1FY7A

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
273
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast Esa1 suggests a unified mechanism for catalysis and substrate binding by histone acetyltransferases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords ESA1 HISTONE ACETYLTRANSFERASE
total genus 81
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fy7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1fy7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1fy7A02
1IB1E 4ON0A 2K7LA 3W6JB 4AD9A 5E8GA 1MZBA 4H6ZA 4LGWA 3LAPA 2OB0A 3F0AA 4KYWA 1QPMA 4EJVA 4YFJA 1W5SA 4M73A 4UA3A 1YTYA 1YX0A 3GF2A 1P4XA 1J7KA 3G73A 4IRIA 4MTEA 1NE9A 1QSTA 4L18B 2ESHA 3S6KA 2HYGD 3ZMTA 5L3GA 1FT9A 1R1TA 3C18A 3EFAA 1PUEE 5ERIA 3PP9A 3IGRA 3ECOA 4FD6A 1CF7A 1TLHB 4AVPA 3D5LA 3F8NA 4YRHA 4GGGA 1CJWA 2NMTA 4MEYF 2ADUA 3QRFF 3HUGA 2LDUA 2X0LA 4A0XA 4EGZA 2EUIA 2HUZA 2M8EA 1GXQA 1KUYA 1P4WA 2W24A 1MDMB 1WI9A 2JDDA 1JHHA 1V3FA 3K0LA 1S5KA 4HLXA 1LDKB 1NMTA 3JSPA 1OR7A 3NRVA 1FBQA 2O0YA 1S7NA 4IF4A 4F7ZA 3JSOA 1RZ4A 4Q4ZF 5TRDA 2D2WA 3FF5A 4M71A 1C0WA 2VBYA 2J8NA 1M4GA 5BPDA 3F5BA 4L9JA 4U7BA 1RUOA 4IHTA 3FBUA 4OINF 4IJAA 3CUQA 3ZMZA 4WXDA 2WWYA 1M1DA 2AJ6A 2E1CA 1S6LA 2QQ9A 1YFHA 3WODF 4G6QA 1R1VA 4R8HA 4ZYDA 2ZBKA 2VN2A 3KZZA 2VC0A 2LKPA 5CJ9A 2A61A 2MBFA 2OAZA 5BMZA 4L0YB 3E3VA 3N97A 3GZ6A 3P9CA 1XMKA 2QM3A 1EH8A 2FIWA 1T98A 3BPXA 5D8KB 4K2EA 4QLCU 4KN4X 3FXQA 3VWDA 2DQRA 4GO1A 3TDUC 2HR3A 2ZW6A 5EEHA 3K9UA 1FC3A 5FO5A 5EC4A 2EA2A 3I71A 2H5MA 5IV0A 2UWMA 4UHTA 3KLOA 3RYPA 2HWVA 4BMHA 2EJRA 3JUWA 4ZZLA 2FNPA 3EY5A 3JVNA 4ZYGA 3BY6A 4KT5C 1CF7B 1U6MA 4KUAA 5H84A 4UWJA 2DO7A 2RV8A 2EFOA 2R98A 4QC6A 4HOBA 4R3LA 4R87A 3R9EA 3BJAA 4KNYA 3EC4A 2OZHA 1Q2DA 3B73A 5DCMA 2F5IA 3GZ5A 4F0YA 1KQ9A 3VB2A 5E20A 5A2QZ 2B0LA 1B59A 1V0CA 2CY2A 2OQGA 1HW1A 1IICA 2ZW5A 2Z99A 4PZJA 4RS2A 5E1XA 1SD6A 1UHWA 1QSRA 2I00A 2K4BA 2FQ3A 3VFZA 3HRTA 1XDUA 3I4PA 3LQRA 2B3UA 2RGVA 1Y9WA 3E0KA 1BOAA 1J5YA 3NE7A 4XNHB 1XIXA 2QQAA 4RGSA 2ZW7A 2NRAC 2IT0A 3OWCA 2J8RA 5KTCA 3FYNA 1D3YA 3WGHA 5JI6A 3TDZC 3GEZA 2FS5A 4BH9A 4ETSA 3G3ZA 1YS6A 2ISYA 1EH7A 2PN6A 2NAZA 4QBJA 1YYVA 5LBQA 2L4AA 4MTDA 2ZW4A 3EXNA 1HW2A 4HA8A 3LFKA 3EUHA 4R9MA 4L9VA 3QP6A 4HAMA 4EVIA 4CYDA 1ZGAA 3IWGA 1BC7C 2PMHA 2QLZA 2ZO4A 4L5IA 1YW9A 4EJTA 2R8VA 1OYWA 3PQJA 3M9AA 4AG9A 3W6XA 1U5TB 3VOEA 1I1SA 3C1DA 3WE2A 4KOXA 3E5QA 4KOSA 3I59A 1OYYA 4BHBA 4P5OA 1ON2A 3EO4A 2Z0ZA 2XAGA 1IYKA 2KJBA 1F5TA 4G8XA 2L3DA 1O3RA 4NQWA 2D4PA 2JPCA 2E7WA 3ZZIA 2W84A 2BEOA 2GAUA 3DP7A 3J7AO 2HV2A 2CFXA 3FRMA 3LSTA 3WGIA 2HEOA 2QYOA 3V7SA 5HS7A 3FX3A 3D2MA 2ZFWA 2DT5A 2OBPA 3DQVC 3WU0A 4G9YA 3WTZA 2Q7BA 3TOBA 3L09A 4Y49C 2K27A 4KIGA 1J2XA 4G7ZF 2O28A 3KP2A 3K9TA 3HRUA 1W7PD 2IVMA 4IVNA 5DUKA 1YW8A 4PSWA 3DPTA 3G8WA 4EGYA 3RIRA 3R4KA 3SHFA 2KIFA 1G3TA 2IJLA 2PR1A 1ULYA 3TFYA 1CM0A 3TKYA 1FNNA 1T0FA 4L9TA 4QUSA 1PDNC 3FMSA 1HQCA 2ESNA 4A5NA 1A04A 2DPDA 4M9XA 4ENNA 5KK1A 4HDVA 3BJOA 1IN8A 1TBXA 2L02A 2EFPA 5LRSA 3HSFA 1FYLA 1K78A 4KOVA 3R9GA 4I01A 1LNWA 4HW0A 3G3SA 3I64A 3T8TA 3WTWC 4HZFA 3DEUA 4OLLA 2Y75A 4EM1A 5HS9A 4I02A 1F9NA 3WR7A 4M72A 1S8NA 4MHDA 1IXSB 2H6CA 3GWZA 2FNAA 5LRRA 3F8KA 2A3SA 3HOSA 3E97A 3J81Z 3UY5A 4Q47A 6PAXA 1N71A 3HIFA 2P0WA 2K5TA 5BQTA 1T38A 2ZCWA 1IUYA 3QU6A 3GKRA 4TV7A 2CYYA 2CQKA 4CDGA 4H89A 1QNTA 3TQNA 3TGNA 2Q04A 4XPDC 2G3TA 1U2WA 1U5TA 4I98B 3RPQA 3IRRA 3QB8A 1R00A 3F6VA 1QBJA 4ORFA 1IN5A 2P8TA 4LJZF 5FVJA 2ATRA 5LHGA 1OKRA 4XPLA 4U0YA 3C3WA 2XAHA 2J5PA 2EV5A 2ZKZA 3EETA 1ZYRF 4YGOA 3K1PA 2WC2A 4M6XA 1QO0D 3F21A 4XPDB 4BYYA 3R96A 3HTUA 2F5EA 1DDNA 4I09A 2QIRA 3FXRA 4U0WA 3R6SA 1HKQA 4I2OA 1S3JA 2G7HA 5JQ4A 5DD4A 2DBBA 3TTHA 2QWWA 4N9HA 1L0CA 3WTYC 4WX9A 2P7VB 4H6UA 2HQYA 2V9VA 2YU3A 3SZTA 1S7AA 5BPIA 4B5PB 2M87A 1GHEA 2REFA 4JLYA 1QGPA 3H92A 1M44A 2PC1A 3L00A 1W7PA 3M8EA 3GYAA 1YREA 2ISZA 1FWZA 1S7KA 3LA2A 3WTXC 2J5OA 3VEPA 5F64A 5AIPA 4AB7A 2Q2EA 2XAJA 3E5XA 3N4MA 2VODA 1JE8A 4NB5A 3EYYA 5C82A 3CUQC 2YPRA 1D8KA 4M6YA 3F8CA 2VC1A 5DWNA 3HRMA 4R1HA 4ESJA 1IXRC 1R22A 2CSOA 3FNCA 1IF1A 2A07F 3ZMDA 1B6AA 1S7LA 1Y0UA 2F5CA 4BQAA 3KLNA 3RJPA 4B09A 3I5UA 2QBYB 3D8PA 3RKYA 3CUQB 3BDDA 4KOTA 1YW7A 5E18F 3DPLC 2EV6A 5BOXA 4OADA 2JSCA 1S60A 3WGGA 3MQ0A 3OV8A 4UXNA 2HQNA 1P4AA 1H9TA 4A5MA 4HF1A 3KP4A 2CO5A 5H6QA 2E1NA 1R57A 1KQ0A 1BI2A 2P6GA 4AVAA 4B5OA 3QU3A 4PV6A 5C88A 3MZHA 1T39A 2Q0YA 2HKOA 3VWEA 4NSQA 2DI3A 1S7OA 5J6XA 1VTNC 2O8XA 1KQ8A 3MGDA 1G3SA 2RNJA 2H27A 4Z2YA 2WPWA 2XUBA 4HLYA 1H9GA 5D8LB 2AE6A 1BI1A 4MEXF 4G94A 2O6GE 3S6FA 3LWFA 4AVCA 3I58A 3R0JA 1NSLA 3DNSA 3P7NA 1HSJA 4HX7A 2HGCA 3WE3A 2G7UA 2RC4A 2JTVA 3O6BB 3OOPA 4YIIA 1SD4A 4EVYA 2ZXJA 1HW5A 1P4NA 3K2ZA 5HLHA 1D5VA 1P0HA 2WPXA 2MA3A 3L9FA 1ZGJA 3M7GA 4M85A 4RI1A 2EWNA 2PJPA 4RGXA 2DK8A 5H20A 2LF7A 4IF5A 1KU3A 3JW4A 1I5ZA 3ABUA 2VOPA 1HKSA 1ZN2A 1YLEA 2NS0A 2QBYA 3QPHA 1P92A 2R1IA 1QZZA 3DKWA 1UHMA 3R0AA 1IZ1A 1STZA 2A5YB 4HV5A 4I7HA 3RDIA 5LGNA 3BJ8A 1I1GA 5DEQA 5CVVA 2EFNA 3S2WA 1SD7A 3ZMVA 1HSTA 1TNTA 1T6SA 4AIHA 5LHIA 4GCVA 1FP2A 3KP7A 3C7JA 1XF8A 4X5KA 1PP7U 4RS8A 1U5TC 4Y17A 3R60A 1B9MA 5JR3A 4E70A 4MI4A 3U1DA 1XGSA 1ZRDA 3QOPA 3KETA 4JXQA 4KMFA 5DWMA 5FD6A 3ROUA 5FLXZ 2IPQX 3T0YA 2DLLA 4P9UA 4JWPA 4Q48A 2LF8A 3I54A 5F48A 1WWXA 2KKOA 2B5GA 4OMZA 5F6FA 2OU2A 3LA7A 4ZBGA 4MJ8A 4I0AA 1MJBA 2RVCA 2OH1A 4EJOA 2PBIA 2FRHA 4EQQA 3TCVA 2E7XA 3W6SA 4I49A 2OZGA 3P9KA 2QQBA 2DXQA 3PFIA 2FMLA 5DCFA 4S05A 1O7LA 1XGMA 2D1HA 2VXZA 4P9FA 3PQKA 5D4SA 5JPHA 4O5VA 2Z3YA 4A0ZA 4P55A 2A6HF 2P4WA 5F49A 1FX7A 2FE3A 2DQLA 1JGSA 3ZPLA 2P5LC 4F6AA 1EV7A 4A2UA 2J8MA 5HDKA 2VZZA 2F5FA 4PCQA 3R1KA 4L8AA 1FOKA 2IRFG 5L3FA 1ON1A 4MQ9F 5L3DA 1IXCA 2Y48A 5HDNA 2MC3A 1XN7A 2Z9OA 1M4DA 5J8FA 4NCZA 1W7PB 4LG0A 2IA0A 4YFNF 2L01A 3HTSB 2MLKA 3EYIA 5ILUA 1USSA 4KN7X 1AOYA 1XSXA 3VODA 3PGPA 4HDUA 3FB3A 4EJWA 1L3LA 4OMYA 4JD6A 5HH1A 3IC7A 4NXYA 1R5GA 2MLGA 4EJUA 4KDPA 1IN4A 1E2XA 3ZP5A 5L3EA 5HLGA 1MJ9A 1RI7A 2CG4A 2CGPA 2STWA 4G7OF 1IRGA 1UCRA 4FX4A 4OIQF 5D5VB 3COAC 1YLFA 1FYMA 3L2CA 4OIOF 3ERED 1I6XA 1I27A 1IN7A 4RB0A 4LG0B 2GZWA 3TO7A 4RB1A 2GIVA 4JBAA 4YG2F 2ZNYA 1O3TA 1ZAOA 3TT2A 3ULQB 2FA5A 2IP2A 4LB6B 2XASA 2HYFA 2L54A 4PSXA 1LVAA 3V8LA 2B4DB 4AIJA 4A6DA 1QSNA 1X3UA 1R5HA 1BM9A 2KIUA 1KA8A 1RIOH 1YQAA 4L89A 1Z91A 3SXOA 2GQQA 1YVKA 2M30A 2YX4A 3T90A 3NEUA 5LEKA 5KTDA 1WQ2A 1Z6TA 1PP8F 2NNNA 1VHSA 2R7DA 5L3CA 3K69A 1YR0A 3H3UA 2M5WA 3V8IA 5K5OA 1MDMA 1R36A 2VBZA 5FFZA 4XSXF 5L3BA 3CO7C 1Z6RA 2UZKA 1SMYF 4GYIA 5IT9Z 1IN6A 2QUFA 3ZN1A 2VEZA 2WV0A 2BBYA 5CVRA 1Z4EA 4LK0F 2Z10A 2XVCA 2OA4A 3BJ6A 1K6OA 1TW2A 3EQLF 3DXJF 3KFWX 1QSMA 3HHGA 3GVAA 3DF8A 2C27A 4BAYA 2FSWA 4KIBA 5CVUA 2IA2A 1DP7P 1MKMA 3P2HA 2XIGA 3E6CC 4H0EA 3J81K 2PSWA 2H94A 3IKTA 5H86A 3R9FA 2W85A 3J80Z 4KMUX 4LB5A 1I1DA 4UV9A 2Z33A 4JXRA 2H6BA 2XKPA 3H4QA 1U3EM 1WSUA 4QVTA 5CYVA 1GHCA 1WK4A 3W91A 2F2EA 1ZHFA 4O3MA 1ZRFA 1XE4A 3MAJA 1Q2CA 4ZYHA 3WU1B 2RQPA 2XHKA 2YSRA 2GXBA 3F22A 2CW0F 3FMQA 1LRZA 1BJAA 4KFCA 5F1RA 3FZVA 4ESFA 2VXKA 2QZ8A 2XAFA 3ZN0A 4LX9A 3GFJA 2B4DA 4KUMA 1B87A 2MD5A 3GX4X 1K79A 3SHPA 4A0YA 1BOBA 1G3WA 1XCVA 2P6SA 2VT2A 1O3SA 3D3SA 4YFXF 3KEOA 1R58A 4LFUA 1ZG5A 4A12A 5F47A 1JXSA 2B4BA 1BI3A 1BIAA 4UVAA 3CXSA 5FB2A 1LEAA 3LA3A 3BPVA 3IKVA 1KUVA 4RB2C 3ABTA 1WWZA 2LSOA 2HS5A 1YG2A 4IHSA 3BP8A 3DSBA 3IL2A 3CUOA 1QSOA 5LGTA 4JQFA 1YS7A 2BSWA 4CXFA 3IRQA 3GFMA 4DNCA 5GCNA 2GE3A 5HOOA 1Y7RA 1YVOA 3R61A 1O57A 4HQEA 1PUAA 1LDDA 1SFUA 2EFQA 2M1BA 1USTA 2YX7A 1KU2A 4R57A 2PMUA 2FE7A 2X7BA 2Z11A 1BI0A 3FIXA 3C26A 4HKFA 5KTAA 2IL4A 3TOAA 3FM5A 5FLXK 1ZG1A 2XGXA 3PZJA 1S7FA 2BUEA 4GYGA 4OOIA 3HRSA 4CAVA 3REOA 2STTA 2V1UA 2FL4A 3IWFA 2NNYA 3HYIA 2DW4A 3SXNA 5HMNA 5LLQA 1IAWA 1U78A 3I9SA 2Q44A 4MHGA 2G9WA 2VZYA 1G3YA 1O3QA 3I59B 4ONUA 5AONA 5JFRA 4CO8A 4GS4A 3E6BA 2GA2A 2IW5A 1ON0A 4M9SA 3KP5A 2XROA 1Y9KA 5ICGA 2EFWA 5DUIA 3M1EA 1ZRCA 2PEXA 2GA1A 2FMYA 3CJNA 1I21A 2PLYA 3RTRA 1G6NA 3O2PE 4N9IA 5KVRA 3ELKA 2PR8A 1K7AA 3QPTA 1TQIA 2A69F 1FBSA 4IRHA 3T8RA 2PG4A 4O6JA 3CDHA 3LODA 4ASNA 4RAYA 5IT3A 4L9NA 2HFHA 3F6OA 4IUSA 1K4JA 2VQYA 4WXHA 4GXOA 4KVOE 1J4JA 2W25A 1XEBA 2Q4VA 4KA4A 4XSZF 2BE5F 1FZPB 3SZPA 3RPUA 2A6EF 4Q5SF 4WK8F 1FSEA 3IWZA 1XCBA 2PDOA 4E8OA 3CXQA 5D6FA 1LQ1A 2FCKA 4L0ZB 1B9NA 2HKXA 2ARHA 4I0BA 1XD7A 2DU9A 2JT1A 2GWRA 3FM3A 4ENJA 3L7WA 3WTUC 4U0VA 1HBXG 2WTEA 3GFIA 4J3GA 5K5QA 1J59A 3CLOA 1FPQA 3D2PA 2VI7A 1FBUA 1SFEA 4EMSA 4S04A 1LDJA 1TIQA 1G4DA 3JTGA 1LB2A 3U9GA 2BV6A 1OPCA 4AG7A 1XSVA 2ELHA 3TO6A 4CHUA 1LJ9A 2FEZA 4AIKA 2PQ8A 2ZNZA 1BBYA 3T5XA 3T1BA 5IB0A 1R23A 1YGHA 3Q9SA 1KZFA 4IPAA 1LEBA 3K1NA 2C6YA 5EEGA 3ZMSA 2BGCA 4AWXB 2EVNA 2XV4S 2ZMEA 3JAMK 5CVJA 4BHCA 4XLPF 2P6FA 1P6RA 4UWIA 1SAXA 3CTAA 4HBLA 1EH6A 1YK3A 4AVBA 3WG9A 1J0RA 1R7JA 4UNOA 2ZMEB 3GXOA 2QENA 5E8IA 4HYEA 3ECHA 4U5YA 3Q5FA 4CRZB 3BJ7A 5FGMA 1TW3A 1REPC 5K5RA 3F8FA 3M8FA 4KLWA 3SQNA 2VE8A 3MEXA 1FSHA 3EDPA 4KOUA 4NF1A 3F8MA 5AIQA 1YO5C 4DQ2A 2R7HA 3GO5A 1HKTA 1GVJA 2O3FA 3MFKA 3WTSC 2F5DA 1BO4A 5DYMA 3D0SA 2O03A 1ZREA 2EA4A 5DDGA 1RXTA 4KOWA 1Q2YA 5DCMB 1FYKA 2CNSA 5E1WA 1RO5A 4KORA 2RDPA 5E1ZB 1ZLJA 2JLMA 3GY9A 3B02A 4NHJA 4NEXA 2CWEA 5LHHA 1P2FA 2K4JA 1F1ZA 2BYVE 4FHTA 5IT9K 4E2AA 2MH9A 4KIFA 1UB9A 4FD5A 2DTRA 3K1MA 2BL1A 1IYLA 1S29A 1BIBA 3DV8A 3S6GA 3QP5A 4BNCA 2PI0A 1FP1D 1J9IA 3U2RA 1XGNA 3LQQA 4UVBA 4CICA 2Q4YA 1D8JA 2HQRA 3V7RA 2B5GB 3KP3A 2D1VA 4PGGA 3HSEA 4OAEA 2K86A 2K02A 1KU7A 1QQIA 2CNMA 5TJJA 1KUXA 1XSDA 2FXFA 2VBXA 1Z9UA 4QB9A 2COMA 2EB7A 3V8KA 1DUXC 1KU9A 3P2FA 5I0CA 1Q1HA 1XB4A 1ZLKA 1U8RA 1Z9CA 4A6EA 1GXPA 3MWMA 3I0TA 2GANA 3LAJA 2P6TA 2FT0A 2ZPAA 1DPRA 4OU0A 1DPUA 4XPKA 1O7FA 4FD4A 1HXDA 4XLNF 2PFBA 5BS6A 2ACJA 3F23A 1Z4RA 5ILSA 2VT3A 4HNYB 3Q9VA 5CVIA 4CS0B 2D4OA 5FFXA 1TNSA 3JAMZ 3V8JA 3P9IA 3GUDA 2XRNA 4UUVA 3CO6C 4QWQA 3FHZA 2B3VA 3JTHA 2JZYA 3RKWA 4RAZA 2OZUA 3BROA 4ENKA 3KE2A 4YIFA 3DR8A 1K78B 1QZYA 3SFZA 2G3AA 3J80K 3MZYA 3SXYA 2XAQA 3E5UA 3FWEA 1PU9A 2DFIA 5D4RA 5ICCA 4M9ZA 2KJCA 5A2QK 4KUBA 4XBFA 2VOOA 1FLIA 1OMIA 3QAHA 1SMTA 2VBWA 4ENMA 1J75A 4LLGF 5CLSA 2R7FA 2XKOA 4B5PA 1XMAA 4LK1F 3E6MA 4UBRA 1I12A 3ZJ0A 1NHAA 3GW2A 2PRBA 3ZQ7A 5JHUA 1SD5A 2QECA 1U6GA 3IHUA 2DPUA 1SFXA 1XMTA 3DR6A 3LD2A 2X4HA 1V4RA 4UV8A 3ISPA 2BEIA 2YR2A 4CZZA 4IRGA 1Z7UA 4XRFA 4YFKF 5ED4A 2CNTA 1W5TA 1TQPA 2VE9A 5E17F 2OQRA 4HQMA 3V7CA 2JEVA 3V4GA 5D5WB 2OZ6A 2EV0A 3KP6A 1RUNA 1B4AA 4KVME 2RKHA 4WCGA 2FSRA 4HF0A 3F3XA 3WTVC 5CNPA 4HX8A 4Y13A 1MJAA 2Q0OA 1ZG3A 1KGSA 2QMLA 4EM2A 1XGOA 4MGRA 2AS5F 1ONVA 2HZTA 1E17A 4HF2A 4MQVA 4CGZA 4FT8A 1MD0A 3RI4A 2FOKA 3N7ZA 4KLVA 1ZARA 1R1UA 4RGUA 4RB3C 2V1XA 2REEA 4HV6A 2MH2A 2V79A 5JVTA 2B58A 4WF2A 4LD5A 5D6EA 3KEQA 1IW7F 1WRJA 3RYRA 4EV0A 4LMYA 1UFMA 1OZPA 2NYXA 3HSRA 4U9YA 1IIDA 4U9ZA 3KKWA 4MBUA 1KYZA 1T2KA 5J8CA 5LGUA 2RN7A 2D45A 4M74A 3CXPA 4KZTA 2FF4A 2UXNA 4G6DA 5HS8A 3I53A 1KYWA 4U7DA 3ML6A 4PGHA 4FD7A 3B8GA 4G7HF 2P5VA 3KZYA 3BWGA 3BZ6A 2G0BA 2FXAA 2GXGA 2HTJA 2O61A 1B1BA 3GYHX 2M45A 2JPBA 5DV5A 4MNUA 4WXCA 4WWCA 4UVCA 3WTTC 5FD5A 4P96A 4B8XA 1VKCA 3GLXA 3HOTA 1ODDA 4ESBA 5ISVA 1FY7A 2ZXVA 2ETHA 2Z5UA 4RGRA 1AWCA 3S6HA 3F8BA 1MK4A 4R79A 4BXUA 2UXXA 1Z05A 4M3SA 3BOQA 3HHHA 1XDSA 2L4MA 3DDDA 4HNXB 4CAXA 4PK3A 3BLNA 3TO9A 3RKXA 3R95A 2FU4A 3H3ZA 1YIOA 1F4KA 5HDGA 4LLNA 4K30A 3F72A 4U88A 4R3KA 4XNHC 2P6EA 1JHFA 4PK2A 2KCWA 4LUAA 2VONA 2ZJ2A 2TDXA 1IRFA 5ICEA 4KVXA 3AAFA 1WKMA 3I3GA 4OIRF 5IX3A 5H6RA 4HNWB 1RNLA 2QVOA 3ZMUA 2LNBA 4LLLA 1ZH5A 2Y0MA 2Q8KA 3KCCA 4PDKA 5HVQC 4FX0A 1UFHA 2KIMA 3NQOA 4Y15A 5F46A 4KICA 4II9A 3FXTA 5DD8A 2HTSA 2R3SA 3MCZA 5D5XB 3GFLA 2V6CA 1MGTA 4IXAA 4MY3A 5E96A 3TE4A 1BC8C 1S3ZA 1H0MA 4EM0B 2IA1A 2W57A 2VBQA 4N0BA 4JK1X 3FMRA 4HX4A 2A68F 2H09A 5ILVA 2HOEA 2KRFA 4D0PA 5LEJA 1BN5A 2A4NA 1OYIA 4JJXA 2P7CB 5D5UB 3E6DA 4ZYEA 5HLIA 3O3KA 2FBHA 2FIAA 3FXUA 2DK5A 4ZH4F 2DAOA 5K1YA 4KOYA 4MY0A 2EK5A 1W4MA 2JRTA 4CAWA 4ZZDA 5ICFA 1Z1DA 3T9YA 4OIPF 2HDCA 2AXLA 2V1DA 1TQMA 1M4IA 4CRYB 2P5KA 3DFGA 1B6BA 2OD5A 3RYOA 1L0OC 3W6KB 2FBKA 1CGPA 5EBVA 2JDCA 2I79A 1SQHA 2FBIA 4E0AA 4Y49B 1TTYA 4BHPA 4L5JA
chains in the Genus database with same CATH superfamily
1ZLIA 3ZQLA 1IB1E 4IAVA 1LANA 4ON0A 3JRCA 2K7LA 3W6JB 2L7FP 4KT6A 4AD9A 3ZQIA 3OYFA 4J01A 4A3DJ 5E8GA 2ZEPA 1MZBA 3D5RC 4H6ZA 2CWGA 4P4DA 2L2OA 4LGWA 3ZGKA 3LAPA 4XKCA 2OB0A 1K4SA 3F0AA 4KYWA 2V1CA 3DWLE 1QPMA 2ZEDA 4A30A 1ZG8A 4MHZA 4EJVA 3PBEA 4YFJA 1W5SA 4M73A 4UA3A 3BG7A 1YTYA 1YX0A 3GF2A 1MBJA 1P4XA 1Z8XA 1J7KA 3G73A 4IRIA 2XEIA 2M8GX 2R5YB 4MTEA 1NE9A 1QSTA 3CCJI 1SGDI 4L18B 3B3TA 2ESHA 3KYLA 2PJ5A 3ASNH 1ZGWA 3S6KA 2HYGD 3BI0A 3ZMTA 5L3GA 1FT9A 1R1TA 3C18A 3BR1A 3EFAA 1PUEE 2QEXI 5ERIA 2MC4A 3VYRB 3K2AA 3PP9A 2CUJA 4XLFA 3IGRA 3ECOA 4FD6A 1CF7A 1QHGA 1TLHB 4C2XA 3W2WA 1E3PA 1FIAA 1KMAA 1IV6A 3H5RA 2DN0A 3NWTA 4AVPA 3LSJA 3FEDA 5ELYA 3D5LA 4AYBA 3F9KA 3F8NA 4BQNA 4YRHA 4GGGA 1CJWA 2NMTA 4MEYF 2ADUA 2Y31A 3QRFF 3HUGA 2LDUA 2X0LA 4PFPA 4A0XA 4HNVA 4EGZA 2RFHA 2EUIA 2HUZA 2M8EA 2H8WA 2V4JC 1GXQA 1KUYA 1P4WA 2ME0A 2W24A 4DBQA 1MDMB 3GTMJ 3OVOA 1WI9A 2JDDA 2LG4A 1ORKA 2W0TA 1X1CA 3O8HA 4C3JJ 1JHHA 2DMTA 3VYUB 3NARA 1TZLA 1V3FA 2LYCA 3K0LA 1S5KA 2PJ2A 4HLXA 1LDKB 1NMTA 3NFZA 2W7NA 3UKGA 2LD5A 3JSPA 4HRIA 1LCPA 4OVOA 1TOTA 4CGNA 1OR7A 1W0UA 1OVOA 1J09A 5B1BH 3NRVA 1FBQA 2O0YA 3CMMA 2ID6A 1S7NA 2QPOA 1Y1CA 4OC0A 3R5DA 4A95A 2Y9YA 4IF4A 4F7ZA 3JSOA 1RZ4A 1SGPI 4NFRA 5JHWC 3MKZA 3DEEA 3U21A 2GU2A 2PMZN 2P6AC 4Q4ZF 3QYFA 4X2TA 3PUBA 5TRDA 2D2WA 3FF5A 1MNMC 4M71A 1C0WA 2V8GA 3BR0A 3RSNA 2VBYA 2J8NA 1M4GA 1QA6A 5BPDA 3F5BA 4L9JA 4U7BA 1TKHA 1YMEA 1BA5A 4OC4A 1B72A 2PRQA 1RUOA 2ZSHB 4IHTA 4OINF 3FBUA 2CWHA 4ZGYB 2IAIA 4IJAA 3CUQA 3ZMZA 4OC2A 4WXDA 2WWYA 1M1DA 2AJ6A 1SVMA 2Z3MA 2E1CA 1S6LA 2QQ9A 1YFHA 5LYIA 3WODF 2EZHA 1R1VA 4G6QA 4R8HA 4A3EJ 4ZYDA 2ZBKA 5FUYA 2VN2A 4DGWB 3KZZA 2LBFB 2VC0A 5JHFA 3L2RA 1UVFA 1TBRR 2VJ4A 2LKPA 3E0JB 2A61A 2MBFA 2OAZA 3HC7A 5CJ9A 5BMZA 4L0YB 1YQEA 3E3VA 3N97A 3SEQA 4CYOA 3GZ6A 3P9CA 1WJDA 1XMKA 2QM3A 3IJ3A 3OIPA 1JTYA 4XKWA 1CQTA 1EH8A 2FIWA 1T98A 3BPXA 5D8KB 4K2EA 2ERWA 4QLCU 4KN4X 1BUSA 3FXQA 1HDQA 3VWDA 3B4VC 5K8MA 4C3IJ 3G1MA 4ZC3A 3OYAA 1CX8A 2DQRA 3FJUA 3VWBA 2X1CA 3SI2A 4UFVA 2FUG2 3B6CA 5E3OA 1LFUP 2LMDA 4GO1A 3TDUC 1XMBA 5M5WJ 3GB0A 2HR3A 3J7AY 2ZW6A 1V5EA 5EEHA 5J47A 2B8TA 3K9UA 2M34A 1FC3A 5FO5A 1HEVA 3S9LA 2SGQI 5EC4A 1OYVI 2EA2A 3I71A 3NAUA 2H5MA 5IV0A 1QRYA 2K40A 2Y0SA 2UV1A 3BTJA 2HNHA 3MMYB 4N4NB 4UHTA 2D5VA 2UWMA 3KLOA 1IY5A 1R3NA 2C6GA 1FMWA 3RYPA 2HWVA 4BMHA 2EJRA 3OYGA 3JUWA 2SGPI 4NBQA 1E3OC 3DU6A 2LKXA 1P9QC 4ZZLA 2FNPA 1A36A 3CCYA 1TKFA 3EY5A 3JVNA 1NG6A 4ZYGA 3TP3A 4Y4RA 3BG9A 3BY6A 9WGAA 4MFQA 4KT5C 3UNGC 2IGNA 1CF7B 2Z3KA 1U6MA 2Q1ZB 4KUAA 5H84A 3OYCA 1K83J 1WGCA 3WG7H 4CH7A 3KR5A 4UXIA 2DO7A 4UWJA 2RV8A 4XN0A 1AKHA 3V42A 2EFOA 2R98A 3S3NA 4QC6A 4K3NA 2V1CC 4OAYA 1UJ8A 4XIDA 4HOBA 4Y52J 3KIOA 4BQOA 4R6TA 1ZQ3P 3DPUA 3BC8A 3OYIA 4R3LA 4C2UA 1NTCA 1I39A 4Q36A 4R87A 3BJAA 4RM3A 4KNYA 1S20A 3EC4A 3U1KA 3I4MJ 3OY9A 2OZHA 1Q2DA 2M0MA 3B73A 4XKVA 5DCMA 2R7ZJ 4FCYA 2F5IA 4UB8C 3GZ5A 4F0YA 3BTCA 1KONA 1KQ9A 2CQXA 3VB2A 5J1YA 1VQ7I 3FKIJ 1T95A 1N75A 5EX0A 3VYSB 4ZJZA 5E20A 3N05A 4XNFA 5A2QZ 2B0LA 3HEFA 1B59A 1V0CA 2CY2A 2ME6A 2CQQA 1SEUA 4HPQA 2NOGA 2OQGA 1YLOA 1Y1VJ 5F04A 1OR7C 1W0TA 1TIHA 1TXRA 1F36A 1HW1A 1IICA 3QPSA 2YNCA 2ZW5A 2ODFA 2Z99A 4PZJA 2O8KA 4RS2A 3QYBA 4E7HA 5E1XA 3CT9A 1SD6A 1UHWA 1QSRA 4QSHA 3CP8A 4AM3A 2I00A 2K4BA 2FQ3A 3PFEA 3VFZA 3HRTA 1XDUA 1SGNI 3I4PA 3LQRA 1JJ6C 2E34A 2B3UA 1VIXA 2RGVA 3LSPA 1Y9WA 1QZEA 4ZTJA 2NU4I 2QJ8A 3E0KA 1CGJI 5F09A 2JW6A 4OIDA 1BOAA 1VZ0A 1J5YA 4C7HA 3FDYA 4NC7A 3NE7A 4XNHB 2BW3B 2PCUA 2F8HA 2CWFA 2MG4A 5EEAA 1WJFA 5K7ZA 1XIXA 2QQAA 5DTDA 1GV5A 2JRMA 4RGSA 5EDNA 3J7YJ 2ZW7A 3T8WA 2NRAC 1GVDA 2IT0A 1XBTA 3UGDA 2C6PA 3GTJJ 3UEJA 2J8RA 3OWCA 5KTCA 2CS3A 3FYNA 1D3YA 1Y8QB 2XRCA 3WGHA 5JI6A 2X6YA 3GEZA 1X1BA 2PMZA 3TDZC 2R7TA 2FS5A 4BH9A 4C30A 1Y8FA 1UMQA 2FX0A 3G3ZA 4ETSA 1BR1A 1YS6A 2ISYA 2V26A 2AFXA 1EH7A 2PN6A 3MKWB 2NAZA 4W9YA 1YYVA 5LBQA 2L4AA 4QBJA 5IB9A 2KPMA 2GVIA 4MTDA 2ZW4A 4C9YA 1HW2A 3EXNA 1WKXA 4HA8A 4JOMA 3LFKA 1BR4A 3EUHA 3CMYA 4L9VA 4R9MA 3LSGA 4E7SA 5IY5H 3QP6A 1H89C 4E7JA 1PPFI 3HOUJ 4EWTA 2Z3OA 4HAMA 2DA2A 4JX4A 1LFPA 4EVIA 5B1AH 1XPXA 4CYDA 1ZGAA 3IWGA 1BC7C 5J1RA 2PMHA 2QLZA 2CV0A 2ZO4A 4A31A 4L5IA 1YW9A 3R5CA 3KGQA 2VKHA 4EJTA 3ABKH 2R8VA 1OQYA 2LY9A 5EG0A 1CT2I 1OYWA 3PQJA 4MCPA 3M9AA 1ETWA 4AG9A 3GTPJ 2GM4A 4MFZA 5GP9A 4D5FA 1FJLA 1U5TB 2E1MB 3VOEA 3W6XA 1WTJA 1I1SA 2KISA 3HKZA 1UUCA 3C1DA 3WE2A 4KOXA 2XRLA 3E5QA 1D0ZA 4IK2A 2PJRB 3I59A 4KOSA 5F27A 1OYYA 4MHPA 3JRFA 4BHBA 3IP4B 4OWRB 4P5OA 1ON2A 3EO4A 2Z0ZA 2XAGA 1VFCA 2DJNA 1IYKA 4U87A 2KJBA 3HPGA 4A2ZA 1F5TA 1HJAI 1F2OA 4G8XA 2L3DA 3L2UA 4NQWA 1O3RA 2JPCA 3H0GJ 2D4PA 2E7WA 5EGOB 3ZZIA 5LRKA 2W84A 2BEOA 3DP7A 2GAUA 3J7AO 2HV2A 2CFXA 4QIWN 3FRMA 3LSTA 1ZLHA 3FK7A 2V53A 5C44J 3WGIA 2F48A 2H1LA 2HEOA 2QYOA 3FSXA 3V7SA 1AUGA 2ANPA 3RBUA 3I4NJ 5HS7A 3KQZA 3FXLA 2NS7A 3FX3A 2ZFWA 1PUFB 3D2MA 2WCYA 4XKBA 2L0KA 5C4JJ 4YWYA 1BL0A 5LYLA 2VASA 1GDTA 2DT5A 2OBPA 3DQVC 3CP2A 2DF5A 3WU0A 2VUMJ 1V55H 3FVLA 4G9YA 3WTZA 2Q7BA 3TOBA 1LFBA 3L09A 3SI1A 4Y49C 2K27A 4PQAA 4F92B 4KIGA 4LQGA 1OCCH 1J2XA 4G7ZF 2NXNB 1EA3A 3BCAA 3KP2A 3SFIA 2O28A 5A28A 3K9TA 2CMPA 4CCNA 3HRUA 1DGWY 1NXUA 1W7PD 4NUBA 2IVMA 4IVNA 5DUKA 3EUAA 1YW8A 4GFBA 4C2YA 1N77A 3A1YA 4L9MA 4PJLA 1N13A 2GBYA 3TW6A 4PSWA 4DYRA 4BINA 3WU2C 1D5YA 3DPTA 4NQWB 3PUFA 1Z8WA 1XX5A 2L9RA 3TL4X 4EGYA 1TGSI 3G8WA 3QODA 3RIRA 3R4KA 3SHFA 3OYJA 4P45A 2HVSA 2EBJA 2KIFA 3L2VA 1G3TA 2DDAA 2IJLA 2PR1A 1ULYA 3TFYA 3SEZA 1CM0A 3PO3J 3TKYA 2BO9A 1FNNA 5AG4A 4ABZA 1T0FA 2NVXJ 1CP7A 5IYBJ 4FWUA 4L9TA 4QUSA 3GTQJ 1PDNC 3FMSA 1Z7LA 1Z2LA 5J4VA 2XGCA 1IC8A 2L8EA 2EK9A 2DMNA 1HQCA 2BY0A 2ESNA 4A5NA 1A04A 3DLJA 2DPDA 4CGPA 3RQIA 1JWQA 2OJED 4M9XA 3S14J 4ENNA 5KK1A 1Y39A 2R5YA 4HDVA 4IHYA 4B43A 2X51A 3BJOA 1ULKA 3NH4A 1IN8A 1TBXA 2L02A 2ZFUA 2VQLA 4YELA 2EFPA 5LRSA 3HSFA 1FYLA 1K78A 2FOWA 4KOVA 1JI8A 2PVVA 3R9GA 5K7FA 4I01A 1HC8A 1LNWA 2LY1A 4HW0A 3G3SA 3I64A 2JA8J 3T8TA 3WTWC 4HZFA 2ORWA 3DEUA 5CCLA 5HXDA 3HGGA 1BW5A 2Y75A 3BQZA 5CKTA 4EM1A 1OBRA 1X4PA 2JVHA 4I02A 5HS9A 3N5FA 3K70D 4IQJA 2RIJA 5E3PA 1F9NA 3NA6A 4C2MJ 3WR7A 4M72A 1W36C 1X10A 1HDPA 1ZR2A 3HOWJ 1S8NA 4MHDA 1IXSB 2H6CA 3GWZA 3LFUA 2FNAA 5LRRA 3FSYA 5C3EJ 3F8KA 1RKWA 1VNDA 2A3SA 2N8GA 3FIWA 3PNVA 2EZKA 3OXLA 3HOSA 3OYDA 3E97A 3J81Z 1ELMP 4UY8I 2YNCC 3I3LA 3UY5A 4Q47A 2W82A 6PAXA 1N71A 3JTKA 1RETA 3CMAI 4JP0A 3HIFA 4BEHB 3KR4A 2P0WA 5KAFC 2UVOA 2K5TA 5BQTA 1T38A 2EK8A 1IG7A 5FKLA 5E3QA 2ZCWA 1IUYA 3TX8A 3QU6A 2ZXHA 2GOXB 3GKRA 5JVGF 2ENNA 2ZEOA 3CF2A 4TV7A 2CYYA 1VQ8I 2CFOA 2CQKA 4CDGA 4H89A 2PE3A 1QNTA 3TQNA 1VF9A 1MSEC 3TGNA 2Q04A 4XPDC 2G3TA 1U2WA 1U5TA 4FAIA 3DTKA 1JGGA 1AKHB 2IS2A 3PDNA 3QTLD 4I98B 1X74A 4BY1J 3IU2A 3VARA 3RPQA 3IRRA 4YIRX 3QB8A 1R00A 3F6VA 1QBJA 4DYQA 4ORFA 1IN5A 2P8TA 4LJZF 5FVJA 3K4CA 3TMOA 3IWWA 5A27A 2ATRA 1JUSA 2W48A 5LHGA 2KMPA 1OKRA 1HF0A 4XPLA 4CCKA 4U0YA 3C3WA 5HVFA 5F08A 2XAHA 4UUSA 2J5PA 1HA8A 2EV5A 1A6QA 2E36A 2XB5A 4IO9F 2ZKZA 3EETA 3D7HA 4DZJA 1ZYRF 4MO7A 1V1HA 4YGOA 3K1PA 2WC2A 4M6XA 4FASD 4A39A 1QO0D 2PJ1A 3F21A 4XPDB 2BXZA 4BYYA 1ARMA 3R96A 3HTUA 2F5EA 1RFHA 4KSFA 2O7OA 1Z67A 1DDNA 1LE8A 4I09A 2ZXIA 1TC3C 2X52A 5B66C 2QIRA 3FXRA 1G2HA 3ZOBA 4FTHA 2B0UC 1XRYA 4XR6A 4E7ZA 2WAQN 4U0WA 5EZHA 1HKQA 3R6SA 4I2OA 1S3JA 2G7HA 5JQ4A 2WY8Q 5DD4A 2DBBA 2LRDA 3TJQA 2KL4A 3DTIA 3TTHA 2QWWA 4N9HA 1XA6A 3HH2C 1L0CA 1YHQI 1POGA 3RZOJ 3WTYC 4WX9A 4Y7NJ 2P7VB 5C4XJ 4H6UA 2LTPA 2V9VA 2YU3A 3FHNA 1S7AA 3SZTA 2OTJI 2HQYA 4FKDA 5BPIA 4MLOA 2EWBA 4EEFG 4B5PB 2M87A 1GHEA 3LMMA 2VIXA 2REFA 2ZJQF 4JLYA 1QGPA 3H92A 1M44A 2PC1A 1WJAA 3L00A 1W7PA 2E1OA 3M8EA 3GYAA 2E73A 3G6EI 2R7SA 3K7AJ 3OR2C 3LSMA 1YREA 2CUFA 3JRDA 1FWZA 2ISZA 1S7KA 3CCVI 3LA2A 3CPAA 3WTXC 1IRZA 3FKJA 2J5OA 3VEPA 5F64A 3H36A 5AIPA 2VJ5A 4AB7A 2Q2EA 1LE8B 2AXTC 2IEKA 2XAJA 3E5XA 3N4MA 2V1NA 3SYTA 2VODA 1JE8A 4NB5A 4MCSA 1JUMA 3CXLA 3EYYA 4W1UA 2ZENA 4B13A 5JLWA 5C82A 2FD5A 3CUQC 3FMCA 2YPRA 4PXCA 4NGRA 4UEZA 2F4MB 2KQRA 1D8KA 4M6YA 2LH9A 3F8CA 2VC1A 2JA1A 5DWNA 2PJ3A 2WA0A 3HRMA 4R1HA 4ESJA 3HUVA 3M3YJ 2XSDC 4A93J 1IXRC 2VPLA 1JT0A 1E0EA 1R22A 2CSOA 2AFMA 2CIJA 3FISA 3FNCA 1IF1A 5DAEA 2A07F 4P1WA 3OYNA 3ZMDA 1B6AA 1S7LA 1DS2I 3DEWA 1Y0UA 2F5CA 4BQAA 3KLNA 3RJPA 2O9LA 4B09A 2M5XA 3I5UA 4CUGA 1NH3A 2QBYB 3D8PA 3RKYA 3CUQB 3BDDA 4B6DA 1QMUA 2VL1A 2F7VA 4KOTA 1YW7A 5E18F 3V7ZA 2DFEA 3DPLC 2EV6A 5BNGA 1NUBA 5BOXA 4OADA 2Q2EB 3H9GA 2JSCA 1S60A 4UUTA 2HVQA 1FOYA 1TT0A 3OR1C 4RAGA 2ZELA 2A6TA 2LLKA 4B3AA 3WGGA 3SJEA 3MQ0A 3OV8A 3VDXA 3FXMA 1X58A 4UXNA 2HQNA 1OJLA 1P4AA 3MD2A 3OL4A 3VPRA 1H9TA 3KQXA 4A5MA 2DTZA 4HF1A 3KP4A 2CO5A 1K7VA 1ETVA 2OPTA 5H6QA 2ENZA 3QOEA 3PNYA 2E1NA 1R57A 1KQ0A 3SJMA 1BI2A 2P6GA 4B14A 2F6CA 2R7QA 4RMNA 2M4KA 4XOTA 1WZ2A 4AVAA 4B5OA 1IOIA 4MHYA 3QU3A 1X12A 1IY7A 4CYCA 2QQ0A 2Z16A 3EUKL 3S1MJ 3QWPA 4PV6A 5C88A 3MZHA 3IH4A 1T39A 2DKVA 2Q0YA 2HQAA 2HKOA 2PJBA 3VWEA 1VQPI 4YU9A 2JUCA 4RLFA 1SVLA 1A2ZA 4NSQA 2DI3A 5K8NA 4C2ZA 1S7OA 5J6XA 1VTNC 2O8XA 2KZVA 1KQ8A 1VQKI 3MGDA 1G3SA 3AKZA 2RNJA 1RRJA 1PTRA 3S16J 4M3EA 2H27A 4Z2YA 1LFWA 2WPWA 2DYSH 2XUBA 4CYQA 4JX6A 2XC7A 1OCOH 1UG0A 2L9SA 4JYWA 1X4OA 4HLYA 4GXHA 1H9GA 5LYDA 5D8LB 1LOKA 2AE6A 3OS2A 1BI1A 2OCCH 3IAS2 2IGMA 4UUSB 1WGXA 4MEXF 2JXDA 2ARPF 4G94A 3S8PA 4A38A 1OCPA 2O6GE 4B3XA 4BBSJ 2V8HA 1FEXA 3S6FA 3LWFA 4AVCA 3I58A 2IBDA 3KZIC 3R0JA 4FISA 1IDZA 5AG5A 1NSLA 4D5CA 5IP6A 3P7NA 3DNSA 1HSJA 4HX7A 4M6HA 2HGCA 3WE3A 2G7UA 2RC4A 2JTVA 3O6BB 3CZXA 4XN3A 4ZX8A 2LK2A 2OV7A 3OOPA 3FXOA 4YIIA 1SD4A 3H5NA 2ZXJA 4BDZA 4EVYA 3GLJA 3L2NA 2JA6J 1HW5A 3W3CA 1P4NA 3K2ZA 5HLHA 1D5VA 1P0HA 4IQ4A 2WPXA 2MA3A 3L9FA 1TWCJ 1ZGJA 2X1DA 1ETQA 3M7GA 4M85A 4BXFA 4RI1A 2EWNA 2OOTA 5IP7J 1CPXA 4HGUA 2PJPA 1EJ9A 3G1OA 1IGNA 4RGXA 2DK8A 2XEGA 2C6CA 4OC1A 2FVGA 5H20A 2LF7A 4IF5A 1KU3A 1V54H 3CDXA 2DCEA 1I5ZA 3ABUA 3JW4A 4EATA 2HOSA 2VOPA 5CBMA 1X1AA 2NS8A 1HKSA 1ZN2A 1JT6A 1YLEA 1R43A 4M3GA 3DBHB 3GTOJ 1LAPA 2NS0A 5GAGJ 4GI3C 3GLLA 2QBYA 3QPHA 1P92A 2R1IA 1QZZA 2HQ5A 3M4OJ 2HYJA 3DKWA 1UHMA 3IUOA 1IV8A 3R0AA 2HXIA 3BZCA 1IZ1A 1STZA 4FUUA 2A5YB 4HV5A 2TRTA 4I7HA 5FKNA 3RDIA 5LGNA 2HVRA 3BJ8A 1I1GA 5FKOA 3PFYA 1ACIA 2Z3PA 5DEQA 4J00A 5E3NA 2EZIA 5EG0B 5CVVA 3KHZA 2EFNA 2WBMA 2EO8A 3S2WA 1R4NB 3DLAA 7WGAA 1SD7A 3Q0VA 3ZMVA 2WUUA 1HSTA 1TNTA 3B7IA 1MNEA 2N17A 3W2VA 1T6SA 2EH3A 2W4SA 4AIHA 2PJ7A 5LHIA 5CPAA 2YUUA 4XLAA 1FTZA 4GCVA 2KMQA 1SAUA 1FP2A 1CT4I 3SJGA 3QNVA 2EIMH 2KLOA 3GZNB 2Q51A 1ERDA 1Z8TA 2XPWA 4JCVE 3KP7A 1LR8A 3C7JA 2BZTA 2DA3A 1XF8A 4X5KA 1PP7U 1SGEI 1QQ9A 4RS8A 4AUXA 4CYCB 1U5TC 1W5CC 2E1MC 1D1AA 4Y17A 2ICWG 2CUZA 3R60A 1B9MA 5JR3A 1ETOA 2A20A 4ANJA 4E70A 1BW6A 4MI4A 1TT5B 3U1DA 2YGWA 1XGSA 1ZRDA 3QOPA 2Z3NA 3KETA 4HSTA 4JXQA 2OVOA 2NU2I 4MFJA 4KMFA 5DWMA 5FD6A 3ROUA 1Z3YA 5FLXZ 2IPQX 4UB6C 3T0YA 3VSKA 5KCMA 2SGEI 2DLLA 4A24A 4P9UA 4JWPA 3JRUA 2J87A 4R8FA 2XF6A 2ELKA 4Q48A 2LF8A 3I54A 5F48A 2AFSA 3UGLA 1WWXA 3K4KA 3D00A 2KKOA 3RU0A 2B5GA 1W36D 4OMZA 5F6FA 2OU2A 2VL8A 3BR6A 3LA7A 4OLLA 4MJ8A 4I0AA 4ZBGA 2MFZA 4II2A 1MJBA 2EINH 2RVCA 2OH1A 4EJOA 2PBIA 2FRHA 3CCRI 4EQQA 1B8IB 1P9ZA 5TISC 3DCFA 1MSFC 2K9SA 2ZEGA 3A4CA 3TCVA 3KZWA 2E7XA 3W6SA 1ETKA 3FECA 3VH9A 3H5AA 4PJJA 4I49A 1NK3P 2H8RA 2OZGA 4BE1A 3P9KA 2QQBA 1VQ6I 5IP9J 2DXQA 2KMUA 4IL6C 3PFIA 2HI3A 2FMLA 3MKLA 1JKPC 2M4GA 4MXUA 2KT0A 5DCFA 2L7MP 2D1HA 1O7LA 1XGMA 4S05A 1XJOA 2VXZA 4P9FA 3PQKA 5D4SA 5JPHA 4Q7AA 4O5VA 2Z3YA 3ABMH 4FQGA 3DTEA 4A0ZA 2QSHX 4P55A 2AFUA 3E2IA 2A6HF 2P4WA 4LIUA 4XK4A 3NE8A 2M9HA 4IZZA 4KISA 5F49A 1FX7A 1ETYA 2FE3A 2VKVA 5LRJA 1A5JA 4R76A 2MSYA 3D7FA 4H4KC 1XS9A 2PVWA 5ISVA 2DQLA 1JGSA 3ZPLA 4NGNA 2P5LC 3GOXA 4F6AA 1EV7A 4A2UA 2J8MA 3H0DA 4CZCA 5HDKA 2VZZA 2F5FA 4PCQA 3R1KA 4L8AA 1FOKA 2IRFG 5L3FA 2H1KA 1ON1A 4KSIA 4MQ9F 2AO9A 4X3RA 1GT0C 5L3DA 2NU1I 3JR9A 1IXCA 2NVYJ 2Y48A 5HDNA 1OCRH 2N71A 2MC3A 1XN7A 4CSWA 2Z9OA 1BPNA 5J8FA 1M4DA 3B35A 4NCZA 1W7PB 4LG0A 2IA0A 4YFNF 2L01A 1B8IA 2MLKA 3EYIA 3HTSB 5ILUA 1MBGA 1USSA 4KN7X 3HDDA 1AOYA 2PJ8A 3WC5A 1XSXA 2CW7A 3VODA 2CW8A 3PGPA 4BUPA 4HDUA 5FJ8J 1VQNI 3FB3A 4EJWA 2L9NA 4UEFA 2DJIA 4BACA 4RAFA 1L3LA 2GLOA 4OMYA 2JYYA 3PB6X 4JD6A 3ZCOA 5HH1A 3IC7A 4NXYA 1R5GA 2N1AB 1VDDA 2MYSA 2N52A 2CQ7A 2DA7A 2HDWA 2MLGA 2VPRA 3MVPA 2GLFA 1YU6C 4FBEA 4EJUA 1IN4A 1E2XA 1OLTA 4KDPA 2DXIA 1YW6A 3ZP5A 5L3EA 3BQYA 5FLVA 1SFKA 5HLGA 1MJ9A 3IH2A 3ASOH 2OD1A 1RI7A 3PL8A 3HB9A 2CG4A 2CGPA 2STWA 4G7OF 1IRGA 1CHOI 1T8IA 1UCRA 4FX4A 4ZI6A 2QF7A 4OIQF 3AL0B 2I8DA 2WAEA 4XMYA 1GUUA 5HODA 2M3AA 5LD2C 4JZ0A 5D5VB 3COAC 5EX3A 1YLFA 1FYMA 2KMOA 3L2CA 4OIOF 3ERED 1I27A 1I6XA 3H5ZA 3DLLF 1IO2A 1GLNA 2E19A 1U0JA 5GAEJ 1P7IA 2V6EA 2OCEA 3OL0A 2DPTA 1X3WB 1IN7A 4RB0A 4AU7A 4LG0B 5HNHA 2KCXA 4PPZA 4TNUA 2GZWA 1WJEA 3TO7A 4RB1A 2GIVA 4JBAA 4YG2F 5FRMA 2ZNYA 3VDUA 1TF8A 4PXBA 3WC7A 1O3TA 4CAFA 1ZAOA 3TT2A 4XOPA 2FA5A 3ULQB 4NC6A 2IP2A 4LB6B 2JA2A 4BJ5C 3CC4I 3IU1A 2XASA 5J40A 2GKRI 3AG3H 2HYFA 2L54A 4PSXA 1LVAA 4F55A 2YUSA 3V8LA 1X2MA 2B4DB 1MMGA 4AIJA 4A6DA 1QSNA 3K70C 5J1QA 1X3UA 1FOWA 1R5HA 3KPHA 1M8CA 1BM9A 2KIUA 1KA8A 1RIOH 1YQAA 4L89A 1Z91A 3WT4A 1MT1A 2PJRA 3SXOA 2GQQA 5E79C 1YVKA 5M5XJ 4E1RA 3OYBA 4B44A 1M8BA 2M30A 2WY7Q 2PIYA 3WABA 4ZYQA 2WZNA 2YX4A 3T90A 3NEUA 1DS3I 3IEHA 5LEKA 5KTDA 1WQ2A 4A3CJ 2KMRA 1Z6TA 2HB6A 2ZEHA 1PP8F 1VQ5I 1WH7A 4BDYA 2NNNA 1VHSA 1K7TA 2R7DA 3HBLA 2MD0A 5L3CA 1Q7LA 4NGSA 1Y6IA 2EPFA 3K69A 2WAQA 1YR0A 2DMQA 3H3UA 2ECCA 4OAZA 4MPIA 5K7HA 3AFHA 2M5WA 1NG7A 3V8IA 5K5OA 2Y9ZA 1MDMA 2JJ7A 3OSGA 1R36A 2VBZA 5FFZA 4XSXF 5L3BA 3CO7C 3SI0A 4N4OB 3BTIA 1Z6RA 1WH5A 5CQEA 1Y8RB 2RNGA 1SMYF 4GYIA 2UZKA 5IT9Z 1IN6A 2QUFA 3ZN1A 1LKXA 3Q0WA 2WV0A 2XGEA 2VEZA 7CPAA 2BBYA 3BCBA 5CVRA 1UHAA 1Z4EA 1BPMA 4LK0F 3ZQGA 3PBBA 2Z10A 2XVCA 2OA4A 3UOEA 3OWTA 4P4FA 4AIDA 3BJ6A 4M3DA 1CE3A 1K6OA 1TW2A 3EQLF 4MIMA 3DXJF 3KFWX 1QSMA 2ZSIB 3HHGA 2COBA 1YSJA 4XL9A 3IAM2 4SGBI 3GVAA 3JRBA 4A3JJ 3DF8A 2C27A 3ZR8X 4BAYA 2FSWA 4KIBA 2V9PA 2HC9A 3DBRB 1PTQA 3RQ4A 5CVUA 2L7ZA 5FKKA 1T0FC 2IA2A 1ELLP 1DP7P 1MKMA 3P2HA 3HJEA 2VXDA 1XMXA 3FF3A 4I6ZA 3S3MA 2ZMEC 2XIGA 3E6CC 2OC6A 4H0EA 3J81K 2PSWA 1YW4A 4IOAF 1WCMJ 2H94A 5HVHA 1HDDC 2POKA 2VKDA 3PSIA 3IKTA 2LFBA 3S3OA 5H86A 3R9FA 2W85A 3KYCB 3PB7X 3J80Z 1S7EA 2PJ6A 4KMUX 4LB5A 1I1DA 4DYOA 4UV9A 2Z33A 4JXRA 2H6BA 2XKPA 1KBFA 4M3FA 1NSAA 3H4QA 1U3EM 2X9DA 1WSUA 2V8DA 1LUJB 4OP4A 4QVTA 5CYVA 1UHSA 4V2GA 4P4IA 1GHCA 2I3CA 1SGRI 1WK4A 3W91A 1A31A 2F2EA 1ZHFA 4O3MA 3OYMA 1ZRFA 2QQDA 1EE3P 1XE4A 2QQ8A 3MAJA 3O8GA 1Q2CA 2K9MA 2LC2A 4ZYHA 3WU1B 2RQPA 2XHKA 2YSRA 2WB1A 1VI0A 3BHXA 2GXBA 3F22A 3PB8X 2CW0F 2GXAA 3ONQA 2R7XA 3FMQA 1VQOI 4B11A 2R7OA 4C3HJ 2PIZA 1LRZA 1BJAA 4KFCA 5F1RA 1R49A 3FZVA 3S17J 4ESFA 2Y30A 2JZMA 3H8EA 5D8NA 2VXKA 2QZ8A 2XAFA 3ZN0A 2WSAA 4XM3A 2DA6A 4LX9A 2J9RA 3BR5A 4MFLA 3GFJA 2B4DA 1UAAA 4KUMA 2AFOA 4EMEA 1B87A 1RR7A 2MD5A 3D7GA 4BBRJ 3GX4X 1K79A 3D67A 3SHPA 4A0YA 3OS1A 3OXFA 4XLCA 1BOBA 1ZK8A 1G3WA 1XCVA 2P6SA 2VT2A 1O3SA 2M0CA 2IMOA 3D3SA 3K4JA 4YFXF 3KEOA 1R58A 2HOAA 4LFUA 4XONA 4DBRA 1ZG5A 5DS9A 4A12A 2QA4I 5F47A 1QHHD 3QQAA 1Z2IA 4DW6A 2QKMB 4A3KJ 1JXSA 3SDGA 2B4BA 1BI3A 1BIAA 1IRXA 2K3PA 4UVAA 3CJRB 3QPLA 3CXSA 2X6WA 5FB2A 3CDLA 4IKFA 1LEAA 4A69C 3UEYA 1HPTA 3LA3A 3HOYJ 2GKVA 1T08B 2CUEA 2ELJA 2JVGA 1ZTRA 4A33A 3BPVA 3IKVA 3CESA 4RB2C 4A3GJ 1KUVA 3SJXA 3ABTA 4Z6YA 3L2QA 1WWZA 2LSOA 4XLHA 2RAEA 4BU2A 3CCUI 2HS5A 1OMTA 1OCZH 1YG2A 4IHSA 6CPAA 3BP8A 1CP6A 4JYKA 5DM7F 1F2PA 1AU7A 3DSBA 3G4SI 3IL2A 2VRWB 3CUOA 2L7XA 2QYVA 2WAFA 3A0BC 5M3FJ 1QSOA 5LGTA 4A3FJ 2KIQA 4JQFA 1YS7A 2BSWA 1WJCA 3A0HC 5F0CA 4CXFA 3IRQA 3GFMA 3L2WA 4LOCA 4DNCA 5GCNA 2GE3A 2NU0I 1DTDA 1XG1A 3AL0C 3BXMA 5HOOA 1Y7RA 3D4UA 4A37A 1YVOA 3R61A 1CG2A 4BL0B 3QYEA 3WC6A 1CT0I 2BVMA 3GIUA 4P10A 4BJ6C 4MCRA 1O57A 4HQEA 1PUAA 4XICA 1LDDA 2BY1A 5EZGA 3HOXJ 2BUSA 5CCMA 3ABLH 1SFUA 1IW4A 1KWMA 2L7KA 2EFQA 2VLAA 2K9NA 2M1BA 1USTA 3VATA 2VJJA 3OL3A 4PFOA 1DE4C 2YX7A 4B12A 1KU2A 1OMUA 4R57A 2CJJA 2PMUA 1RC9A 2CQNA 2FE7A 2X7BA 1WI3A 2Z11A 1BI0A 4ZDOA 3FIXA 5G22A 4IHWA 3C26A 4UCNA 4HKFA 4C68A 1ZO0A 5KTAA 2IL4A 1E3HA 3TOAA 5HVGA 1PCEA 9ANTA 2KRCA 4LQ6A 3FM5A 5FLXK 1ZG1A 2XGXA 4HPSA 3GUXA 2G0EA 3B3SA 3PZJA 1MIJA 3CD6I 2XB0X 4RLQA 3TW7A 1S7FA 3FK6A 2BUEA 2GIZA 4GYGA 3PB9X 4OOIA 1B72B 3HRSA 4CAVA 4PJMA 3REOA 1ENHA 3IWEA 2NVQJ 3BJIA 5HI7A 2MW8A 4D7MA 2KHMA 2STTA 3ESWB 2V1UA 2FL4A 1DGRM 3IWFA 3TC8A 2NNYA 3HYIA 3M07A 3D5SC 4WJBA 1K7UA 1YX5A 2DW4A 2HPIA 5JLXA 5M5YJ 2R7WA 3SXNA 5HMNA 1Z3XA 3S1RJ 1BJZA 2CU7A 5LLQA 5D29A 2YU9J 5E3RA 3RZDJ 4ITVA 2L9VA 4ZYAA 1Z8LA 1TF9A 1IAWA 2ROWA 1YRNA 1U78A 3I9SA 3LWUA 2Q44A 2DIPA 1JKQC 4MHGA 1ETXA 5GADJ 4PXDA 2B7EA 2G9WA 4AC0A 2VZYA 1G3YA 1O3QA 3I59B 1VHOA 4BE2A 2K85A 4ONUA 1BR2A 4KITB 5AONA 1JTXA 5JFRA 3KYDB 2CTCA 4CO8A 2ZOFA 2E35A 5DM6F 4GS4A 5G1ZA 5JGFA 3E6BA 2GA2A 2IW5A 1ON0A 4M9SA 4E7IA 2P81A 3KP5A 2XROA 4B10A 2OTLI 1Y9KA 5ICGA 2EFWA 3PRTA 5DUIA 3G71I 2A05A 1CSOI 1RKTA 4Q38A 3M1EA 5KAIC 1SFOJ 2PEXA 2GA1A 2FMYA 1ZRCA 2NU3I 1YITI 3CJNA 4AMLA 2DOFA 1I21A 3LMSA 2PLYA 3RTRA 3CJQB 4ZX9A 1X1DA 4FE7A 1G6NA 4X0GA 3O2PE 3IC1A 3CJTB 2CRGA 1P7JA 1D1CA 4N9IA 5FROA 5KVRA 3SGQI 3SZGA 3ELKA 3CF5F 1R79A 2PR8A 2X6OA 1K7AA 3QPTA 3MN8A 3BLYA 1TQIA 2A69F 1MH4A 1FBSA 2WADA 4IRHA 3T8RA 2PG4A 2PX9A 4O6JA 1NK2P 3CDHA 3LODA 4ASNA 1XFOA 4RAYA 5IT3A 4L9NA 2DFHA 2HFHA 1H88C 1V1IA 3F6OA 3PO2J 4IUSA 2JN6A 2Q4ZA 3SDBA 1K4JA 2QCOA 2RB7A 3Q3SA 2VQYA 4WXHA 4DOZA 3CQZJ 4BY7J 1Y0RA 2ABZA 4GXOA 2WGCA 4KVOE 1J4JA 4ZY0A 2W25A 3H9QA 2IS6A 1XEBA 2IXSA 2Q4VA 4BGDA 4KA4A 4XSZF 2BE5F 2JEWA 3J7ZI 1H8LA 1G8XA 1FZPB 4BQQA 1MMNA 3CCEI 2Y2ZA 4WWVA 3SZPA 5HQ8A 1AYEA 4KSAA 3RPUA 4D7NA 2A6EF 2XPUA 4Q5SF 1Z0XA 4MMOA 4WK8F 3SJFA 4HNUA 1FSEA 3IWZA 1PCAA 5IYCJ 1W3SA 2ODDA 1XCBA 2PDOA 4AXVA 3TP0A 4E8OA 1YOVB 3CXQA 4IX7A 5D6FA 1MMSA 1LR9A 1X1PA 3CCSI 1HDLA 1LQ1A 3MRUA 2FCKA 4L0ZB 2AFWA 4PJNA 1B9NA 2HKXA 2ARHA 4I0BA 1XD7A 2DU9A 3UR3C 1LPQA 2AFZA 4P4JA 2VJIA 3K10A 2JT1A 2GWRA 2R93J 2JMWA 3FM3A 4ENJA 2XF5A 3L7WA 4NNJA 3KHXA 2CTBA 3WTUC 3UFFA 1CPSA 2R92J 4U0VA 2JUGA 2WTEA 4F52A 3GFIA 1HBXG 4J3GA 5K5QA 1J59A 2R7VA 2LVSA 3CLOA 3VYTB 5GPCA 3OSFA 1FPQA 4PK4A 3D2PA 2VI7A 1FBUA 1SFEA 3CDIA 2MABA 5CPRB 4EMSA 1MMAA 4S04A 3PJRA 4EFDA 4FETA 1APLC 1LDJA 1TIQA 3C2HA 1G4DA 2E5ZA 3JTGA 1LB2A 3U9GA 2BV6A 1OPCA 2VKEA 2Q43A 4AG7A 2F4IA 2Z2SB 2E60A 3I56I 1XSVA 2ELHA 1Z77A 3I9V2 3TO6A 4CHUA 2BXYA 1TKJA 3PB4X 1LJ9A 1TBNA 2FEZA 2WVJA 1V5FA 3MN2A 4AIKA 1R0RI 2BY3A 2PQ8A 1TWFJ 2ZNZA 4ZDLA 1BBYA 2VQHA 2WB1N 5HNFA 4GRIA 3T5XA 5E3MA 1S9HA 3T1BA 4XQFA 3HG9A 1WPKA 2VB6A 2ZEMA 4UCMA 5IB0A 4A94A 1R23A 2E5RA 3Q9SA 2JA5J 1KZFA 4IPAA 1TBOA 1YGHA 2ZOGA 1ZG7A 1LEBA 1FYBA 3K1NA 4CYPA 2C6YA 5AGEA 5EEGA 3ZMSA 3RO0A 2BGCA 4AWXB 3PIPF 3MKYB 1YX3A 2I10A 2EVNA 4BBHA 2XV4S 1V5GA 2HU9A 2ZMEA 3JAMK 1TL8A 1UWYA 4G1PA 1Y7EA 5CVJA 4BHCA 1SVOA 4XLPF 2P6FA 1P6RA 4UWIA 2NVTJ 3I55I 1VQLI 1ARLA 1FTTA 1SAXA 3CTAA 4HBLA 1EH6A 1YK3A 2DT6A 2Y69H 3WG9A 4X8IA 4AVBA 1J0RA 1R7JA 4CGMA 4UNOA 1W1WE 2ZMEB 3R5BA 3GXOA 5FLMJ 3K2KA 4O23A 2QENA 5E8IA 4HYEA 3VDPA 3ECHA 2J9AA 4U5YA 3KASA 2LP0A 3Q5FA 4CRZB 4NC8A 1H8AC 2SGDI 3BJ7A 5FGMA 3S1QJ 1TW3A 1HDUA 2AQFA 1MH3A 1REPC 1I3QJ 5K5RA 3F8FA 1XC5A 3M8FA 4KLWA 3KX2A 4F91B 2OR4A 1X4SA 3SQNA 3BZKA 2VE8A 3MEXA 1M4LA 1LVKA 1FSHA 4CCJA 1JJ8C 1ULNA 1WVRA 3GBGA 2R4GA 3BT9A 3EDPA 4H2KA 4M6GA 2IJZA 5GTHC 4KOUA 2X1EA 1ULMA 3C2GA 3TBIA 2C1CA 4XORA 3FXJA 4NF1A 4HSRA 2E5NA 3F8MA 2LKSA 2PJ9A 4II3A 5AIQA 4XRSA 2DA1A 1YO5C 4DQ2A 1VQMI 3LSKA 4UXJA 2R7HA 3GO5A 2UUZA 3VE5A 1HKTA 2M7AA 1D1BA 1GVJA 1R4MB 1T33A 1MNDA 2O3FA 3PNTA 3A01B 3R5AA 3MFKA 4UIAA 3PEIA 3BG3A 5LRGA 3WTSC 2F5DA 2ZC2A 1BO4A 4DZPA 1YJNI 4BKXA 4ZDPA 2ID3A 3ZXSA 4DJLA 5DYMA 3D0SA 4P6YA 2O03A 3JCUC 2HOTA 1ZREA 2EA4A 2XAUA 1YTPA 5DDGA 1RXTA 4KOWA 1Y0YA 4Y3OA 1Q2YA 5DCMB 4MFEA 1FYKA 2CNSA 5E1WA 1QU3A 2ZJPF 2CV2A 4NJQA 1RO5A 2OF7A 4IOCF 3KI9A 4KORA 5EMIA 2RDPA 5E1ZB 1IJWC 1K61A 1ZLJA 2PJ0A 2JLMA 4E6KG 2OUMA 2JSPA 5CQGA 4B4CA 3GY9A 3B02A 3AG1H 3HKZN 4NHJA 3B6AA 4DUKA 4NEXA 2CWEA 1EKEA 4B48A 3B3WA 5LHHA 1OFCX 4OC3A 1P2FA 2K4JA 1F1ZA 3HGYA 4BXXJ 1WJ5A 2BYVE 2QQEA 4FHTA 2A5WA 5IT9K 4E2AA 5K8PA 2MH9A 4KIFA 1UB9A 5F1JA 1Q1VA 1KZHA 4FD5A 5AG7A 2DTRA 3K1MA 2BL1A 1IYLA 1S29A 4DIQA 1BIBA 3DV8A 3S6GA 2HPMA 3JREA 3QP5A 4BNCA 1DQUA 2PI0A 2O4HA 5F0HA 1FP1D 5F0FA 1IUFA 1J9IA 3U2RA 1XGNA 3LQQA 2MGQA 3F0CA 4UVBA 4CICA 2Q4YA 5FRNA 1D8JA 2HQRA 3V7RA 2X3TA 2L5QA 4QPQA 2B5GB 3KP3A 3L1PA 2D1VA 4PGGA 2WV1A 3HSEA 1YE9A 4OAEA 1HLVA 2VQGA 2YS9A 2K86A 2GLJA 2K02A 1N25A 2ECBA 1AHDP 3LACA 1KU7A 1I50J 2ZJRF 1JUPA 2XEFA 1QQIA 2EZLA 3GCMA 2CNMA 3HXLA 2FNFX 1PYVA 5TJJA 1KUXA 1XSDA 1O4XA 2K9QA 2FXFA 1U5KA 4CGOA 3RZAA 1TWHJ 1TUSA 1HEEA 1ZG9A 2VBXA 1Z9UA 4QB9A 4ZY2A 3MZ8A 2COMA 3KY9A 2HDDA 2O53A 2EB7A 3V8KA 5TGTA 1KU9A 1DUXC 3CC7I 3IH3A 3P2FA 5I0CA 4UEEA 1Q1HA 1XB4A 3PM1A 2XSJC 1ZLKA 1U8RA 1Z9CA 4A6EA 1G59A 2X6XA 1GXPA 3MWMA 1PUFA 3I0TA 2GANA 3PIOF 1ZR4A 1KBEA 2XGDA 5J4YA 3LAJA 2P6TA 2YQPA 2FT0A 2ZPAA 4A3IJ 4CPAA 1DPRA 2BHYA 4OU0A 1MMDA 3EUHC 3G1LA 1DPUA 3I1UA 2LOOA 1SGQI 1O7FA 4XPKA 5H2FC 4FD4A 1HXDA 2XPVA 4XLNF 2PFBA 5BS6A 2ACJA 4OMEA 3F23A 2NYQA 2BVLA 4BE0A 4NGTA 1BAVA 3WHBA 2RREA 1Z4RA 3OMYA 3MEKA 5ILSA 2VT3A 1AA7A 4HNYB 4BS9A 1MBFA 2EIJH 4V2FA 3Q9VA 1ZELA 3GTKJ 5CVIA 4CS0B 2D4OA 2V7FA 4X1EA 5FFXA 1TNSA 3JAMZ 3V8JA 3EPZA 3P9IA 3GUDA 2XRNA 1U8BA 3CO6C 4QWQA 3FHZA 2E2HJ 3CC2I 4UUVA 2B3VA 2CF4A 1Z21A 3JTHA 1DU6A 4NGMA 2JZYA 3RKWA 2Z3LA 4UIBA 4RAZA 2OZUA 4D9JA 3BROA 4ENKA 3KE2A 1ZKGA 1X19A 1SANA 4YIFA 3IV5A 3DR8A 1CGII 3OXGA 4XRMA 2X85A 4HNTA 5IOYA 1K78B 4JX5A 2GKTI 2LB7A 3D68A 2VI6A 3HPHA 1QZYA 3SFZA 4ZTFA 2IQ6A 3OIOA 3HOZJ 3J80K 2G3AA 4C7IA 2WYRA 4MFKA 1QVUA 3K4NA 3MZYA 3SXYA 1DU0A 2XAQA 3E5UA 3FWEA 4C2TA 1VHEA 1PU9A 2DFIA 1R6RA 5D4RA 1IGBA 1SGYI 2JWTA 3ZRGA 5J1UA 5ICCA 1BLLE 2JK3A 2DPSA 1Y56A 4M9ZA 2KJCA 3DKYA 4QTRA 3G2BA 5A2QK 4KUBA 4XBFA 1Y1WJ 4L5EA 4CCMA 1VQ4I 2QSGX 2VOOA 3DU5A 1FNOA 5FUWA 1FLIA 1R5ID 1OMIA 4IHMA 3QAHA 1SMTA 4CGLA 2VBWA 4ENMA 1J75A 2DYRH 4LLGF 4E7KA 1XBUA 4M3BA 2R7FA 2XKOA 5CLSA 2GFQA 4B5PA 1XMAA 4UFXA 1IOFA 4RBOA 4LK1F 5IOZA 4QPOA 3E6MA 4HEA2 2YNEA 4UBRA 1I12A 3QWLA 2V77A 2K5CA 2HZDA 3ZQFA 2IS1A 3ZJ0A 5E3LA 1NHAA 3GW2A 5DS0A 2PRBA 4RN7A 4FE4A 3HL2A 2LUYA 2YNDA 3ZQ7A 5JHUA 1SD5A 1QPIA 2G9DA 3OOUA 2QECA 1U6GA 3ERMA 3IHUA 3D1NI 2DPUA 1SFXA 3H1CA 3GTGJ 4F9UA 1XMTA 3DR6A 3LD2A 2X4HA 1V4RA 4OC5A 3NH5A 2FQ4A 4F8ZA 2M2EA 4UV8A 3NH8A 3ISPA 2BEIA 2YR2A 3H3VK 1F57A 4UXHA 1UELB 3B2YA 2LREA 4J19A 4CZZA 3V38A 3CZ6A 4IRGA 4MCQA 2X48A 4OKOA 1T56A 1Z7UA 4XRFA 4YFKF 5ED4A 2CNTA 4OIWA 1W5TA 5FKMA 1A35A 1TQPA 2VE9A 2ZXWH 5G21A 2PJ4A 3S2DJ 3K6GA 5E17F 2OQRA 2IS4A 4HQMA 5EYRA 3V7CA 3D66A 2JEVA 3K4MA 3W2AA 1WJBA 2LY2A 3V4GA 5D5WB 4I99C 2OZ6A 5EGOA 2EV0A 3KP6A 2B9SA 4D1QA 3IFEA 2EBIA 1RUNA 1B4AA 3JRAA 2XEJA 1I3AA 4KVME 4UCPA 2RKHA 2HXOA 4WCGA 2DA4A 5IPAA 2FSRA 4HF0A 3F3XA 2ORVA 3WTVC 3OYEA 5CNPA 2PJAA 1AMPA 1MBEA 4KJZA 4HX8A 4Y13A 3ISXA 1MJAA 5AG6A 1WHUA 2Q0OA 8CPAA 1ZG3A 1MBHA 2AHQA 1KGSA 2QMLA 4EM2A 4UFWA 3DKXA 3HM5A 3A2KA 1XGOA 3FBNB 3RNZA 4F9VA 4MGRA 4CCLA 2E2IJ 1XOVA 2AS5F 1ONVA 2DMUA 2K9HA 1RR8C 2SGFI 3K4LA 2HZTA 1IDYA 5B5EC 3S1NJ 3OYHA 3IIBA 4LITA 3CCMI 2R5ZB 1E17A 1TURA 4HF2A 2QQCA 4MQVA 2BY2A 3RCOA 4CGZA 3H8GA 4FT8A 4R3KA 4NDLA 1MD0A 3RI4A 2FOKA 2Z1DA 3N7ZA 2CJSC 2QKLB 4P4BA 2PJCA 4KLVA 1GV2A 1ZARA 1R1UA 2F5VA 4RGUA 4RB3C 2NOJB 2V1XA 1R9TJ 3PSFA 2REEA 1PJRA 4HV6A 4GM5A 2V8VA 3RAMA 2MH2A 4NGQA 2DFFA 2V79A 4R7MA 5THWA 4IHXA 3P5JA 5JVTA 4M6IA 1K6YA 2B58A 3E7LA 5JM6A 4WF2A 3HOVJ 3LL7A 3IO1A 4LD5A 5D6EA 3D7DA 3KEQA 1IW7F 3S93A 3NWSA 1R71A 1WRJA 3RYRA 1PYTB 4EV0A 4LMYA 2DOEA 1UFMA 3BI1A 1OZPA 5GTIC 2DMPA 3BR3A 2NYXA 3HSRA 4ZY1A 4U9YA 1FIPA 4RDUA 1HCRA 1IIDA 4U9ZA 2CXAA 3KKWA 4MBUA 3FXKA 1KYZA 2R7RA 1QVTA 1T2KA 2JQ7A 1I6HJ 2XDVA 5J8CA 5LGUA 1UG2A 2RN7A 1VGYA 2D45A 4M74A 3CXPA 2KDOA 2E71A 4KZTA 3WHCA 3HLPA 2FF4A 3AG2H 2UXNA 4G6DA 2BCOA 4W97A 3ZQQA 1X2NA 2LBFA 3I53A 1KYWA 5HS8A 4U7DA 3QAYA 5BWAB 2BW3A 2K3FA 2R5ZA 1SC7A 3ML6A 4PGHA 4FD7A 2DDBA 3B8GA 2KZGA 4CCOA 4G7HF 1W4RA 1HOMA 1MW7A 2P5VA 3GMEA 3KZYA 1FARA 2W1OA 4LG3A 4GDFA 3BWGA 1UZCA 5FUXA 2DEAA 1CBXA 5LYFA 3BZ6A 1FOXA 2G0BA 2FXAA 2GXGA 2HTJA 2O61A 2NSMA 1F43A 1B1BA 2IGOA 3M8JA 3ISZA 3S15J 3LNQA 3GYHX 2M45A 3SEKC 2JPBA 5DV5A 2BOLA 1YRNB 2EILH 4MNUA 4WXCA 3CPXA 4WWCA 4UVCA 1FMVA 2Y0SN 1JQGA 1LAMA 3WTTC 5FD5A 1D0YA 3BG5A 4YRVA 4CAEA 4P96A 3LSRA 4B8XA 4E4HA 5LFAA 1VKCA 4NGPA 3GLXA 5J3LA 3HOTA 1BMOA 1ODDA 4ESBA 2B63J 2QSFX 3M1CA 1FY7A 3FC3A 5EJCA 1PVEA 4LIVA 1JKRC 3S2HJ 3A01A 1IU8A 2GREA 2ETHA 2ZXVA 4UF4A 3KEYA 2Z5UA 4RGRA 1XX6A 1AWCA 3S6HA 3F8BA 1MK4A 5HLTA 4ONWA 4HG2A 1Z7KB 4CA0A 4R79A 4BXUA 4F93B 2UXXA 1Z05A 5KHDA 3A9LA 4X6AJ 4M3SA 1YJWI 3BOQA 3HHHA 1XDSA 4P44A 3E1SA 1U9OA 3B3CA 2L4MA 3DDDA 3HZJA 3FH4A 5JH9A 4B6ZA 4HNXB 4AYBN 4CAXA 4M6VA 4PK3A 4B47A 1FT7A 2TCTA 3RPUD 3CCLI 3BLNA 4A3BJ 3TO9A 3RKXA 3R95A 2FU4A 3OIQA 3W6VA 2JBKA 5KNLA 1Z5RA 3FBIB 3H3ZA 1YIOA 3BG6A 3RKQA 1F4KA 1X3ZB 5HDGA 4LLNA 4K30A 3F72A 4U88A 4DYCA 1YJ9I 2P6EA 1JHFA 2QVPA 2KCWA 4PK2A 4XNHC 4A32A 3C2BA 3FEEA 4LUAA 2VONA 3PFOA 1UVGA 2ZB9A 4A3LJ 3Q0UA 1AN1I 3ZQCA 2ZJ2A 3CMEI 1WGTA 4I76A 2TDXA 1IRFA 5ICEA 4MRIA 4KVXA 3AAFA 5K8OA 4BEHA 1WKMA 3OYLA 4MHNA 3I3GA 4RA2A 4PXEA 4TWEA 4OIRF 1RPWA 1TBQR 2DB6A 5GPAA 5IX3A 5IYDJ 4PJ0C 3JRGA 2LR8A 2DODA 3KL9A 2IGKA 1JKOC 3UGIA 4B1RA 5H6RA 3FX6A 4HNWB 4MFPA 3LOCA 1YI2I 1RNLA 3R9EA 2QVOA 3ZMUA 2R0QC 2LNBA 4LLLA 1M1EB 3BTLA 4RUHA 4IEJA 1N78A 1ZH5A 2Y0MA 3AG4H 5M3MJ 4BJTA 2AQEA 2Q8KA 3TEDA 1PJUA 5I4MA 2ELIA 2Q7SA 1D0XA 3KCCA 4PDKA 5HVQC 2KDZA 4PUSA 3JRHA 2EQRA 1VQ9I 4FX0A 1UFHA 2ZEEA 2KIMA 3HUGB 2VQCA 3NQOA 1MBKA 4Y15A 5F46A 4KICA 4II9A 1WFXA 5DD8A 1LR7A 3FXTA 2HTSA 4NJRA 2M7BA 2R3SA 3MCZA 4E7LA 5D5XB 3GFLA 3JRIA 2V6CA 2JBJA 4P4EA 1S5LC 5GAHJ 1K4TA 1MGTA 4IXAA 4MY3A 2XF7A 3LSIA 5E96A 3TE4A 3GTLJ 2JA7J 1BC8C 1S3ZA 1H0MA 1OCTC 1A6IA 4YEJA 4EM0B 1XTAA 1Y0NA 2IA1A 2W57A 1S72I 1IY6A 4CYNA 2VBQA 4N0BA 3X2QH 1FAQA 3OS0A 4JK1X 5FUVA 3FMRA 4MFDA 4HX4A 4XRSG 4WP4A 2F4OB 2A68F 3S32A 2H09A 4E1PA 3E59A 2UZ3A 2FJ1A 2I5UA 5ILVA 3B3VA 2HOEA 3CLQA 3SGBI 4Z65A 2KRFA 4D0PA 5LEJA 1BN5A 2QGUA 1Q9BA 2A4NA 1OYIA 1EF4A 2V9KA 4DJAA 1TP4A 3ZQHA 2P7CB 4JJXA 3BR2A 5EF6A 5D5UB 2KFDA 3S9NA 3E6DA 2CH0A 4S0HB 2KRHA 1Y1BA 4ZYEA 5HLIA 1RTQA 3O3KA 2FBHA 1H0ZA 2FIAA 1ITYA 3FXUA 2DK5A 3LSHA 4ZH4F 2DAOA 3VSLA 3OYKA 5K1YA 4KOYA 4MY0A 2NVUB 3H9JA 2EK5A 1W4MA 4XLEA 2JRTA 4CAWA 4ZZDA 3S9MA 1DP3A 2DOAA 2K9LA 1OISA 4G6TB 5ICFA 1Z1DA 3A03A 3T9YA 4OIPF 2HDCA 2O5RA 3DGVA 3H8FA 4BD9A 2AXLA 2BHZA 2V1DA 2DT7B 1TQMA 4RM2A 5G20A 3DBLB 1M4IA 2BOAA 1RESA 1P9GA 4CRYB 2GOMA 1TWGJ 4V19K 2P5KA 3DFGA 4F3QA 5B3SH 2E2JJ 1B6BA 2OD5A 4A3MJ 3RYOA 2LEOA 4G12A 1L0OC 2RQQA 3CCQI 2CV1A 1U9NA 2ZEFA 2W00A 3A02A 4IHVA 1GYTA 3W6KB 2FBKA 1CGPA 2R7UA 5EBVA 2JDCA 1TWAJ 2EIKH 4F0XA 4KS9A 3H35A 2DA5A 3K4BA 2I79A 4Y33A 4AVZA 1YIJI 1SQHA 2FBIA 4E0AA 4Y49B 1TTYA 2KP6A 4BHPA 2F3CI 4L5JA
chains in the Genus database with same CATH topology
1IB1E 4ON0A 2K7LA 3W6JB 4AD9A 5E8GA 1MZBA 4H6ZA 4LGWA 3LAPA 2OB0A 3F0AA 4KYWA 1QPMA 4A30A 4EJVA 4YFJA 1W5SA 4M73A 4UA3A 1YTYA 1YX0A 3GF2A 1P4XA 1J7KA 3G73A 4IRIA 4MTEA 1NE9A 1QSTA 4L18B 2ESHA 3S6KA 2HYGD 3ZMTA 5L3GA 1FT9A 1R1TA 3C18A 3EFAA 1PUEE 5ERIA 3PP9A 3IGRA 3ECOA 4FD6A 1CF7A 1TLHB 4C2XA 4AVPA 3D5LA 3F8NA 4YRHA 4GGGA 1CJWA 2NMTA 4MEYF 2ADUA 3QRFF 3HUGA 2LDUA 2X0LA 4A0XA 4EGZA 4Q36A 2EUIA 2HUZA 2M8EA 1GXQA 1KUYA 1P4WA 2W24A 1MDMB 1WI9A 2JDDA 1JHHA 1V3FA 3K0LA 1S5KA 4HLXA 1LDKB 1NMTA 3JSPA 4CGNA 1OR7A 3NRVA 1FBQA 2O0YA 1S7NA 4A95A 4IF4A 4F7ZA 3JSOA 1RZ4A 4Q4ZF 5TRDA 2D2WA 3FF5A 4M71A 1C0WA 2VBYA 2J8NA 1M4GA 5BPDA 3F5BA 4L9JA 4U7BA 1RUOA 4IHTA 3FBUA 4OINF 4ZGYB 4IJAA 3CUQA 3ZMZA 4WXDA 2WWYA 1M1DA 2AJ6A 2Z3MA 2E1CA 1S6LA 2QQ9A 1YFHA 3WODF 4G6QA 1R1VA 4R8HA 4ZYDA 2ZBKA 2VN2A 3KZZA 2VC0A 2LKPA 5CJ9A 2A61A 2MBFA 2OAZA 5BMZA 4L0YB 3E3VA 3N97A 4CYOA 3GZ6A 3P9CA 1XMKA 2QM3A 1EH8A 2FIWA 1T98A 3BPXA 5D8KB 4K2EA 4QLCU 4KN4X 3FXQA 3VWDA 2DQRA 4UFVA 4GO1A 3TDUC 2HR3A 2ZW6A 5EEHA 3K9UA 1FC3A 5FO5A 5EC4A 2EA2A 3I71A 2H5MA 5IV0A 2UWMA 4UHTA 3KLOA 3RYPA 2HWVA 4BMHA 2EJRA 3JUWA 4ZZLA 2FNPA 3EY5A 3JVNA 4ZYGA 3BY6A 4KT5C 1CF7B 2Z3KA 1U6MA 4KUAA 5H84A 4UWJA 2DO7A 2RV8A 2EFOA 2R98A 4QC6A 4HOBA 4R3LA 4R87A 3R9EA 3BJAA 4KNYA 3EC4A 2OZHA 1Q2DA 3B73A 5DCMA 2F5IA 3GZ5A 4F0YA 1KQ9A 3VB2A 5E20A 5A2QZ 2B0LA 1B59A 1V0CA 2CY2A 2OQGA 1HW1A 1IICA 2YNCA 2ZW5A 2Z99A