1FY7A

Crystal structure of yeast esa1 histone acetyltransferase domain complexed with coenzyme a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
273
structure length
273
Chain Sequence
ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast Esa1 suggests a unified mechanism for catalysis and substrate binding by histone acetyltransferases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords ESA1 HISTONE ACETYLTRANSFERASE
total genus 81
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fy7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 1fy7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1fy7A02
2J5OA 2M87A 3VODA 3KLOA 3EETA 4A0ZA 2O03A 1LVAA 3F8MA 4EJUA 4P5OA 3FNCA 2GA2A 3LODA 3I5UA 4GS4A 3LQRA 3MZHA 4ESJA 3DPTA 5DCMA 4HLXA 4AIKA 2FIAA 2QVOA 1SFUA 4OIOF 1VKCA 4P55A 5IV0A 3P7NA 2Q44A 4NSQA 3QPHA 5HOOA 4EJTA 2JPBA 1D5VA 2J8NA 2K7LA 3BJ8A 2Y48A 5E1WA 1I27A 1OYIA 2BBYA 4U7BA 2ZPAA 1H0MA 1KUXA 2QECA 4HKFA 4YG2F 1TNSA 3BWGA 4L5IA 1T38A 4RGUA 2OU2A 1XN7A 1WSUA 3KP5A 3GWZA 3HTUA 4DNCA 1PUEE 3W6XA 3RDIA 2HEOA 3JVNA 4R87A 1MZBA 2VZZA 5LBQA 3IC7A 4FHTA 1R23A 2IPQX 4RGSA 3BJ6A 1ZREA 2W24A 4R3KA 1D3YA 2VOPA 2COMA 3KEQA 4RS2A 1XGOA 4HV5A 1SFXA 4TV7A 2PMUA 4GYIA 4YFJA 4YIFA 4YFNF 3L00A 1F5TA 3OV8A 3R0JA 5IT9Z 3GX4X 4JQFA 2ZO4A 3QAHA 4IRHA 2XVCA 4LFUA 2HS5A 3ZZIA 3P2HA 4EM1A 5DCMB 4O3MA 3L2CA 1K78B 1ZHFA 3MGDA 2XV4S 4AIHA 5FO5A 5CYVA 3PP9A 4WF2A 1O7LA 3IKTA 5FVJA 1T6SA 1KQ0A 2DQRA 1QZZA 3FM5A 2PI0A 4L9TA 1FC3A 4ZZLA 1FSEA 3BOQA 4ENNA 2MLKA 1QO0D 1GHEA 3CUQA 5ED4A 2K5TA 2PQ8A 2FSRA 4R1HA 1J0RA 1J75A 1YTYA 4BQAA 3K1NA 4OOIA 2ZW6A 4UNOA 1RI7A 1IN7A 1UHWA 1B87A 5TRDA 4IHTA 4I49A 4A6DA 2WPXA 3NQOA 3RTRA 2EWNA 2HGCA 2QQAA 4YIIA 1REPC 2HYGD 1JHFA 3M8EA 5LHGA 1N71A 4M6XA 1IZ1A 4KN7X 4A5MA 5HLHA 5JQ4A 1YO5C 3SXOA 5FD5A 1XSDA 1TLHB 2VQYA 5D8KB 5KVRA 1XGSA 3VFZA 2PMHA 2ACJA 1HW5A 1BI2A 4FX4A 2FOKA 4MQ9F 5BOXA 2A6HF 3D5LA 2REEA 5A2QK 2Q04A 3KFWX 4IJAA 2IA1A 1VHSA 2QBYA 2KJCA 2B4BA 3K69A 2QYOA 3SZTA 4OAEA 1O3TA 3ZMTA 1NMTA 4B09A 2M5WA 1EH8A 2KRFA 2BUEA 3KETA 5HLGA 3F0AA 1ZYRF 5E20A 2XRNA 3Q9VA 1F1ZA 2CYYA 3EUHA 1RNLA 2EFNA 3WU1B 1KA8A 3E3VA 3J80K 2V79A 4M74A 1R00A 2L4AA 4M9SA 2O0YA 1U5TB 2R8VA 1HW2A 1G3TA 2FE3A 1P6RA 3HRUA 3PZJA 2FMLA 4RS8A 5K5RA 2EVNA 2ZKZA 1ONVA 1YVKA 1O57A 3WE3A 3L7WA 2PEXA 3QU3A 3TE4A 2P5VA 3DKWA 3HRMA 4O5VA 5LGUA 1S7KA 1QNTA 1YLFA 3F8NA 1BBYA 5LGTA 3TT2A 4E0AA 1ON0A 3EXNA 1T98A 4G6QA 3FXTA 4LMYA 5BPDA 4Q4ZF 3WTWC 4JXQA 4MNUA 2ZNYA 2J5PA 2QBYB 5K5QA 3PFIA 4EMSA 1YW7A 3S6KA 1IN6A 3RIRA 4BHPA 3RKYA 3U9GA 2YPRA 5E1XA 3LWFA 1K4JA 2Z11A 2H09A 5KTDA 2XAHA 2ZW4A 5HDNA 3TDZC 3D8PA 4RB2C 3DF8A 1LJ9A 1S6LA 2RVCA 4F6AA 3RYOA 5H6QA 2OBPA 2ISYA 2GA1A 3F8CA 4XNHB 2FMYA 4U9ZA 4IRGA 1FSHA 4J3GA 3MCZA 5E8IA 4RI1A 2XASA 3CJNA 2FXFA 4A12A 2Z0ZA 1FX7A 1RO5A 1Z1DA 4R3LA 5D5WB 1SD7A 4PSXA 3I0TA 2CNSA 4LG0B 3FWEA 5ICEA 1SFEA 3PQKA 2M45A 4QB9A 1P2FA 1ON1A 3KEOA 1KYWA 2Q8KA 5HDKA 5FGMA 2A3SA 4D0PA 1Z4RA 3EFAA 4M72A 4LLLA 4EVYA 4JXRA 2B4DA 3NE7A 2YR2A 4LGWA 4AVBA 3F5BA 3EYIA 4LK1F 2DK8A 2CY2A 2Q4VA 2P6SA 2R7DA 4IF5A 1R1UA 5LEKA 2G7HA 2QQ9A 2VONA 4XPDC 1AOYA 3IWFA 3WG9A 1W7PA 2ADUA 1LB2A 1YR0A 2IP2A 3WE2A 1WI9A 2RN7A 5LRSA 2R7FA 3KP4A 4AIJA 4JJXA 4N9HA 4U9YA 5LHHA 4HX4A 1SMYF 3LAPA 4PK3A 4A0XA 3Q9SA 1B9NA 3SQNA 2ESHA 2HKXA 2K4BA 2A07F 1BOAA 4CICA 4XPDB 1T0FA 4CRZB 1E17A 2EFQA 3QPTA 4M85A 3IRRA 1W5SA 4L18B 1FYLA 5DYMA 4Q48A 1QSMA 2A4NA 3IHUA 3K1PA 1S29A 3SXYA 3I71A 3LAJA 3L09A 4JLYA 5L3DA 1P4XA 5L3BA 1KYZA 2VBXA 3FHZA 2STTA 1F4KA 4GO1A 4AVAA 2B5GB 2R98A 4NEXA 2I00A 1L0OC 2GXGA 4WCGA 3F23A 4HF0A 2HZTA 1ZG1A 1O3SA 1A04A 3KE2A 5DEQA 5IT3A 3MEXA 1UFMA 1JXSA 4CHUA 2HQNA 4I0AA 5F47A 3QOPA 3NEUA 2ESNA 1Q2DA 2FT0A 4BXUA 2A5YB 2D45A 2P8TA 5H20A 4FD5A 5FFXA 1KU7A 1YW9A 2QIRA 4AD9A 2MH9A 2VZYA 1FT9A 2OD5A 1SQHA 2B3UA 3HRTA 2JTVA 5LGNA 4II9A 4PZJA 3TO9A 5ICFA 4FD4A 2JT1A 5CNPA 5JFRA 5F64A 4ONUA 3IWGA 4JD6A 2DK5A 2VBZA 2WC2A 1ON2A 6PAXA 3BJ7A 1G3YA 2RGVA 1RUOA 3JAMZ 4QWQA 3WTYC 4OINF 2VI7A 3ABTA 1C0WA 2G7UA 4YGOA 5HDGA 4I02A 5HLIA 4L8AA 4MJ8A 1YS7A 3TDUC 1SD6A 3UY5A 1KQ8A 2V1DA 1GVJA 4FD7A 2P6FA 5C82A 4F7ZA 5HS9A 1XD7A 1ZARA 2FRHA 4RB1A 2M8EA 3H3UA 1AWCA 2E1CA 1Y0UA 1U5TA 1ZGAA 3WU0A 1FYMA 2XKPA 2M1BA 1PDNC 1BM9A 1YLEA 4UVBA 5DUIA 1XDSA 4K30A 2GQQA 2GWRA 2W85A 1HSTA 1Z9CA 1ZG5A 1IYLA 2VXZA 3M8FA 4BNCA 1I6XA 1E2XA 4G7ZF 2QENA 1EH7A 1TNTA 2K02A 1FOKA 4HDVA 5DWMA 3V8JA 1XSXA 5A2QZ 1OZPA 3LD2A 4MY3A 2VODA 5J6XA 5GCNA 3GYHX 2KJBA 4EJOA 1HBXG 1I1SA 4Y13A 1TQMA 1NSLA 2PJPA 1ZG3A 2DI3A 1S3JA 2AXLA 2ZFWA 5CVVA 3JAMK 1ZGJA 3GUDA 5BS6A 5HVQC 2EK5A 3EQLF 1S7OA 4KIGA 3N97A 4A5NA 1OR7A 2NYXA 4OMZA 2W57A 4IUSA 3CO7C 2DLLA 4XPKA 2P0WA 2H94A 4CYDA 2FIWA 5ERIA 1W5TA 5L3EA 3G3SA 2XAJA 3ZMVA 4MI4A 2ETHA 4CXFA 3HRSA 4LJZF 1R58A 2LF8A 4QUSA 1CF7A 3R9EA 2Q7BA 4PDKA 1XF8A 2DU9A 2P7CB 2O8XA 5K1YA 2IJLA 3CUQB 3RJPA 5ISVA 1IB1E 3KP2A 1DUXC 2GIVA 1FBUA 1XMKA 2RDPA 4G6DA 4HBLA 5CLSA 1IUYA 2GE3A 5HH1A 3ML6A 4ZYGA 2G9WA 3ZN1A 2XAGA 1OKRA 3FZVA 4FT8A 2PRBA 3R6SA 3NRVA 3QP5A 4MBUA 4HNXB 4HOBA 3E5UA 1BI0A 5FD6A 1LEAA 2JEVA 2QQBA 1K78A 3GYAA 4KVXA 3LA2A 2D1HA 4B5PA 3F8FA 4CGZA 1B59A 1I1GA 2H27A 1SAXA 4MY0A 3F72A 4BAYA 1JGSA 4R8HA 2P6EA 1S7FA 4MQVA 1S7LA 4A2UA 3EY5A 4IHSA 1QGPA 3GY9A 2KCWA 3FF5A 3KP6A 3T90A 2B5GA 3T5XA 2IL4A 2OZ6A 4RB0A 1R57A 1K79A 4G8XA 2R7HA 2P5KA 4I7HA 1NE9A 1YFHA 2BL1A 2FU4A 3BP8A 2HQYA 4Q5SF 3ULQB 1R22A 1B4AA 4IPAA 4MEXF 4LB5A 5CVJA 5J8FA 4MEYF 3I53A 3F6VA 2DW4A 3LA3A 2D2WA 3COAC 3ZMSA 2JSCA 1JE8A 3E5QA 1FBSA 2K27A 4L9NA 3KKWA 1ZLJA 2HOEA 3M1EA 3DQVC 2Q0OA 1W7PB 2ZNZA 4JBAA 3QU6A 3ROUA 2IRFG 3B02A 5D8LB 4LD5A 1V4RA 4I01A 4HZFA 2XAQA 1OYYA 2LDUA 3FBUA 1W4MA 3QP6A 4O6JA 4S04A 3SHPA 3WGHA 2FS5A 4UWIA 1PUAA 5CVIA 1MJAA 1YVOA 2FE7A 3AAFA 2ATRA 3ABUA 1MD0A 2LNBA 2EV0A 4FX0A 4RAZA 4L5JA 3TFYA 4S05A 3T9YA 4AG9A 4ZH4F 1ZAOA 1IICA 1UB9A 4KNYA 1XCVA 2Y75A 1O7FA 5CVRA 3HHHA 4CAWA 4LG0A 4GXOA 3MWMA 2DO7A 4CZZA 3K9UA 1KUYA 2D4OA 1U6MA 1H9GA 1I5ZA 1YQAA 3G8WA 1R1VA 4ON0A 1LDKB 3V8LA 1R7JA 4HAMA 4N0BA 2X4HA 3E6BA 3FM3A 2DXQA 1PP8F 3SXNA 5LHIA 1XCBA 3TOAA 1PP7U 3GFJA 4P96A 2IT0A 1XMAA 4PK2A 1Y7RA 4XPLA 3BJAA 1T39A 4FD6A 2G3TA 4Z2YA 1VTNC 4ASNA 4YRHA 2ZJ2A 3FMSA 5FLXK 3HSFA 3KCCA 3GLXA 1SD4A 2F5EA 4RAYA 2L3DA 2IA0A 1ZH5A 1UFHA 2W84A 4UVCA 4KT5C 3ZP5A 2HYFA 2HV2A 4H89A 3EYYA 3P2FA 3DEUA 1QSOA 2P7VB 4ZYDA 2EV5A 3C1DA 1TQPA 3I58A 4WXDA 1B6AA 3FXQA 1P4AA 1U2WA 3D2PA 3JSPA 2FNPA 1XDUA 3CUQC 4CRYB 2MBFA 3ZMUA 5C88A 4KMUX 2XUBA 4KOTA 3KLNA 4OIQF 1BC8C 5CVUA 2EFOA 2ZXJA 2ZMEB 5AIQA 4KICA 5IX3A 2LSOA 4AVCA 1FBQA 4GCVA 3GFMA 3I9SA 1SD5A 3DFGA 5DWNA 3CLOA 1G4DA 4KDPA 2YSRA 3FXUA 3WR7A 1FWZA 4AVPA 3CO6C 4LX9A 1Z91A 2QM3A 3JTHA 1I21A 1TQIA 2W25A 1J7KA 3RKXA 5JI6A 2VE8A 1KQ9A 5L3GA 2KIUA 4U0WA 1WWZA 4NB5A 1R36A 4PGHA 5J8CA 4XSZF 1IN5A 5D6EA 4OLLA 3DDDA 2HFHA 2QUFA 3GVAA 2L4MA 3JUWA 3RYRA 3GFLA 2A61A 2XROA 4HDUA 3ZMZA 4IRIA 3C7JA 3DNSA 3BLNA 4KFCA 2OZGA 4JK1X 1Y9WA 3PGPA 3JW4A 3EDPA 1YIOA 2DTRA 1SMTA 4A0YA 3WODF 1XMTA 2LF7A 3GKRA 1G3SA 1STZA 4Y49B 5EC4A 4M9ZA 4IVNA 2FCKA 5H86A 1DDNA 4HLYA 5DDGA 5L3FA 3FIXA 3FRMA 3FYNA 4KLWA 5JVTA 4QC6A 2B0LA 4R9MA 3S6HA 5L3CA 4MTDA 1Y9KA 4Y49C 3T0YA 5D5VB 3U2RA 1BI1A 1Z6RA 4KN4X 3DR6A 2BV6A 1U78A 4HX7A 3U1DA 4ENJA 1IXRC 2NMTA 1QSRA 4EGZA 1HKQA 4U7DA 1PU9A 3G73A 4BHCA 3E97A 2L01A 1YG2A 1WRJA 4GGGA 4JWPA 1W7PD 2E1NA 4AB7A 4PCQA 4KVOE 1R5GA 1WWXA 5E1ZB 4HQEA 3HIFA 4LB6B 1M4IA 1HXDA 1IXCA 3HTSB 3TGNA 2VE9A 2NAZA 3KZYA 4OIRF 1IRFA 3J81Z 2I79A 3FB3A 3GO5A 3LQQA 3HUGA 3HOSA 1IN8A 2AE6A 4KYWA 1Z9UA 3DSBA 5F6FA 1HKSA 3D0SA 4G94A 3WTSC 4B8XA 4U5YA 3ZPLA 3K1MA 4XRFA 2CQKA 5DUKA 4EV0A 3V7RA 2WV0A 4KLVA 4BMHA 3B8GA 3W6SA 1MJ9A 2F5FA 2O3FA 1MDMA 1CJWA 3C26A 2PN6A 3B73A 2G3AA 3ZMDA 1KZFA 2D1VA 4E8OA 1H9TA 1KU3A 5HS8A 3I4PA 5DD8A 2KKOA 1L3LA 2ZXVA 3H4QA 2JLMA 3FX3A 1BOBA 2PFBA 3HYIA 1CGPA 1ZN2A 3SFZA 4HF2A 1M44A 2H6CA 3I64A 4KUBA 3EC4A 1ULYA 2PSWA 2QLZA 1WK4A 4OMYA 2B58A 3BZ6A 3H3ZA 1V0CA 4ORFA 2WPWA 1L0CA 2VC0A 3TKYA 4X5KA 3ECHA 1Z7UA 4GYGA 3P9CA 2VEZA 2AS5F 3CXSA 5ICGA 2ZBKA 5JPHA 1XEBA 4OADA 3WTVC 3DP7A 5F48A 2VBWA 2J8RA 2BEIA 2PR8A 2OZHA 4XSXF 4CDGA 5H84A 3VOEA 1DPUA 5IB0A 2Z5UA 3E0KA 3W6JB 1M4GA 1IN4A 3R96A 2GXBA 3BY6A 3G3ZA 5FLXZ 2JDDA 5E96A 3WGGA 3ERED 1J5YA 2CG4A 2PR1A 2O28A 3WTUC 3CXQA 2REFA 4H6UA 4G9YA 2CSOA 3E5XA 4KOSA 2CFXA 2BGCA 2VOOA 3DXJF 1IIDA 4HV6A 1MKMA 3R95A 3H92A 4E2AA 1KU2A 2VBQA 4EM0B 3R0AA 2DPDA 2HKOA 3LSTA 2P5LC 1T2KA 1CF7B 2BE5F 5I0CA 1BN5A 4R79A 2VT3A 5E18F 4EQQA 4UUVA 4B5OA 2V1XA 2Y0MA 5D5XB 1KU9A 4ENMA 3EO4A 1WQ2A 3HSRA 3P9KA 3CDHA 3F22A 3PQJA 3VEPA 2PLYA 2QZ8A 3O3KA 3P9IA 4IXAA 4OU0A 1FYKA 4EVIA 3HOTA 3JSOA 4KIFA 4A6EA 2F2EA 3WTZA 2FQ3A 3BROA 1J9IA 3N7ZA 4WK8F 4KIBA 3WGIA 1QPMA 3F8BA 5IT9K 2PDOA 2FL4A 1XSVA 1IYKA 4XNHC 2FSWA 2WWYA 3TO6A 2KIFA 1G3WA 2TDXA 4ZYHA 4UV9A 4L9VA 4WXCA 2CO5A 3IL2A 3OOPA 3R60A 1K7AA 3RKWA 5ILUA 4HA8A 1LQ1A 1GHCA 4BYYA 2ZW7A 2MD5A 4PSWA 3IWZA 1WKMA 3IGRA 2G0BA 2HTSA 2MLGA 2V1UA 1XGNA 4AG7A 2AJ6A 4DQ2A 1LNWA 1BIAA 2RNJA 1M1DA 4HQMA 1MDMB 1FP2A 3W6KB 3J7AO 5FFZA 1B6BA 2VC1A 3TOBA 1QSTA 3BPXA 2GANA 2EJRA 2NS0A 2ARHA 4HNYB 1KGSA 2HQRA 5LRRA 4CAVA 1DP7P 2NNYA 3MAJA 2O61A 2H5MA 1P0HA 1U5TC 2X7BA 2E7XA 1QQIA 4I09A 4UXNA 2VXKA 4KOWA 3Q5FA 1TIQA 2D4PA 1B9MA 2CW0F 4MGRA 5ILSA 4NCZA 4XLNF 2DFIA 2HUZA 1S3ZA 3R9FA 1OMIA 4Q47A 3RYPA 2EA2A 1HQCA 2OZUA 1QBJA 3GF2A 1S5KA 4E70A 2CWEA 2EFPA 2GAUA 2C27A 3OWCA 5DD4A 5BQTA 1RIOH 2FBKA 3MZYA 3GXOA 1P4WA 1S7NA 4K2EA 3O2PE 2EB7A 4I2OA 4UWJA 2CNMA 2EA4A 2OH1A 2DAOA 4WWCA 1ZLKA 4CS0B 5F1RA 2UWMA 1YYVA 4QLCU 2OB0A 2IVMA 2FF4A 2FBIA 2FA5A 2H6BA 1U6GA 4KOYA 3ELKA 3J81K 4U0YA 2ZMEA 1TBXA 4AWXB 3WTTC 1LRZA 4KOUA 2JDCA 2OQRA 4ENKA 2VN2A 1P4NA 2QMLA 1CM0A 1UHMA 3DV8A 3TQNA 3S2WA 5D4RA 2A68F 1Q1HA 4KOXA 2HR3A 2V9VA 2FXAA 1FY7A 4BH9A 4KVME 1FPQA 5D5UB 3BJOA 2IW5A 2HDCA 5H6RA 1YW8A 4YFXF 3QRFF 4RGRA 5KK1A 1U8RA 5CJ9A 4NF1A 1YREA 4PV6A 4UV8A 5TJJA 5JHUA 4NHJA 2DQLA 2M30A 4M3SA 3T8RA 1TTYA 4M73A 2JRTA 4MTEA 4KUMA 3TTHA 1IAWA 1MGTA 2B3VA 2XIGA 1D8KA 4CAXA 3FXRA 4H6ZA 2OAZA 2Z33A 1U3EM 1IRGA 2A6EF 3K2ZA 1F9NA 5E17F 1GXPA 4UHTA 2WTEA 4Y15A 2BYVE 5D6FA 3LA7A 2UXXA 3SZPA 1EH6A 1G6NA 3DPLC 2JZYA 3VB2A 4G7OF 3REOA 1MK4A 4ZBGA 4HW0A 3LFKA 1K6OA 1FNNA 4MHDA 1MJBA 1Q2YA 3V4GA 3JTGA 1RXTA 2R1IA 3ISPA 3HHGA 3M7GA 3TO7A 4EJWA 4F0YA 5ILVA 1DPRA 1LDJA 4MHGA 5ICCA 2OQGA 1NHAA 2HTJA 1YK3A 2LKPA 5AONA 3RI4A 2VBYA 4EGYA 4G7HF 4U0VA 3V7SA 2PG4A 3ZQ7A 2OA4A 5BPIA 3IRQA 5HS7A 5HMNA 4EJVA 4R57A 2EFWA 4N9IA 3I3GA 3N4MA 3KP7A 3W91A 4WX9A 4L0ZB 4RB3C 1OPCA 2NRAC 3HSEA 3FMQA 3GZ6A 1R5HA 1O3RA 1X3UA 3SHFA 4PGGA 5E8GA 1FZPB 1S60A 2XKOA 2RV8A 2PC1A 4UVAA 3T1BA 1UCRA 4NQWA 1O3QA 2B4DB 2XGXA 4M9XA 3V7CA 5JR3A 2RQPA 1LDDA 2JPCA 2ELHA 3MFKA 5KTCA 3R9GA 2HWVA 1IF1A 2P6GA 4Y17A 5DCFA 2RKHA 2CNTA 4P9UA 2GZWA 4ETSA 5BMZA 5D4SA 1ZRFA 3E6MA 5F49A 3T8TA 1BC7C 1FP1D 4UBRA 2BSWA 1TW2A 4EM2A 3R61A 4ESFA 3GEZA 4B5PB 4L0YB 1YX0A 4KMFA 3S6FA 1XE4A 1M4DA 3R4KA 1XGMA 4L9JA 2E7WA 4HX8A 1YS6A 1Z6TA 4KA4A 4YFKF 2STWA 3F8KA 1I12A 1Z05A 3I59B 2L02A 3KZZA 3QB8A 1OYWA 2Q2EA 3GW2A 3GZ5A 3V8KA 2Z9OA 3FMRA 3RPQA 2IA2A 1R1TA 3DR8A 2Q0YA 4H0EA 3M9AA 3WTXC 4IF4A 2ZW5A 1Z4EA 2FNAA 2MC3A 1P92A 4UA3A 4LLGF 1YGHA 2F5DA 3CXPA 2DPUA 3L9FA 1I1DA 3D2MA 1LEBA 4I0BA 3C3WA 2YX7A 2XAFA 1BO4A 2XHKA 2F5CA 1V3FA 4U88A 4KUAA 5LLQA 5FB2A 2O6GE 2Q4YA 1EV7A 3IKVA 1XIXA 4CO8A 1D8JA 1QZYA 2YU3A 1RUNA 1S7AA 2Z3YA 4HNWB 2EUIA 1JHHA 1HKTA 2VT2A 3VWEA 4XLPF 3ECOA 1QSNA 1J4JA 1BI3A 5DV5A 3VWDA 1USTA 1ZRCA 2EV6A 3CTAA 2K4JA 1IXSB 1FLIA 2CGPA 3TCVA 1ODDA 3GFIA 3F21A 4M71A 4RGXA 1KUVA 1RZ4A 5KTAA 5AIPA 3RPUA 2KIMA 4QBJA 3D3SA 1B1BA 1GXQA 2L54A 2BEOA 4OIPF 4P9FA 4M6YA 2K86A 5F46A 4HF1A 2V6CA 2ISZA 3R1KA 2UXNA 1IW7F 2UZKA 4ESBA 2C6YA 5EBVA 2P6TA 3MQ0A 4LUAA 2F5IA 4ZZDA 3ZJ0A 1USSA 3J80Z 2X0LA 4HYEA 3O6BB 4QVTA 3BDDA 1Q2CA 4L89A 3V8IA 2DBBA 3KP3A 2Z99A 2PBIA 4KZTA 5EEHA 4KOVA 4XBFA 2MA3A 1HW1A 1S8NA 2RC4A 1TW3A 5EEGA 3I54A 4KORA 2ZCWA 3S6GA 4LLNA 3F6OA 1ZRDA 1BJAA 3K9TA 2FBHA 2P4WA 4LK0F 3K0LA 3CUOA 2NNNA 1J2XA 5LEJA 3C18A 2QWWA 1HSJA 2R3SA 2DT5A 2J8MA 3F3XA 2Z10A 5K5OA 2FEZA 1BIBA 2YX4A 3E6CC 4ZYEA 3E6DA 4I98B 3ZN0A 1XB4A 2A69F 2MH2A 4BHBA 3BPVA 1J59A 4WXHA 3I59A 4NXYA
chains in the Genus database with same CATH superfamily
4XKCA 2J5OA 2M87A 1OCOH 3VODA 3KLOA 3EETA 4A0ZA 3KEYA 2O03A 1LVAA 3F8MA 4EJUA 2G9DA 4KLWA 4P5OA 3FNCA 2GA2A 3AG2H 3LODA 1HPTA 3I5UA 2ZJPF 2L7KA 1JTXA 1FIAA 4KISA 3A2KA 1XRYA 3PUFA 3KI9A 1W4RA 4GS4A 2JQ7A 5JGFA 3LQRA 3MZHA 4ESJA 2L7FP 3BI1A 3DPTA 5DCMA 1NK3P 1CX8A 4HLXA 4AIKA 2FIAA 2QVOA 1VQPI 7CPAA 2KDZA 1SFUA 4OIOF 2OTLI 4P55A 1ARMA 1VKCA 3P7NA 5IV0A 2Q44A 3FB3A 4NSQA 3QPHA 5HOOA 4L9MA 1OLTA 2Y31A 3OMYA 5FKNA 5K7ZA 5K8OA 4EJTA 2EINH 1FIPA 2JPBA 1D5VA 1W36D 1Q9BA 2J8NA 3LSKA 2K7LA 4QPQA 1MBGA 2Q4ZA 2LY1A 3BJ8A 2Y48A 5E1WA 4EFDA 3DGVA 2L0KA 1I27A 3IU2A 2NS8A 4I99C 1OYIA 1SVMA 2M0CA 4HG2A 1X2NA 2BBYA 3B3TA 2CTBA 4U7BA 4LIVA 3SEKC 2ZPAA 2ZXHA 2V4JC 1H0MA 4RBOA 1Z77A 4P45A 4IHVA 1KUXA 4FUUA 2DMPA 3OL4A 2QECA 4HKFA 4YG2F 1TNSA 3BWGA 2XEIA 4L5IA 1T38A 4RGUA 1NTCA 2QSFX 4ZTFA 1YIJI 1WJDA 2OU2A 1XN7A 1WSUA 3KP5A 4A3KJ 3S32A 4HGUA 3CJRB 3GWZA 3HTUA 4DNCA 1PUEE 3W6XA 3RDIA 4IK2A 2ZXWH 2HEOA 3VYSB 3JVNA 1RPWA 1MZBA 4PJ0C 4R87A 3BG9A 3B6CA 5EX0A 2E35A 2VZZA 4UEZA 5LBQA 3IC7A 4FHTA 5E3MA 4PJMA 1R23A 1FOYA 2IPQX 4RGSA 3BJ6A 4M3EA 1SAUA 1ZREA 2JVHA 3H36A 3PBBA 2W24A 4R3KA 3ZXSA 1ZO0A 1D3YA 2VOPA 3DLLF 1DS3I 4CAFA 2COMA 3H3VK 2PJ9A 3KEQA 5DS9A 4RS2A 1YJWI 1XGOA 3D7DA 1ZG9A 2DA2A 1P9GA 4HV5A 1SFXA 5G22A 4TV7A 5FKMA 2PMUA 3H5AA 2OPTA 4GYIA 3BXMA 4YIFA 4YFNF 4HRIA 4RLQA 4YFJA 3HGYA 1S5LC 5HVFA 5JM6A 3L00A 3QTLD 2IGNA 1F5TA 4D7MA 3OV8A 2HPMA 3R0JA 3TEDA 4ZJZA 1MMSA 5IT9Z 3GX4X 1BUSA 4JQFA 2ZO4A 3QAHA 4A2ZA 1TBOA 4IRHA 4P4EA 2XVCA 4LFUA 1XBTA 2HS5A 4C3IJ 3ZZIA 5M5WJ 3P2HA 2J9AA 4EM1A 4F9VA 5DCMB 4JYWA 4O3MA 1X19A 3L2CA 1K78B 1ZHFA 3FDYA 4F91B 2QPOA 3MGDA 2VQLA 2EZLA 5M3FJ 2XV4S 1K6YA 3KQZA 4AIHA 1SGNI 5FO5A 5CYVA 3PP9A 3BQZA 4WF2A 3MKYB 1O7LA 3O8GA 3IKTA 5FVJA 1MH4A 4A39A 2PJCA 1RRJA 1T6SA 1KQ0A 1UJ8A 4DBQA 2DQRA 1QZZA 2VJJA 3FM5A 2AXTC 1IG7A 2PI0A 5EX3A 1CGII 4L9TA 4PJNA 1FC3A 5D8NA 4ZZLA 1D1BA 1FSEA 2VXDA 3BOQA 4ENNA 5IP7J 3JRIA 4UXHA 1NG6A 2MLKA 1QO0D 1GHEA 3CUQA 2NOJB 5ED4A 2PQ8A 1JKQC 2FSRA 2K5TA 4R1HA 1J0RA 1J75A 2XEFA 1YTYA 3IV5A 5F1JA 2JUCA 4BQAA 3S2DJ 3K1NA 2PJ0A 4OOIA 4XR6A 3M1CA 4UNOA 2ZW6A 5EGOA 3D1NI 1RI7A 4MFPA 1IN7A 2OVOA 1I50J 1YTPA 1R3NA 2HB6A 5LYIA 5HNFA 1UHWA 4Y3OA 3ZOBA 1BA5A 2HVQA 2M9HA 1B87A 2CIJA 3S9LA 5TRDA 4IHTA 3J7ZI 2KZVA 3B3SA 1K61A 4I49A 4A6DA 2JA6J 2I8DA 4RM3A 2WPXA 3NQOA 4RLFA 3RTRA 2EWNA 3VDXA 2HGCA 2QQAA 4YIIA 2MW8A 2K9MA 1QHHD 1REPC 3D7HA 1CG2A 2NU4I 2HYGD 1JHFA 3I55I 2ZJQF 3M8EA 3CC4I 3V42A 5FJ8J 4NGMA 1SGYI 5LHGA 1LE8B 1LUJB 3GTQJ 1N71A 2VKDA 4M6XA 4HNTA 1IZ1A 2WZNA 1Y8QB 4KN7X 4A5MA 5HLHA 4U87A 1YO5C 2E1OA 3WG7H 5FUWA 5FD5A 1XSDA 1TLHB 1QRYA 2VQYA 3SXOA 1I3AA 2K9HA 5D8KB 5KVRA 1XGSA 2KZGA 4JX6A 3VFZA 2X1DA 3LMMA 4XN0A 1D5YA 4IO9F 2PMHA 4BY7J 3A9LA 2ACJA 4UFVA 1HW5A 1TP4A 2BHYA 1BI2A 2DT6A 2FOKA 4F93B 4MQ9F 4FX4A 1VFCA 4IHYA 2XSDC 3CDIA 2A6HF 5BOXA 2BOAA 2K9SA 3D5LA 2REEA 2JSPA 5A2QK 2Q04A 1V54H 4P1WA 2HOTA 3KFWX 4IJAA 2IA1A 1VHSA 4XOTA 2QBYA 2KJCA 2B4BA 4B47A 3K69A 3ZQQA 1A35A 2QYOA 3SZTA 1WTJA 5JHWC 1O3TA 4OAEA 1Z2LA 5IYCJ 3ZMTA 2F48A 1NMTA 1Z8XA 4B09A 2M5WA 2UUZA 4CYCB 1EH8A 1FOXA 4YU9A 3KPHA 2N8GA 2KRFA 2BUEA 3KETA 5HLGA 4XL9A 1T95A 3F0AA 5IOZA 1ZYRF 3SJEA 5E20A 2XRNA 3Q9VA 4OC0A 1F1ZA 2CYYA 3EUHA 3E2IA 1RNLA 2Y9ZA 2N71A 4CGNA 2ORWA 1HDPA 2PJ7A 2EFNA 1WJFA 1T33A 3ISZA 2M34A 3ONQA 3WU1B 1AYEA 3LOCA 1KA8A 4H2KA 3E3VA 3J80K 1TT5B 2A05A 2V79A 4ZX8A 2VRWB 4NGQA 4M74A 4FTHA 1R00A 2L4AA 4M9SA 5K7FA 3JRFA 2O0YA 1ZG8A 4MCRA 4CYNA 1U5TB 3MVPA 1HW2A 2JZMA 2GFQA 2JEWA 2R8VA 1G3TA 2KLOA 2FE3A 1PCEA 4E7JA 1P6RA 3HRUA 2EIJH 3PZJA 4XLHA 3JR9A 3O8HA 1WH7A 2JK3A 1IUFA 2ZC2A 1V5EA 2FMLA 4RS8A 4DYRA 5K5RA 3BZKA 2R5ZB 2EVNA 2NXNB 2ZKZA 1ONVA 5HNHA 4BE1A 1YVKA 4MFZA 4OIWA 1O57A 3WE3A 1OCCH 3L7WA 2PEXA 3QU3A 4A38A 3FH4A 2XEJA 2P5VA 3K4KA 2PCUA 3TE4A 3DKWA 3HRMA 4O5VA 5LGUA 1S7KA 3JRUA 2GOMA 2X51A 3PFYA 1QNTA 2FD5A 1YLOA 1YLFA 2V9PA 1BBYA 3F8NA 3BG3A 5LGTA 3TT2A 5E3OA 4ZY2A 5JQ4A 2QCOA 4E0AA 4ZDPA 1R9TJ 4PUSA 4KT6A 4X0GA 1ON0A 3EXNA 1T98A 4G6QA 3FXTA 2BY3A 2FJ1A 4LMYA 4PFOA 4JZ0A 3S14J 4UEFA 4B11A 2B7EA 3DPUA 4Q4ZF 5BPDA 3WTWC 3KHXA 1JT0A 4JXQA 4ZYQA 4OWRB 2AFUA 2K85A 4MNUA 5J40A 1VGYA 2ZNYA 2PJ6A 3HM5A 2J5PA 2SGQI 2QBYB 1ETXA 3FMCA 4D1QA 5K5QA 3PFIA 1ZR4A 2EQRA 4EMSA 2HXIA 3MKWB 1RR8C 1YW7A 1SGQI 1IN6A 3S6KA 4CCLA 2PJ5A 3MN8A 4BY1J 4O23A 3WT4A 3RIRA 4BHPA 3RKYA 1R49A 1FNOA 2DA4A 3U9GA 3EUKL 2YPRA 2BW3B 5E1XA 2HC9A 3LWFA 1K4JA 2Z11A 3HKZA 3OL0A 4GM5A 5LFAA 2H09A 3QQAA 4DW6A 5KTDA 1X4OA 1TOTA 2XAHA 1W1WE 3CF2A 4FQGA 2OCCH 3K4BA 2ZW4A 3BTIA 5HDNA 5FLMJ 3TDZC 2CXAA 3D8PA 2BXZA 3HGGA 3DF8A 4RB2C 1LJ9A 1S6LA 2M4KA 3LWUA 1UVGA 2RVCA 4AYBA 1SC7A 2QYVA 1CQTA 3RYOA 1XA6A 4F6AA 5H6QA 2BVLA 2ISYA 2GA1A 2OBPA 5DAEA 3F8CA 4XNHB 1RESA 1TKJA 2FMYA 1RC9A 4U9ZA 4UIBA 2L9SA 1N13A 5IP6A 4HPQA 4IRGA 1Z3YA 1FSHA 4J3GA 3BTLA 3MCZA 4MFEA 1BLLE 5E8IA 4RI1A 2XASA 2IS2A 3CJNA 1Z3XA 2AFMA 3PRTA 1GV5A 3U1KA 1LFUP 2FXFA 2FNFX 5F0HA 1QA6A 3FXKA 4A12A 1IRXA 1FX7A 3B4VC 2M4GA 2WYRA 2Z0ZA 4UFXA 1RO5A 1MNDA 2LP0A 1Z1DA 4R3LA 5D5WB 1SD7A 3OY9A 4PSXA 3I0TA 2CNSA 4LG0B 2ELJA 2WVJA 2M7AA 4CCJA 3HBLA 3FWEA 5ICEA 2E71A 1X4SA 1SFEA 1BPMA 3PQKA 2M45A 4QB9A 1TGSI 3QOEA 3JTKA 2BY1A 2PJRB 1BW6A 1R79A 1P2FA 3CP2A 1W36C 2NYQA 1ON1A 3KEOA 1IW4A 1KYWA 2Q8KA 2DOEA 3I56I 5HDKA 4DYOA 2BVMA 5AG4A 3N05A 3UEJA 4KSAA 5FGMA 3FECA 3CCUI 2A3SA 4D0PA 3TP0A 1Z4RA 2M0MA 2X6WA 3DTKA 1M8BA 3LACA 1KBEA 3EFAA 4M72A 4LLLA 2X3TA 4EVYA 4JXRA 1HEVA 1ETOA 3VYRB 1U0JA 4NQWB 2B4DA 2Q43A 2Z3PA 1MBKA 4JP0A 3NE7A 4Q36A 1GVDA 2YR2A 2MFZA 1FYBA 4LGWA 4AVBA 3F5BA 3OOUA 2C6CA 2K3FA 3EYIA 5LRJA 4LK1F 2DK8A 2CY2A 3CP8A 2HVRA 1U9NA 4I76A 4D5CA 2Q4VA 1R0RI 4B10A 4YEJA 2P6SA 4C9YA 5B3SH 4BXXJ 3CCMI 1A6QA 2R7DA 1R1UA 2QQ9A 2G7HA 5LEKA 1B8IA 2HOSA 2VONA 2WADA 2KMUA 4CH7A 3CPXA 1AOYA 4GXHA 2X85A 3PNYA 4B3XA 3IWFA 3WG9A 1W7PA 2ADUA 3HL2A 1OQYA 1LB2A 2VQGA 1YR0A 2IP2A 3WE2A 4CYOA 1WI9A 5EYRA 2RN7A 3H9JA 2CW8A 2R7FA 5LRSA 3KP4A 4AIJA 2XGEA 1VDDA 2YS9A 2VLAA 4JJXA 3HZJA 4C2ZA 3BJIA 4N9HA 4U9YA 2LBFA 5LHHA 4HX4A 4F0XA 1SMYF 3FBNB 4YELA 4DOZA 1ETKA 3CCVI 3LAPA 4PK3A 4A0XA 1KBFA 3Q9SA 1B9NA 3DWLE 3SQNA 2ESHA 2HKXA 2R7SA 2K4BA 2A07F 2COBA 1BOAA 4CICA 1IY6A 3SYTA 3CMEI 3MRUA 4V2FA 4XPDB 2KMRA 1T0FA 2ZOFA 4CRZB 1E17A 3X2QH 2EBIA 2EFQA 3K4MA 4NDLA 1G8XA 3QPTA 1W5SA 3EPZA 3P5JA 3IRRA 1K4SA 1LCPA 2CF4A 1ELLP 4L18B 1FYLA 5DYMA 1YOVB 1EF4A 2PJ1A 2NU2I 4Q48A 1QSMA 2A4NA 3IHUA 2C1CA 3K1PA 2QVPA 3VDPA 1S29A 3SXYA 3I71A 3LAJA 2DYRH 4FISA 4DBRA 4A32A 3L09A 4ONWA 4JLYA 2R5YA 1OMUA 1JQGA 5L3DA 1P4XA 5L3BA 4UCNA 1KYZA 2VBXA 1GT0C 3FHZA 2PIZA 1HEEA 4F9UA 2STTA 5FUXA 1F4KA 3IAS2 3QWLA 2L5QA 2LG4A 4GO1A 2B5GB 4AVAA 2QGUA 4II2A 4K30A 4SGBI 2R98A 4NEXA 2I00A 3BC8A 1L0OC 2GXGA 4WCGA 3F23A 3DU5A 4HF0A 2HZTA 4ABZA 4IAVA 5GADJ 1ZG1A 1O3SA 1A04A 2VKVA 2XRLA 3D5SC 1PYTB 2V8HA 3KE2A 3Q0WA 3TMOA 5GAEJ 1QQ9A 3CXLA 5DEQA 5IT3A 5FUVA 3GCMA 1PVEA 1DQUA 1UFMA 2HXOA 2JA2A 3MEXA 1ELMP 1JXSA 4CHUA 3FF3A 3RPUD 4C7HA 2HQNA 2C6GA 4I0AA 5F47A 3QOPA 4JOMA 3NEUA 2LRDA 3B2YA 2ESNA 1NSAA 1Q2DA 2FT0A 4BXUA 3FX6A 2A5YB 5CPRB 1U9OA 4PJLA 3SEZA 2D45A 2P8TA 4XRSG 4C2XA 3NWTA 5H20A 4FD5A 2L7XA 1LANA 4A94A 5FFXA 1KU7A 4BJ6C 1IGNA 2DFHA 2IAIA 4EEFG 1APLC 1YW9A 1TUSA 2QIRA 4AD9A 2MH9A 3PB9X 5C3EJ 1V5FA 2CW7A 2VZYA 1FT9A 1T08B 2OD5A 1XOVA 2MABA 1SQHA 2B3UA 4J00A 3KZWA 2O4HA 1OMTA 2CJJA 2XB5A 2OJED 3HRTA 2VUMJ 2JTVA 3RZOJ 3L2NA 5LGNA 1LAPA 4II9A 4BS9A 4PZJA 5B1BH 3TO9A 2HNHA 5ICFA 3K70C 4IHXA 4WP4A 4FD4A 1GLNA 2JT1A 3FBIB 4G6TB 3BR0A 2L7MP 5JFRA 5CNPA 2DA3A 1FMVA 5F64A 2IBDA 2ENNA 3NARA 4OC5A 5HVGA 2QQ8A 3OS2A 3VH9A 4ONUA 3IWGA 2SGPI 1VHOA 2KFDA 2LR8A 4MCQA 4JD6A 2DK5A 4FE4A 1BR1A 2GREA 4FE7A 4PXBA 4XN3A 2VBZA 4NGSA 2M8GX 2WC2A 1ON2A 2H1KA 3PJRA 6PAXA 2TRTA 3BJ7A 1G3YA 2RGVA 1RUOA 2VQCA 3JAMZ 3GTOJ 4QWQA 3WTYC 1MBEA 4OINF 2VI7A 5C44J 4M6VA 3ABTA 1C0WA 4AMLA 4A3IJ 2G7UA 1TWAJ 4YGOA 5HDGA 3G1LA 4I02A 4F8ZA 2O53A 3CJQB 2FX0A 5HLIA 3BCAA 1XX6A 3GLLA 4L8AA 2ME6A 4MJ8A 1YS7A 3BHXA 3TDUC 1SD6A 3UY5A 1KQ8A 4IOCF 3BR1A 5THWA 5M3MJ 1WGXA 2V1DA 1VF9A 4MFKA 1MMAA 2KPMA 2XC7A 1YRNA 2XGDA 1GVJA 4FD7A 2P6FA 2D5VA 4BKXA 5C82A 3GOXA 3BZCA 4F7ZA 5HS9A 1XD7A 5CQEA 1UMQA 1ZARA 4MHYA 1TWCJ 1JTYA 2FRHA 4RB1A 3Q3SA 3B3VA 3KY9A 2M8EA 3H3UA 1AWCA 2E1CA 3RO0A 1T0FC 1Y0UA 1U5TA 2QQ0A 1JUMA 1VQ5I 2AFSA 2B63J 1ZGAA 3WU0A 1FYMA 1FARA 2XKPA 2I3CA 2M1BA 1PDNC 2ANPA 1VQ4I 5FKKA 3HUVA 4BJTA 3SJGA 4CYQA 1BM9A 5FLVA 1YLEA 3HPGA 4UVBA 5DUIA 1XDSA 4XRSA 2GQQA 3LL7A 4YIRX 1D0ZA 2W0TA 2DOFA 2GWRA 2W85A 1RKWA 1PTRA 1HSTA 5LYDA 3M07A 4CCOA 2WAQA 2B9SA 1Z9CA 1ZG5A 1IYLA 2KDOA 5J1YA 2VXZA 2LREA 3WU2C 2K40A 3M8FA 4BNCA 1I6XA 5GPAA 1E2XA 4G7ZF 4E4HA 1NH3A 1JKPC 1AHDP 2QENA 2QKMB 4DJLA 2Z3OA 1EH7A 2EH3A 1TNTA 2K02A 3OWTA 4RMNA 1FOKA 2ZEOA 1OYVI 3CZXA 1MIJA 4HDVA 5DWMA 1MT1A 3V8JA 1XSXA 2Q7SA 5A2QZ 1OZPA 3LD2A 3GZNB 1E0EA 1CSOI 4MY3A 2VODA 5J6XA 1YSJA 3W2VA 3CCLI 1OVOA 4AC0A 3GUXA 2NVQJ 5GCNA 3GYHX 3D66A 3R5BA 4IF5A 3VWBA 2KJBA 1POGA 4EJOA 1HBXG 3S1NJ 1I1SA 4Y13A 1TQMA 4LOCA 3KIOA 3UEYA 2PIYA 4KSIA 2R7UA 2CUZA 2PJPA 3CCJI 1NSLA 1ZG3A 4P44A 2DI3A 1S3JA 3IH3A 2AXLA 2ZFWA 5CVVA 3JAMK 1YRNB 3MZ8A 4HNUA 1ZGJA 1MH3A 3GUDA 5BS6A 5HVQC 2EK5A 1TC3C 3EQLF 3OIOA 1S7OA 4KIGA 3N97A 4NFRA 1IV8A 3CDLA 5BNGA 4W1UA 1OR7A 4A5NA 1TWHJ 2VIXA 4PJJA 2NYXA 4RAGA 5JVGF 4OMZA 1MNEA 2W57A 1W5CC 2IMOA 3JRDA 4IUSA 4P4FA 3CO7C 2DLLA 4XPKA 2P0WA 1SGDI 3TL4X 2H94A 4CYDA 2FIWA 5ERIA 1AKHB 1W5TA 3HB9A 5L3EA 1XJOA 3G3SA 2XAJA 3ZMVA 1Z67A 4MI4A 2DA1A 1Y1BA 2ETHA 4CXFA 5IB9A 3HRSA 3D4UA 4LJZF 1R58A 2LF8A 1PUFB 2M5XA 4M3FA 2DB6A 4QUSA 1CF7A 4MCPA 5LYFA 1CT2I 3R9EA 2Q7BA 1LR8A 4M3DA 2XF5A 4PDKA 1XF8A 2K5CA 1WJCA 4IHMA 2DU9A 2W1OA 2P7CB 2R7TA 4R6TA 2O8XA 4KSFA 5K1YA 2IJLA 3CUQB 3RJPA 5ISVA 1IB1E 1UG0A 3BG6A 3KP2A 1DUXC 2GIVA 1FBUA 5E3NA 1XMKA 2RDPA 4G6DA 4HBLA 5CLSA 1N78A 4ZDOA 1IUYA 1UVFA 3RU0A 2DODA 2GE3A 5HH1A 3ML6A 4ZYGA 1IRZA 2LMDA 5I4MA 2G9WA 1X3ZB 5LYLA 3ZN1A 3JRBA 5AG6A 2XAGA 1OKRA 3FZVA 3LFUA 1CP6A 3RSNA 2E1MB 4FT8A 2PRBA 3MD2A 3R6SA 4ZI6A 3NRVA 1UWYA 2X1EA 3QP5A 1V1HA 4MBUA 2VL8A 2X6YA 2IXSA 2X1CA 1Z5RA 4HNXB 1ZK8A 3OL3A 4HOBA 3H8EA 3E5UA 1BI0A 4NC6A 5FD6A 1LEAA 2JEVA 3FJUA 2ELIA 1Y6IA 2QQBA 2LKSA 1K78A 3GTLJ 5LRGA 3AG4H 3SZGA 3S2HJ 3GYAA 1WJBA 3ZQCA 4KVXA 2ID6A 3LA2A 2D1HA 3IU1A 4B5PA 3BG5A 2JUGA 3F8FA 4CGZA 1B59A 1I1GA 2H27A 4X5KA 1SAXA 3RQ4A 4BBHA 4MY0A 3F72A 4BAYA 2R7OA 1JGSA 2PJAA 4R8HA 1FTTA 2P6EA 3CJTB 1S7FA 4A24A 2IGOA 4M6IA 3OR1C 4BEHA 3A03A 4MQVA 1WFXA 1S7LA 4A2UA 3EY5A 3S9NA 2H8WA 4GRIA 4IHSA 1QGPA 3ZRGA 3NE8A 1DU6A 3GY9A 3PL8A 2KCWA 3FF5A 1SEUA 3KP6A 3T90A 2JA8J 2OOTA 2BXYA 2V26A 1X12A 2B5GA 3RBUA 3T5XA 2IL4A 3DEEA 2EZHA 1F2OA 2OZ6A 3HJEA 1GYTA 4RB0A 1R57A 1K79A 2V77A 4G8XA 1CHOI 3D7GA 1P7JA 2BCOA 1WGTA 1Z8LA 4IEJA 4XKWA 2R7HA 3HH2C 2PJ2A 2P5KA 1VQKI 1H0ZA 4MFLA 1TZLA 2VKEA 4I7HA 4XLCA 1IDYA 4CPAA 2JN6A 1NE9A 1F36A 4X1EA 1EJ9A 4X2TA 1YFHA 1Z21A 2BL1A 2FU4A 3BP8A 3KX2A 1OBRA 2HQYA 4P10A 1FTZA 4ZX9A 4Q5SF 4UFWA 3FXOA 3PSIA 3NWSA 1IOFA 2QQDA 3ULQB 4IQ4A 1S72I 1R22A 1HDDC 3PB6X 2O9LA 3B6AA 1JT6A 3OIPA 1B4AA 1OISA 4IPAA 4FETA 4MEXF 4LB5A 2V9KA 3OSFA 4XRMA 3M4OJ 3S1RJ 2Z3KA 5AGEA 3L2QA 2ROWA 5CVJA 2R7VA 3DBHB 5J8FA 4MEYF 1X1CA 3I53A 1DTDA 3F6VA 4UB6C 3K4JA 3NH8A 1FEXA 2LBFB 1OCZH 3MMYB 3OYBA 2DW4A 3OYEA 3OYIA 3LA3A 3B35A 2SGDI 2D2WA 3COAC 3ZMSA 1N25A 2JSCA 3G4SI 1JE8A 1F43A 3E5QA 1FBSA 2K27A 4L9NA 3KKWA 1ZLJA 3IFEA 2HOEA 2BY0A 2Z2SB 2CUJA 3M1EA 4B1RA 3DQVC 3FKIJ 2Q0OA 1W7PB 5IOYA 2ZNZA 4JBAA 3QU6A 2KT0A 2CQQA 3ROUA 3S3MA 2R7RA 4B4CA 4E7HA 2IRFG 3DKXA 1DP3A 3OXLA 3G6EI 3B02A 5D8LB 3K6GA 4J19A 2CV2A 4LD5A 1V4RA 4I01A 5GP9A 5F08A 4B48A 4CGPA 4HZFA 2VJ5A 2XAQA 1DGRM 1X58A 4W97A 3ZCOA 2J87A 1OYYA 2WAFA 1QPIA 2LDUA 1M8CA 3FBUA 1W4MA 4BGDA 3J7AY 3QP6A 1HF0A 4O6JA 4S04A 3SHPA 1Y56A 3WGHA 2FS5A 4UWIA 3L2RA 2WA0A 1PUAA 3W3CA 5CVIA 4M6GA 1MJAA 1VQMI 2GLJA 1MMGA 2DA5A 1YVOA 3AAFA 1HA8A 2NOGA 3Q0VA 2FE7A 1OCTC 3ABUA 2Z16A 2ATRA 3HDDA 1MD0A 4Y33A 2LNBA 1RETA 2EV0A 4FX0A 4RAZA 2PJ8A 4L5JA 3TFYA 2VASA 4S05A 3T9YA 2JYYA 5J1RA 4AG9A 4ZH4F 1ZAOA 2AHQA 1IICA 2F5VA 2NVUB 2N52A 1UB9A 4KNYA 3CZ6A 3OYKA 1XCVA 2Y75A 1O7FA 5CVRA 3KL9A 3HHHA 4CAWA 4Z6YA 4LG0A 1EKEA 4GXOA 3MWMA 2WB1N 2DO7A 4CZZA 2CWFA 3K9UA 3ZQLA 1KUYA 2D4OA 2MSYA 1U6MA 1H9GA 4XOPA 3WC5A 1I5ZA 1YQAA 3G8WA 1R1VA 3I3LA 4ON0A 1LDKB 4G12A 2XPWA 1R7JA 4HAMA 4N0BA 4NC7A 3V8LA 1BPNA 1MBFA 3OYLA 3VDUA 3OYMA 2X4HA 3AL0C 3ZQHA 3H0DA 4C68A 3E6BA 3FM3A 5CCLA 3QYBA 2KRHA 2DXQA 3TW6A 2Z3LA 4ZYAA 1PP8F 1FT7A 1AUGA 2E5RA 2GOXB 3SXNA 2KRCA 2LKXA 5LHIA 1Y7EA 2DMUA 4LITA 1XCBA 3TOAA 2V53A 1HOMA 1PP7U 2BHZA 3GFJA 1YX5A 4P96A 2Y2ZA 1XMAA 2IT0A 4PK2A 1Y7RA 2NU1I 3K4LA 4XPLA 3BJAA 4WWVA 1T39A 4FD6A 3SGQI 3S16J 4M6HA 2G3TA 1H8LA 4Z2YA 1VTNC 3TX8A 2LYCA 2JXDA 1EA3A 4ASNA 1B8IB 4A30A 1ZELA 4YRHA 2ZJ2A 3BR3A 2ZENA 2EZKA 3FMSA 3HSFA 5FLXK 2KMQA 3I1UA 4NC8A 3KCCA 3GLXA 3HUGB 1V1IA 3A1YA 3IC1A 1SD4A 3A4CA 2F5EA 2L3DA 2IA0A 2M7BA 4RAYA 4BL0B 2W84A 1ZH5A 1TKFA 4UVCA 2RIJA 1UFHA 4KT5C 4CAEA 3ZP5A 2HYFA 2HV2A 1TBQR 4H89A 3GMEA 4KS9A 3EYYA 3P2FA 2E34A 3DEUA 2ENZA 1QSOA 2P7VB 1MMNA 2E60A 2EV5A 3C1DA 1TQPA 3I58A 4WXDA 4ZYDA 2ARPF 1B6AA 3FXQA 1P4AA 1U2WA 3FEEA 3D2PA 1LKXA 4JX4A 1CT4I 3JSPA 2FNPA 3OYDA 1XDUA 3CUQC 4C3HJ 4CRYB 2MBFA 3ZMUA 3OYGA 2XDVA 3ZGKA 2IS6A 4QIWN 4KMUX 2R7XA 5C88A 3ZQFA 5M5YJ 3I4NJ 2JJ7A 1K4TA 2XUBA 4D5FA 3KLNA 4KOTA 3BT9A 4OIQF 4IKFA 3OYFA 5FRMA 1BC8C 5CVUA 2EFOA 2GIZA 2ZXJA 3U21A 3RZDJ 2PJRA 1I39A 4DIQA 3RZAA 2ZMEB 1DE4C 5AIQA 1V55H 3UGLA 4KICA 5IX3A 1D0YA 2LSOA 2WB1A 4AVCA 2NSMA 1X1AA 4Q7AA 1FBQA 1R4MB 4GCVA 3GFMA 3CMAI 3I9SA 1SD5A 3DFGA 3W2WA 4ANJA 3CLOA 2R5ZA 1G4DA 1TXRA 4UF4A 5DWNA 4KDPA 1R71A 2YSRA 4OC4A 3FXUA 3KR4A 2ECCA 4MO7A 2RQQA 1TURA 3WR7A 1S7EA 2DJIA 1FWZA 2KISA 4AVPA 3CO6C 4CGMA 2JWTA 2IQ6A 4LX9A 2K3PA 1Z91A 1VQ9I 2QM3A 4C2UA 3S1MJ 3JTHA 4A69C 1I21A 3HOVJ 1TQIA 2W25A 1J7KA 2CRGA 4MHPA 5G20A 4CGOA 4UB8C 3RKXA 4XONA 5JI6A 1JJ8C 1ULMA 2VE8A 3HOYJ 4MHNA 1KQ9A 2KP6A 1E3HA 1LFBA 5L3GA 2KIUA 4U0WA 2AFWA 1WWZA 3ABLH 5D29A 4NB5A 1R36A 4PGHA 2Z3NA 2DDAA 5J8CA 4XSZF 2Y0SA 1IN5A 4MRIA 1WHUA 2B8TA 5D6EA 2SGFI 1G2HA 3CPAA 4NJRA 4OLLA 4HSTA 4BJ5C 4GFBA 4A3CJ 4MXUA 3BCBA 3DDDA 2XPVA 2GM4A 2HFHA 2QUFA 3GVAA 5C4XJ 3OYJA 2GLOA 2L4MA 3JUWA 3H1CA 3RYRA 2XEGA 5EEAA 3DU6A 3GFLA 2R0QC 2BO9A 3LMSA 4PFPA 5HQ8A 2CQ7A 2W4SA 2A61A 1XS9A 2XROA 2GVIA 5FROA 4RN7A 4HDUA 3ZMZA 4IRIA 1HDUA 2K9NA 3C7JA 3DNSA 3BLNA 3PSFA 4KFCA 2OZGA 1AKHA 3B7IA 4BD9A 4JK1X 3JRHA 5J1QA 1Y9WA 3PGPA 3JW4A 3EDPA 2EZIA 1VQNI 1YIOA 2VJIA 2CV1A 2VL1A 2DTRA 1SMTA 2HI3A 4A0YA 1AA7A 1XTAA 2JA1A 1HC8A 4BDYA 2HU9A 1A2ZA 2PMZA 3A01A 3WODF 3OVOA 1XMTA 1J09A 2HVSA 2OR4A 4OP4A 4A3JJ 4OMEA 2LF7A 3S17J 3GKRA 1G3SA 1STZA 2MGQA 1SGRI 3A02A 4Y49B 1MW7A 5EC4A 3V38A 4M9ZA 4IVNA 2CTCA 1OR7C 1DDNA 4FKDA 1SGEI 2FCKA 5H86A 4HLYA 5DDGA 5L3FA 3CCQI 2P6AC 3FIXA 3FRMA 5JVTA 2GKVA 2B0LA 1CP7A 3B3CA 3FYNA 4QC6A 3LSPA 3T8WA 3F0CA 3S6HA 5L3CA 1D1AA 1CGJI 4BQQA 4AVZA 1K7TA 1KONA 3VARA 3ESWB 4MTDA 1Y8FA 4Y52J 4B6DA 1Y9KA 4Y49C 2NVTJ 3T0YA 3OS1A 1NXUA 2JW6A 4UUTA 5D5VB 2KHMA 3U2RA 2GU2A 1BI1A 1Z6RA 4KN4X 3DR6A 4DZJA 3IJ3A 4IZZA 4R7MA 2BV6A 2QF7A 1U78A 2FVGA 4HX7A 1NUBA 2PRQA 3U1DA 2RB7A 4ENJA 1IXRC 2WSAA 2HDWA 2NMTA 1QSRA 5M5XJ 3CMYA 4EGZA 1HKQA 4U7DA 1PU9A 3G73A 2R93J 4UUSB 3R5AA 4BHCA 3E97A 2AFXA 2L01A 4XLEA 3BR5A 1YG2A 5FKLA 4CA0A 3D5RC 1WRJA 2ABZA 2OUMA 4GGGA 3MEKA 4MIMA 2OTJI 4JWPA 1W7PD 2E1NA 4AB7A 4PCQA 5HXDA 3FISA 2QEXI 4KVOE 1R5GA 5J47A 1NK2P 1WWXA 2KQRA 5E1ZB 5C4JJ 3VSLA 3HIFA 4HQEA 1H89C 1X10A 4L5EA 4LB6B 1M4IA 1IXCA 1HXDA 3HTSB 2ZEPA 1Z7KB 5ELYA 3TGNA 2VE9A 1R43A 2NAZA 3KZYA 4OIRF 1IRFA 3ZR8X 3J81Z 1YMEA 1FAQA 3GO5A 2I79A 2MYSA 3HOWJ 2HOAA 1OCPA 3LQQA 4ITVA 1JUPA 2QJ8A 3HUGA 3IP4B 2LK2A 3HOSA 1IN8A 4E7KA 4KYWA 2AE6A 1Z9UA 3PIOF 3DSBA 5F6FA 2YNCC 1HKSA 3D0SA 4G94A 3A0HC 4XLAA 4II3A 3WTSC 3HPHA 4B8XA 5GPCA 4BE2A 3AFHA 4U5YA 3ZPLA 2EPFA 5K8MA 3GBGA 3K1MA 1OCRH 1ZGWA 4XRFA 2PE3A 2GLFA 3CDXA 2CQKA 5DUKA 3H8GA 4EV0A 3WC6A 4PPZA 1ULKA 3V7RA 2WV0A 2PMZN 2HPIA 3VSKA 3WHBA 2WY8Q 5DTDA 3PO3J 2HZDA 4Y7NJ 1LE8A 4KLVA 4BMHA 2ZJRF 3K2AA 1M1EB 1YW6A 3B8GA 3PEIA 3W6SA 1MJ9A 2F5FA 2O3FA 4JCVE 2FQ4A 5GTHC 2LB7A 2UV1A 1MDMA 1QU3A 4P4BA 3CQZJ 2KL4A 1CJWA 1XX5A 2PN6A 3B73A 3C26A 1R6RA 3FHNA 2WBMA 3FSXA 2G3AA 3ZMDA 1SFKA 3I9V2 4IOAF 1KZFA 3QNVA 2F8HA 2D1VA 3BG7A 2O5RA 4S0HB 5AG7A 4E8OA 1H9TA 1KU3A 2V6EA 5HS8A 2JBKA 4D9JA 3I4PA 5DD8A 2ZEHA 2WV1A 2KKOA 1L3LA 5F27A 2ZXVA 5EG0B 4A33A 4RUHA 5K8NA 3H4QA 4P4DA 2ZSHB 3CT9A 2JLMA 1U5KA 2OC6A 1YITI 4F52A 1WJ5A 4A3EJ 1M4LA 4P6YA 3FX3A 1BOBA 1ULNA 2CV0A 2PFBA 3M3YJ 3HYIA 1CGPA 1PYVA 1ZN2A 4JX5A 3SFZA 4HF2A 1M44A 3ERMA 2H6CA 1OFCX 5BWAB 3I64A 4KUBA 5JLWA 3EC4A 1ULYA 5KNLA 2QLZA 2PSWA 1WK4A 4OMYA 2B58A 2LUYA 2NVYJ 3BZ6A 3GTJJ 1Y1WJ 2ZXIA 3H3ZA 1H8AC 1ITYA 1V0CA 2DF5A 2WPWA 4ORFA 3VE5A 1L0CA 2VC0A 3TKYA 2E5ZA 3OYCA 5EDNA 3ECHA 1Z7UA 3PUBA 4GYGA 3P9CA 4CSWA 4E7ZA 3CCSI 2N17A 2VEZA 2AS5F 5F0FA 3CXSA 1JJ6C 4HSRA 2L9NA 5ICGA 2LH9A 2ZBKA 3TJQA 1IY7A 4XIDA 3LSRA 4B13A 2X52A 3C2HA 5JPHA 3JRGA 1XEBA 4OADA 1W3SA 3WTVC 3DP7A 5F48A 2VBWA 3H0GJ 2J8RA 2BEIA 5EMIA 2IS4A 2K9LA 4N4OB 1CT0I 1OJLA 1GV2A 2OZHA 3OYAA 2EBJA 4XSXF 3HOUJ 4CDGA 2PR8A 5H84A 3VOEA 1DPUA 5IB0A 2Z5UA 2M3AA 3E0KA 4B14A 3W6JB 2WCYA 3QWPA 1M4GA 5DS0A 1IN4A 3NH4A 2DMQA 3R96A 2L8EA 1IGBA 2CS3A 2GXBA 3HOZJ 2X48A 3KGQA 3BY6A 1T56A 3G3ZA 5FLXZ 2JDDA 3HLPA 5E96A 3WGGA 5K7HA 3ERED 4J01A 2L9VA 2POKA 4QPOA 2W00A 1BJZA 1J5YA 2CG4A 3K70D 2CFOA 2DYSH 2QKLB 2GXAA 2PR1A 4DUKA 2HYJA 3L1PA 2MC4A 2O28A 1MBHA 4FWUA 3WTUC 3CXQA 4XKVA 1IO2A 2REFA 4H6UA 4G9YA 3IWWA 3CD6I 1VNDA 2CSOA 3E5XA 4KOSA 3DLAA 4CUGA 2CFXA 1D1CA 2BGCA 3DXJF 5CKTA 3JREA 1DU0A 2VOOA 1IIDA 1X3WB 4HV6A 1VQLI 2PJBA 1MKMA 3R95A 3H92A 2R5YB 4V2GA 2ZSIB 4E2AA 3SJXA 1KU2A 2R92J 4EM0B 2VBQA 3R0AA 2DKVA 2DPDA 5KCMA 1UG2A 1YQEA 2HKOA 4UCPA 3DKYA 3LSTA 2P5LC 1QMUA 1T2KA 1CF7B 2BE5F 3PBEA 5I0CA 1BN5A 4R79A 3E0JB 4CZCA 1TBRR 2VT3A 3E7LA 5E18F 2ICWG 3PFOA 2DPSA 1X1DA 4IL6C 1Y0YA 3QODA 4EQQA 4UUVA 1ORKA 1TT0A 4B5OA 2V1XA 2Y0MA 2F4IA 5D5XB 3UNGC 4XICA 4C7IA 1KU9A 4ENMA 1EE3P 3JCUC 3EO4A 1W0TA 1ZTRA 1WQ2A 4UXIA 3CC2I 3HSRA 5E3LA 3P9KA 3CDHA 3F22A 3PQJA 1VQOI 4I6ZA 4A3FJ 3AG3H 2O8KA 1IOIA 5JLXA 4BQNA 3VEPA 2DTZA 2PLYA 2QZ8A 4CCKA 1LR7A 1IU8A 4MCSA 4NGRA 3AG1H 3O3KA 1SGPI 3P9IA 2CH0A 4DYQA 2NU0I 4IXAA 4OU0A 3KQXA 2YUSA 1FYKA 2PJ4A 3G71I 4EVIA 3HOTA 4MFQA 4BUPA 3JSOA 4K3NA 4KIFA 4A6EA 2F2EA 3WTZA 2FQ3A 5KAFC 3BROA 2L9RA 1J9IA 3N7ZA 1T8IA 3UKGA 4WK8F 4KIBA 2ZMEC 3WGIA 1QPMA 3F8BA 1WJEA 5IT9K 2PDOA 3UR3C 4P4JA 1YX3A 3BR6A 3L2WA 2FL4A 2ZFUA 3PIPF 1XSVA 1IYKA 5E79C 1Y39A 4XNHC 3LNQA 2JBJA 4BINA 2FSWA 2WWYA 3TO6A 3NA6A 2KIFA 3SDBA 3D67A 2F3CI 3S9MA 1G3WA 2TDXA 4ZYHA 4UV9A 1FJLA 4NBQA 2I10A 3K7AJ 2AO9A 4L9VA 4WXCA 1KZHA 4ZY0A 5F09A 5J3LA 2WUUA 1VIXA 1R4NB 2CO5A 3IL2A 1PJUA 3OOPA 5K8PA 4RAFA 4BBSJ 5A28A 3SDGA 3R60A 1FMWA 2JVGA 1PCAA 1K7AA 3RKWA 5E3QA 3S1QJ 1LOKA 5ILUA 4HA8A 1LQ1A 1Q7LA 1GHCA 4BYYA 3OYHA 3DCFA 3KR5A 3TP3A 2ZW7A 3MN2A 2C6PA 1JWQA 2DMTA 3KYDB 4DZPA 1B72A 2MD5A 1WZ2A 3H5RA 3FK7A 3HG9A 4PSWA 3IWZA 1WKMA 3IGRA 3QPLA 4B6ZA 2G0BA 4UY8I 2HTSA 2MLGA 3SFIA 2V1UA 1P7IA 1XGNA 1Y0RA 2CUFA 4AG7A 1ETWA 2ZEFA 3S93A 2AJ6A 4DQ2A 1LNWA 2CMPA 3IUOA 1BAVA 1BIAA 4MHZA 1QVUA 2RNJA 1M1DA 3ZQGA 4R76A 2IGMA 4HQMA 3OSGA 4NGTA 1MDMB 1Y8RB 4ZGYB 3JRAA 3IEHA 1FP2A 3W6KB 3OR2C 1GUUA 2EWBA 3R5DA 2DOAA 3FXLA 3J7AO 2ZEEA 5FFZA 1B6BA 2CQXA 2VC1A 4YRVA 4QTRA 4OC2A 2DJNA 3ASNH 4B44A 3TOBA 4C3JJ 1QSTA 3BPXA 2GANA 4MFDA 2XRCA 2Q1ZB 4RDUA 3A01B 2EJRA 2NS0A 3GB0A 2V1NA 2ARHA 5LRKA 4HNYB 2E19A 4OC1A 1KGSA 3RCOA 2HQRA 5LRRA 4CAVA 2W7NA 1DP7P 2NNYA 3ABMH 3MAJA 2O61A 2H5MA 1VZ0A 1P0HA 4E7IA 1U5TC 2ECBA 2X7BA 1ERDA 3CCEI 1FOWA 1QQIA 2E7XA 4I09A 4UXNA 7WGAA 2VXKA 3VYTB 4KOWA 3Q5FA 1YJ9I 1ACIA 5CBMA 1TIQA 2D4PA 5GAGJ 1BW5A 3KHZA 1Z0XA 2AQEA 1B9MA 2CW0F 4MGRA 4ZDLA 2E1MC 5ILSA 1WCMJ 1ZKGA 5FUYA 4NCZA 4YWYA 1CPXA 2RREA 4E1PA 3G1MA 4XLNF 3H9GA 2DFIA 1X1PA 2HUZA 1S3ZA 3R9FA 2VI6A 1OMIA 2AFOA 4Q47A 3WABA 3RYPA 4UCMA 4A3GJ 1Z2IA 2EA2A 2KMOA 3VATA 1HQCA 3LSJA 3LSGA 2OZUA 1QBJA 2HQ5A 2Q2EB 1A36A 2LOOA 2Z3MA 1W0UA 3GF2A 1S5KA 2EILH 4E70A 3SJMA 2CWEA 3DEWA 2EFPA 2GAUA 1O4XA 2C27A 5IP9J 1CBXA 1AN1I 5DD4A 5BQTA 3OWCA 1RIOH 5B5EC 2FBKA 2OCEA 5GAHJ 1ZLIA 4Q38A 2L7ZA 3MZYA 3GXOA 3VPRA 5IYDJ 1P4WA 2O7OA 3PB4X 2XF6A 4F92B 4K2EA 1WI3A 3O2PE 1VQ8I 1P9ZA 1S7NA 2ID3A 4GI3C 2EB7A 4G1PA 4I2OA 2I5UA 1VHEA 1TL8A 4MFJA 1PJRA 4FASD 4UWJA 1ETVA 2EA4A 2CNMA 2OH1A 3QYFA 1PPFI 2DAOA 4MPIA 4WWCA 1ZLKA 2ODDA 4CS0B 5F1RA 2UWMA 1YYVA 3HC7A 4QLCU 1WKXA 2LFBA 3K4CA 2ERWA 3UFFA 1V5GA 2OB0A 3PB7X 2IVMA 2M2EA 1XPXA 2FF4A 2FBIA 3MKZA 2FA5A 2Q51A 2AFZA 2H6BA 1WGCA 1U6GA 1ARLA 4KOYA 2TCTA 3OS0A 1K7VA 2QA4I 1SFOJ 1X74A 3ELKA 3J81K 4U0YA 2W82A 2ZMEA 1TBXA 4AWXB 3DBRB 3WTTC 1LRZA 4LG3A 4KOUA 2JDCA 2OQRA 3PM1A 3W2AA 2K9QA 2DEAA 2MD0A 4NGNA 4ENKA 2VN2A 1LFPA 1P4NA 1IDZA 2QMLA 1CM0A 5EZGA 1UHMA 3DV8A 4RA2A 3TQNA 1TF9A 3GTMJ 3S2WA 5D4RA 2VPLA 2A68F 4DYCA 4CYCA 3E1SA 1Q1HA 4KOXA 2HR3A 3BR2A 4BQOA 4E7LA 1HCRA 3S8PA 5LD2C 1H88C 2V9VA 2WGCA 2EK9A 2FXAA 1SANA 1FY7A 2GBYA 2E2IJ 4AXVA 4BH9A 3K4NA 4XK4A 1BR4A 3BTJA 3CCYA 1HLVA 4KVME 1FPQA 1N77A 2LC2A 5D5UB 3SI2A 3BJOA 2IW5A 5HODA 4KJZA 1TWGJ 2HDCA 3LSMA 5H6RA 2DXIA 4Z65A 2PX9A 1YW8A 4YFXF 3QRFF 4RGRA 3BLYA 5KK1A 4Y4RA 1U8RA 5CJ9A 3FVLA 4NF1A 1YREA 4PV6A 4UV8A 2P81A 5TJJA 2CJSC 5JHUA 4NHJA 3BI0A 3NAUA 2E2JJ 2DQLA 2AQFA 3DLJA 2M30A 4M3SA 3T8RA 5F0CA 1UHSA 3HOXJ 2BUSA 1TTYA 4M73A 2JRTA 1MSEC 4MTEA 4KUMA 3SI1A 3TTHA 3M8JA 1IAWA 1MGTA 4XLFA 1NG7A 2B3VA 2XIGA 3PDNA 1D8KA 3UOEA 4CAXA 3FXRA 2R7ZJ 3D7FA 1ETYA 5HI7A 1Z7LA 4ZTJA 5IPAA 2E73A 3B3WA 3NFZA 4H6ZA 2OAZA 2XB0X 5G1ZA 2Z33A 1U3EM 1IRGA 2A6EF 3K2ZA 4ZC3A 1F9NA 3RQIA 5JHFA 5EF6A 5E17F 1GXPA 2BY2A 2V8VA 4A95A 4X6AJ 4UHTA 2WTEA 4Y15A 2BYVE 3GTGJ 1XBUA 5D6FA 3TBIA 2H8RA 1DGWY 3LA7A 1ZR2A 2UXXA 3SZPA 1EH6A 1G6NA 3DPLC 2JZYA 3VB2A 5HLTA 3AKZA 4NGPA 2NU3I 5EGOB 4G7OF 2A6TA 1MMDA 2F4OB 4AYBN 3REOA 1MK4A 4LQ6A 4XPDC 4HPSA 4A93J 4ZBGA 2VB6A 4HW0A 3PNTA 2E36A 2EIKH 3LFKA 1TIHA 1K6OA 1FNNA 4C2TA 2EO8A 1Z8TA 4P4IA 4DGWB 1S9HA 4MHDA 1MJBA 1Q2YA 3V4GA 3JTGA 2ELKA 2CUEA 3KYLA 2X6OA 4C2MJ 2KMPA 2IEKA 1JI8A 2UVOA 1RXTA 2R1IA 3ISPA 3DBLB 4PXDA 3HHGA 2L2OA 3M7GA 2DIPA 4BE0A 3TO7A 1YJNI 1TBNA 3FXMA 3PO2J 4M3BA 4EJWA 4TWEA 4C2YA 2HDDA 4F0YA 3EUHC 5ILVA 1DPRA 4H4KC 4D7NA 3UGDA 1IV6A 1UAAA 1LDJA 4MHGA 4AU7A 8CPAA 5ICCA 3D00A 3E59A 1X1BA 5EG0A 3OXFA 4A3DJ 2LY9A 2OQGA 2HQAA 3BTCA 3LSIA 1X4PA 1NHAA 4AUXA 2XGCA 2HTJA 2YUUA 2JMWA 3H5NA 2QSHX 1UELB 1YK3A 2XSJC 1RFHA 1LFWA 2IJZA 2ZEMA 4FCYA 2YQPA 2LKPA 5AONA 4EGYA 2VBYA 4G7HF 3RI4A 4CGLA 3DTIA 3J7YJ 1Y1CA 4U0VA 3V7SA 2PG4A 3ZQ7A 2OA4A 4XQFA 5BPIA 4A3LJ 3H8FA 5B1AH 3MKLA 2KCXA 3IRQA 5HS7A 2GKTI 5HMNA 4PQAA 5IYBJ 1Y1VJ 4EJVA 2ZEDA 2JRMA 1TWFJ 3S3NA 4R57A 2EFWA 3GIUA 4N9IA 1SVLA 9ANTA 3I3GA 5DM7F 3N4MA 3KP7A 2B0UC 1JKOC 3W91A 4FAIA 2DA7A 4WX9A 3OIQA 2GKRI 2ME0A 4IHWA 2QQCA 3JRCA 4L0ZB 3TC8A 4RB3C 1OPCA 2NRAC 4OC3A 1YW4A 3WC7A 2KIQA 3HSEA 3H35A 3A0BC 4B3AA 3FMQA 2YU9J 3GZ6A 1R5HA 2BW3A 4AIDA 3QYEA 1JKRC 1O3RA 5CCMA 1X3UA 3SHFA 2CWHA 2LEOA 4PGGA 4TNUA 5KAIC 5E8GA 1FZPB 2Y9YA 4BDZA 4OVOA 3OXGA 1S60A 2XKOA 2RV8A 2PC1A 3CLQA 2NS7A 4UVAA 3T1BA 4V19K 1UCRA 3RKQA 2CU7A 3PNVA 4NQWA 1O3QA 2IS1A 1LPQA 1Q1VA 4E1RA 2B4DB 4NJQA 4ZY1A 2XGXA 3D68A 4M9XA 3V7CA 2X6XA 5JR3A 2F6CA 2RQPA 1LDDA 2JPCA 2ELHA 2WAQN 3MFKA 3IAM2 5KTCA 1UZCA 3W6VA 3R5CA 3C2BA 3R9GA 4BACA 2HWVA 1WPKA 1IF1A 2OD1A 2P6GA 5E3PA 2FOWA 4Y17A 5DCFA 2RKHA 4F55A 4UUSA 4P9UA 2CNTA 3RAMA 3IH2A 4WJBA 2GZWA 4ETSA 5BMZA 2E5NA 3KASA 5D4SA 1I3QJ 1ZRFA 3E6MA 4MMOA 2R4GA 5F49A 3T8TA 1BC7C 3FEDA 4BXFA 4C30A 3BQYA 2YNCA 3RNZA 1FP1D 4UBRA 1WH5A 3IH4A 2Y0SN 2DPTA 2BSWA 2V8GA 1TW2A 4EM2A 5J4YA 3PB8X 3R61A 4ESFA 4LQGA 3GEZA 4B5PB 4JYKA 4L0YB 1YX0A 4KMFA 3GLJA 2V1CA 2XPUA 1TF8A 4RM2A 2CQNA 2DDBA 3S6FA 2QQEA 1XE4A 4A31A 1RR7A 1M4DA 3R4KA 4UXJA 4QSHA 3S15J 1XGMA 4L9JA 4HEA2 2E7WA 1XC5A 4HX8A 1HJAI 1ENHA 1JUSA 1YE9A 1YS6A 1Z6TA 4KA4A 2JA5J 3AL0B 5FRNA 1I6HJ 2R7QA 2PJ3A 4YFKF 3I4MJ 3OYNA 1UUCA 4BBRJ 2STWA 1HDLA 2OV7A 1YHQI 3F8KA 1I12A 5EZHA 2XF7A 1A31A 1Z05A 3I59B 2L02A 3KZZA 2J9RA 2YGWA 1ETQA 3HEFA 3QB8A 1MSFC 1OYWA 3HXLA 4XM3A 2Q2EA 3GW2A 2LLKA 3GZ5A 3V8KA 4UEEA 4B43A 4HNVA 3UGIA 3HKZN 4A3BJ 2Z9OA 3FMRA 3RPQA 2IA2A 4IQJA 1R1TA 3VYUB 2F7VA 3DR8A 2Q0YA 4H0EA 3M9AA 1P9QC 3WTXC 2X9DA 4OAZA 4IF4A 1QVTA 2ZW5A 3QAYA 2DMNA 3S3OA 1Z4EA 2CWGA 2FNAA 5J4VA 2QSGX 2MC3A 1P92A 4UA3A 4LLGF 2WAEA 1YGHA 3CC7I 4R9MA 2A20A 2F5DA 3IO1A 3CESA 3CXPA 2F4MB 2DPUA 4LIUA 3L9FA 1I1DA 1BR2A 3D2MA 3L2VA 4AM3A 1LEBA 1CPSA 2ZEGA 2LD5A 4M3GA 4I0BA 3C3WA 1SVOA 2YX7A 2XAFA 1CE3A 2NVXJ 2RAEA 1RKTA 2FUG2 2BOLA 5FKOA 1BO4A 2XHKA 2F5CA 1V3FA 4N4NB 2LVSA 4A3MJ 4U88A 4KUAA 3CCRI 5AG5A 5LLQA 3FK6A 5FB2A 2O6GE 4X3RA 4B12A 2DCEA 1MBJA 3IIBA 4UIAA 4GDFA 4BEHB 2DFEA 2Q4YA 5CQGA 1VI0A 1EV7A 1G59A 3LSHA 6CPAA 5EJCA 2Z1DA 3IKVA 1ZG7A 1XIXA 3SI0A 4EWTA 4CO8A 1D8JA 1QZYA 2YU3A 2VJ4A 1E3PA 5KHDA 3Q0UA 3H5ZA 5HVHA 3ASOH 1S7AA 4XKBA 1RUNA 1TKHA 2RNGA 2Z3YA 3NH5A 4KITB 3PFEA 4HNWB 2EUIA 1JHHA 4R8FA 2RFHA 1HKTA 1U8BA 3KZIC 3SGBI 2ZOGA 1E3OC 2VT2A 4OKOA 3VWEA 5J1UA 4IX7A 3G1OA 3C2GA 4XLPF 4M85A 4CCMA 2UZ3A 4EMEA 4OAYA 3ECOA 2WY7Q 2W48A 3FC3A 1QSNA 1LAMA 2EK8A 1J4JA 1BI3A 3K10A 5DV5A 3VWDA 1USTA 3CF5F 3ABKH 4BU2A 4W9YA 1S20A 1K83J 1ZRCA 1AU7A 2EIMH 4E7SA 4A37A 2OF7A 2EV6A 1JGGA 2YNEA 1QZEA 2SGEI 3CTAA 2K4JA 1A6IA 1IXSB 5TGTA 1FLIA 2CGPA 2V7FA 5E3RA 1WVRA 5B66C 3IWEA 3TCVA 1ODDA 3GFIA 1IJWC 3F21A 2VQHA 4FBEA 1ZQ3P 2VPRA 2DFFA 3K2KA 4M71A 3GTPJ 4RGXA 1KUVA 3GTKJ 9WGAA 3SJFA 1RZ4A 1UHAA 5AIPA 5KTAA 3RPUA 2KIMA 4QBJA 3D3SA 5GTIC 1B1BA 1GXQA 2L54A 2BEOA 2DA6A 4XNFA 4F3QA 1VQ7I 2PVWA 4OIPF 3QPSA 4P9FA 2MG4A 2BZTA 2IGKA 3FIWA 4XMYA 5H2FC 1KMAA 4M6YA 3ISXA 3KYCB 2E2HJ 2K86A 5F46A 4HF1A 2V6CA 1PUFA 1LVKA 1YI2I 2ISZA 3R1KA 2UXNA 4XORA 1IW7F 2G0EA 3WHCA 2UZKA 3H9QA 1BL0A 1IY5A 4ESBA 2JA7J 3EUAA 2C6YA 5CPAA 5EBVA 2P6TA 1F2PA 3MQ0A 1RTQA 1XFOA 5A27A 4LUAA 2ZB9A 2V1CC 2F5IA 1ZLHA 4ZZDA 3ZJ0A 1GDTA 1USSA 2Y30A 3J80Z 2X0LA 2YNDA 4HYEA 3O6BB 4QVTA 2Y69H 3BDDA 1IC8A 5JH9A 1Q2CA 4L89A 3V8IA 2DBBA 3KP3A 2Z99A 2PBIA 4KZTA 3G2BA 5EEHA 4KOVA 4XBFA 2MA3A 2R7WA 2LTPA 4X8IA 2V8DA 3FSYA 5DM6F 1WJAA 1HW1A 3FXJA 1S8NA 1BMOA 1AMPA 2RC4A 4DJAA 1TW3A 1PTQA 3FKJA 1XMBA 2DT7B 2XAUA 5EEGA 3I54A 4KORA 2ZCWA 2ZELA 3S6GA 4LLNA 3F6OA 3DTEA 1D0XA 1ZRDA 1BJAA 3K9TA 2FBHA 4PXCA 3F9KA 2P4WA 4LK0F 4MLOA 3K0LA 1VQ6I 3V7ZA 3CUOA 2NNNA 4NUBA 2ODFA 2H1LA 1J2XA 5IY5H 2A5WA 5LEJA 1QHGA 5G21A 3C18A 2QWWA 1Y0NA 1XG1A 1HSJA 2R3SA 2DT5A 4E6KG 1B72B 3F3XA 1A5JA 2J8MA 3CMMA 1HDQA 1KWMA 5TISC 2Z10A 5K5OA 3N5FA 1XMXA 4CYPA 1X2MA 2FEZA 1BIBA 2YX4A 3E6CC 2DN0A 4ZYEA 1YU6C 3ZQIA 3E6DA 2VKHA 4I98B 4PK4A 3ZN0A 1N75A 4CCNA 1XB4A 2A69F 1Z8WA 2MH2A 4BHBA 1F57A 4OIDA 3BPVA 4EATA 1J59A 3TW7A 3L2UA 2ORVA 4PXEA 4WXHA 1LR9A 5F04A 3SEQA 1MNMC 2LY2A 1DS2I 1K7UA 3I59A 2PVVA 4NXYA 4NNJA 1R5ID 2N1AB
chains in the Genus database with same CATH topology
2J5OA 2M87A 3VODA 3KLOA 3EETA 4A0ZA 2O03A 1LVAA 3F8MA 4EJUA 4P5OA 3FNCA 2GA2A 3LODA 3I5UA 4GS4A 3LQRA 3MZHA 4ESJA 3DPTA 5DCMA 4HLXA 4AIKA 2FIAA 2QVOA 1SFUA 4OIOF 1VKCA 4P55A 5IV0A 3P7NA 2Q44A 4NSQA 3QPHA 5HOOA 4EJTA 2JPBA 1D5VA 2J8NA 2K7LA 3BJ8A 2Y48A 5E1WA 1I27A 3IU2A 1OYIA 2BBYA 4U7BA 2ZPAA 1H0MA 1KUXA 2QECA 4HKFA 4YG2F 1TNSA 3BWGA 4L5IA 1T38A 4RGUA 2OU2A 1XN7A 1WSUA 3KP5A 3GWZA 3HTUA 4DNCA 1PUEE 3W6XA 3RDIA 2HEOA 3JVNA 4R87A 1MZBA 2VZZA 5LBQA 3IC7A 4FHTA 1R23A 2IPQX 4RGSA 3BJ6A 1ZREA 2W24A 4R3KA 1ZO0A 1D3YA 2VOPA 4CAFA 2COMA 3KEQA 4RS2A 1XGOA 4HV5A 1SFXA 5G22A 4TV7A 2PMUA 4GYIA 4YFJA 4YIFA 4YFNF 3L00A 1F5TA 3OV8A 3R0JA 5IT9Z 3GX4X 4JQFA 2ZO4A 3QAHA 4A2ZA 4IRHA 2XVCA 4LFUA 2HS5A 3ZZIA 3P2HA 4EM1A 5DCMB 4O3MA 3L2CA 1K78B 1ZHFA 3MGDA 2XV4S 4AIHA 5FO5A 5CYVA 3PP9A 4WF2A 1O7LA 3IKTA 5FVJA 1T6SA 1KQ0A 2DQRA 1QZZA 3FM5A 2PI0A 4L9TA 1FC3A 4ZZLA 1FSEA 3BOQA 4ENNA 2MLKA 1QO0D 1GHEA 3CUQA 5ED4A 2K5TA 2PQ8A 2FSRA 4R1HA 1J0RA 1J75A 1YTYA 4BQAA 3K1NA 4OOIA 2ZW6A 4UNOA 1RI7A 4MFPA 1IN7A 1UHWA 1B87A 5TRDA 4IHTA 4I49A 4A6DA 2WPXA 3NQOA 3RTRA 2EWNA 2HGCA 2QQAA 4YIIA 1REPC 2HYGD 1JHFA 3M8EA 5LHGA 1N71A 4M6XA 1IZ1A 4KN7X 4A5MA 5HLHA 5JQ4A 1YO5C 3SXOA 5FD5A 1XSDA 1TLHB 2VQYA 5D8KB 5KVRA 1XGSA 3VFZA 2PMHA 3A9LA 2ACJA 4UFVA 1HW5A 1BI2A 4FX4A 2FOKA 4MQ9F 5BOXA 2A6HF 3D5LA 2REEA 5A2QK 2Q04A 3KFWX 4IJAA 2IA1A 1VHSA 2QBYA 2KJCA 2B4BA 3K69A 2QYOA 3SZTA 4OAEA