5HVGA 4K30A 3CUOA 4XNHB 4UHTA 2DYRH 3A9LA 2RV8A 2FMLA 1T33A 5IYBJ 2LRDA 1TQIA 2VBXA 3OWTA 1FYKA 3R96A 1RIOH 4HV6A 2CJJA 1TLHB 2DPTA 4FD6A 1TTYA 1IB1E 3W6VA 2KMQA 1FWZA 1SAUA 3WTUC 5LD2C 4JQFA 1IU8A 3ZOBA 3ABKH 1PUAA 3U21A 1TGSI 2F5DA 4E7KA 3D5SC 1F9NA 2CRGA 2FNAA 4RDUA 4BQQA 4UWIA 4MNUA 2V4JC 5CVRA 4OMYA 1D8JA 4QVTA 5BOXA 5IYDJ 3GMEA 4B5PB 3TGNA 2ZJRF 4E0AA 2VOPA 3IRQA 3EDPA 4WXCA 2B4DB 1EH6A 1PJUA 1U6MA 2PMZA 2Z16A 5K8OA 3KYCB 2JRMA 1A6QA 3KKWA 3M3YJ 1AWCA 1TWHJ 2XKOA 4M6VA 2BCOA 2X52A 3QYBA 4BEHA 1JKRC 3RYOA 3P5JA 3PDNA 3L00A 1IY7A 1B9MA 3NRVA 2VOOA 2B0UC 2ZW4A 2CUFA 4MTEA 5M5YJ 1MMSA 4YGOA 4FX0A 3DU5A 3D2PA 2R7ZJ 2EK5A 2ETHA 3NQOA 4P1WA 1R3NA 2FF4A 5D5VB 2HYGD 3UFFA 2F5VA 3D3SA 3V38A 4KOVA 1NMTA 2D1HA 1R5GA 2OJED 2DQLA 4GO1A 5DCFA 2FNFX 3V8JA 2AJ6A 2DU9A 2PRQA 3LSMA 2K27A 4KVOE 3GFIA 4AYBA 2EINH 3CCEI 1H8LA 3OMYA 1XSVA 2OC6A 1YQEA 1B6BA 3DTEA 5HDGA 5ICCA 2KIQA 4NQWB 2HDDA 1CQTA 5HS8A 1LFUP 1PYTB 1P7IA 1T2KA 5HNHA 2AFOA 3ZZIA 2WVJA 4KUBA 4IHVA
chains in the Genus database with same CATH topology
3CXQA 1Z1DA 3RKYA 5HLGA 4CGMA 2L3DA 2CY2A 3W6SA 1G3YA 4PCQA 2REEA 2K4BA 5DDGA 1S7AA 2X4HA 2Z11A 2K5TA 4R9MA 4LG0B 4H0EA 4LX9A 1KGSA 2FIWA 1Z9UA 3ISPA 4CS0B 4EJVA 2NMTA 1CF7A 2I79A 2ZPAA 3GYAA 4L8AA 3FM3A 2FU4A 4CYDA 1Y9KA 3TOBA 2P6TA 2QYOA 4PSXA 4CZZA 3EO4A 1HKTA 3BPXA 2OU2A 4MQ9F 2ZNZA 1LJ9A 4CDGA 2PMHA 1YR0A 2ADUA 1DPRA 4XLPF 2BEIA 3ML6A 4R57A 3WE2A 2FMYA 1S60A 1BO4A 1PDNC 2HFHA 4RB3C 2B58A 3SFZA 1IN7A 1UHWA 4KYWA 1JE8A 3BJ8A 4PK3A 1WWXA 3O2PE 1MK4A 4G6QA 1R5HA 5CLSA 3C3WA 4HQMA 5D4RA 2EJRA 4H89A 3V8KA 1QSTA 4GGGA 4KIBA 4L5IA 4H6UA 2OB0A 3I5UA 2FNPA 5D8KB 3HUGA 2HZTA 2P7CB 4IPAA 1CM0A 4ENKA 1IW7F 2DAOA 2UWMA 1KQ0A 1ZN2A 3W6XA 2WC2A 2MH9A 3V7RA 3M7GA 2Q8KA 2E1NA 2PFBA 3DQVC 4ZH4F 4OADA 4UV9A 2XKPA 5H86A 4AVAA 4IHSA 1WKMA 2W85A 3FMQA 4KOYA 4IVNA 4M9ZA 4NCZA 1IZ1A 1QZZA 4OU0A 4ESFA 2Q04A 2ZW6A 5DWNA 3EYYA 2EV5A 3SXOA 4ESBA 4UCNA 4FD5A 1RUNA 2M30A 4LB5A 3FIXA 2A61A 1M1DA 4KN7X 2J8MA 2ZBKA 1S5KA 2EFNA 4MHDA 2HOEA 2B3VA 4EM0B 4LLLA 3F8NA 1O7LA 4U0WA 1I1DA 1M4GA 4A5MA 5G21A 3DXJF 1J5YA 3FWEA 3FB3A 2XVCA 2MLKA 5E18F 2FBKA 5IX3A 1XF8A 3FXRA 4OMZA 3ZMDA 2OQRA 4I01A 1M44A 3ULQB 4CGPA 3FNCA 2YR2A 5FFZA 2IPQX 1J4JA 1Y9WA 1QO0D 4JXRA 2LKPA 5FO5A 1XCVA 1LDDA 5F1RA 2HUZA 3EY5A 5EEGA 1SD6A 1YVKA 2FEZA 3WGGA 3LD2A 4EJOA 1GXPA 4M73A 1EH7A 2JTVA 2ATRA 4QUSA 3E5QA 1S7KA 2FL4A 4YIFA 2JDDA 2JDCA 2IA1A 1F4KA 4L5JA 1B1BA 4KICA 3IWFA 3W6JB 1PUEE 4UWJA