4UXJA

Leishmania major thymidine kinase in complex with dttp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
167
Chain Sequence
RGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSDQLMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSKQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structural and Kinetic Characterization of Thymidine Kinase from Leishmania Major.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 47
structure length 167
sequence length 180
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4uxjA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4uxjA01
1E0SA 5TARA 1CLUA 1Q3HA 1C1YA 3KB1A 2CDNA 4QG7A 2BIFA 2CEAA 1BYIA 3AQ4A 2QPAA 1IN5A 2WJIA 4KAXA 1P75A 621PA 4TT3A 2J5XA 1KY3A 4Q7KA 2GVZC 3K0SA 1HUQA 3U44B 1CTQA 3DKVA 2K5UA 5DI3A 2NGRA 3KFXA 4WBSA 1OKKD 1SVOA 1W0JA 2MMCA 4M1KA 4DB4A 3LX5A 3HJNA 1G64A 1KSGA 2IYSA 3CR8A 3L8YA 2WPDA 3C4JA 4CEIA 2DB6A 1K5GA 3EAQA 3RS0A 4D26A 4JLAA 2P0EA 1SXJE 2WSMA 1GOTA 1N6NA 1UDXA 1OIWA 2GKSA 4IFEA 2V1UA 2F1IA 4CEIB 4Z8YA 4AURA 3KXIA 2C98A 1XB2A 3LA6A 5KSOA 4M9ZA 2ZRBA 2XOKA 4PSVA 3UK6A 4W7SA 2V3CC 2WV9A 1U90A 2ZI4A 3GJ4A 2NO7A 5FL3A 1CR0A 1OFTA 3QIAA 5JJIA 4HLQB 3WYGA 3LBHA 2QE7A 4P31A 3ZIAA 2O8CA 3GJ6A 1WA5A 3ZDQA 5FPKA 4BLQA 2GESA 2RAPA 3M4YA 5CYOA 2ZRIA 4KBFA 4KSBA 2W6JD 5KPJA 2C78A 1E0JA 2G0NA 1CJTC 3TBKA 4DCUA 5BXQC 1ZUNB 2OUKA 5GJBA 5DGXA 1CRPA 2OCAA 1HQCA 3AVTA 4WOPA 2VSFA 4IDPA 3NH6A 1RC8A 2GCPA 1RJ9B 5JS8A 1S1CA 2ODNA 1CJUC 3SOPA 1C4OA 1V43A 3AVVA 3L0OA 1FX0B 2KBEA 5G41A 2WJJA 1SVKA 2ZS7A 3IPXA 1SXJC 1RPZA 4KBGA 4N0EA 2R65A 2YC4C 4ZCMA 1XBTA 1COWA 3H84A 2V6IA 2ZU0C 1ZW6A 3P27A 1PUIA 2HJGA 2F55A 5FOWA 4DCSA 4LV6A 4IOMA 1V5WA 2JIZD 1P61B 5CJPA 4AYXA 2LWIA 3A4NA 2QA5A 4RD4A 4WA7A 2XZPA 4CZ2A 4QJ3A 4CT4B 3SHWA 1DO0A 3MSXA 1J8MF 2RHMA 1CEEA 2V4ZA 2F3TA 3LFUA 3ND8A 2FV8A 4NBSA 2ZIAA 5KSPA 3WXMA 2IWRA 1UKVY 2WSSD 4URWR 3LXXA 1E2IA 4PSAA 1JAIA 1KJYA 2OZEA 4Q1FA 2ZTSA 3VHXA 3IEUA 4ESVA 4LYJA 2C9YA 2O0KA 2O8EB 1Z83A 3SJBA 2YC2C 1TL7C 5DN6D 4OQLA 4W5WA 1UBGA 2CXXA 4Q9KA 1JALA 1QHGA 3C41J 2P67A 3VKHA 5CM9C 3PIRA 4MGZR 1DG1G 2GEVA 1G41A 2BBSA 4MRVA 4TYWA 1SXJD 1ZRHA 4PTLA 4Y0VA 1JJ7A 1TEVA 1Z0IA 1E94E 1ZUHA 4HDCA 3K0CA 1G21E 2RGXA 4I1UA 1ZYUA 1J8YF 1NVUQ 1R0YA 4MYUA 4QHYA 4EPRA 4UNSA 2ZS8A 3GLHB 3U5ZB 1KO4A 4XD7A 2EYQA 4CVNA 1DARA 4FMDB 1BMFD 4M4SA 1UFQA 2A5DA 2G88A 2MSEB 4EQ6A 1EFHA 1M6NA 1GL6A 4RZUA 4UKDA 1X86B 1I4LD 1KO7A 4FMCB 5IRCD 821PA 1A82A 1IXRC 3TQCA 4EQ6B 1GKYA 3FHTA 4S35A 2WZQA 5FOUA 5IK2D 1EWRA 4ZKEA 1G7CA 1P2TA 4X8MA 5BWMA 1NI3A 1QVAA 2J7PA 4M8NE 5HR5A 4NMMA 3PUVA 3KQLA 5FI1B 3HYRA 1DAMA 1OHHA 2WWGA 1ZM3A 1QHYA 2X1VA 4TMVA 3BIFA 2QGZA 1DADA 4TL9A 5P21A 3OEHD 5EE0A 1S96A 5K8UA 2ORIA 4URZR 1G5PA 2R6FA 1P2UA 3GMTA 4BFVA 5GVRA 2OE2A 5EP3A 2QMUA 2OESA 1F2UA 2AK3A 3GLIE 4C4PA 2EYUA 2BWJA 2GAOA 2IC5A 2IHYA 3CRRA 2BMDA 2QPTA 3F3YA 4IVRA 1FMLA 3UFFA 2GXSA 2JDIA 2OBMA 3B7GA 1F2UB 3X1YA 1KBFA 3OFNA 2G1JA 5EUQB 5E7MA 2A3RA 2GHIA 2Q21A 4LBZA 3NBZC 2JJ2D 1BO6A 4A0RA 1T4GA 4II7A 2WBLC 1GSIA 4F91B 3LXRA 121PA 2JJ1D 1KK1A 1KI7A 5TXGA 1N5KA 2QT0A 1J70A 2ZI5A 4DCTA 2CE7A 3TVDA 5FPHA 1SVSA 1U98A 2Q9CA 3OZXA 4M9XA 4P4SB 2QTHA 3EWAA 1WXQA 1US8B 4TYYA 4R9UC 3X1DA 3E1SA 2ZI3A 1CULC 3DOEA 3QPWA 5EXTA 2KBFA 2C99A 1GUAA 1YRAA 2HT6A 1E2GA 4GOJA 1E0AA 4BZQA 1G16A 3KJHA 5H1YA 2QG6A 4B75A 1AS0A 3X1WA 2J0UA 1F6BA 2EFHB 3QQ5A 1GRNA 4Q1BA 4ARZA 3D6TB 2G77B 2XTZA 2LKCA 3UMRA 4F7WA 4YDSA 1PLJA 1RFLA 1YZKA 4QJ4A 3RS3A 3W6PA 1QHSA 2PCLA 1FMJA 1R7RA 2Q9AA 5TY0A 4L9MA 2PJZA 2XX3A 3M6AA 4IXNA 1KNQA 4A1FA 2PX0A 1KI6A 1T8UA 2J0QA 1GRRA 4MQBA 1DE0A 4G0NA 1U8YA 2IYZA 3B13B 3N2EA 1A2BA 3FHOA 1TADA 4A8JA 1KI6B 2PCJA 5CYPA 1L8QA 3SFZA 2ZJZA 2QTFA 3AKYA 4FINA 3X2SA 4YXWD 1Q44A 4MUBA 1E2PA 1CP2A 3UWKA 3LQRA 2DFNA 2FGKA 1A4RA 1JXMA 1W0KD 4YMWA 4D80A 3O8DA 2HEIA 1M74A 1JQLB 4B3FX 4RD0A 1CR4A 2BEKA 4PO1A 2XB2A 1N6RA 4RZ3A 4IOJA 4AD8A 3K0FB 1GKUB 4BFYA 3SHFA 5ELXA 2F1HA 3UGDA 4LJYA 3UGLA 2WWHA 4V0ME 2JEOA 1Z2CA 4DLSA 2GXAA 2IT1A 2NO9A 5EE5B 4B43A 1Q12A 4EPYA 3VX3A 3ETLA 3O8BA 4N1AA 1NVXQ 1Y63A 4PC3A 3W6NA 2JLUA 3THYA 3LV8A 1MO4A 2GJAA 2V55B 4D0GA 2WJHA 4EAQA 2JCSA 5BN5A 1VHLA 3KDSE 3R8CA 1TTTA 3KY9A 2NO1A 3THYB 1XF9A 3R7WA 3X1ZA 4U00A 2F1RA 2FZLA 3FFAA 5DH9A 3KUDA 4OJKA 1D9ZA 1YHNA 2AX4A 2TMKA 4M21A 2EWVA 2XGJA 1SVWA 2JGNA 5KNCA 1D8TA 2D62A 3W3ZB 1E1QD 4NE2A 3H1TA 4B76A 3WNDA 4JT2A 4EFMA 1R5BA 5J4HA 1XD9A 4YMSA 4HEJA 1XEFA 4TL6A 1N6OA 4CIDA 1Z5ZA 4D82A 2J1LA 1G17A 4JBYA 1E2NA 3FDIA 4U5XA 1VKJA 4LYAA 4AWXA 1E2QA 1TU3A 3BE4A 4DZZA 3AF2A 2QORA 4KYUA 4D0NA 4Q4JB 4CYMA 5FTJA 4DDWA 1MR3F 3ZS8A 4BLOA 3DO6A 2WJVA 4LUCA 3ZQ6A 2NZ8A 4E09A 1KIMA 4DVGA 1YKSA 2AWNA 4GRAA 3QSYA 1XCPA 1II8A 1W1WA 3LDAA 1WE2A 1FAQA 2IK8A 1ZCBA 2QM8A 2Y8EA 1R8SA 3C7KA 4TZ0A 4C0HA 4YC7A 4V02A 1LW7A 3U7FB 1OE0A 4DXAA 2VPPA 2QNRA 4NU0A 1GNQA 4V0OA 2PEZA 3G82C 1FQJA 2KE5A 2H18A 2GZAA 4IDHA 1KI1A 4Q4AB 1XWIA 1YR6A 2CVFA 3DL0A 4KXFB 3SJAA 5D3QA 4DDUA 1YZTA 2YWHA 3MWJA 1BH2A 3C5CA 5EE9A 3CPEA 3F8TA 2GBLA 3QF7A 2GVIA 4MDEA 3QBVA 1GIAA 2YOGA 1IM2A 5JJLA 1FNNA 1NMZA 4C7OB 1E0KA 2FSGA 4GDFA 2V7QA 1WRBA 2ZYUX 2XNDD 5KNDA 4HI0E 4Q4HA 2WHXA 4UXHA 2QMEA 1U0LA 2REXB 3CBQA 2ZR7A 4OKSA 2JA1A 2ZRAA 4PZLA 4EPTA 4Q4HB 3AUXA 5LB4A 4R2IA 1NN1A 1X8JA 4EJSB 4TN1A 1FNMA 2A5JA 1CKEA 1TPZA 1WF3A 4RJLA 1KNXA 2WVJA 2QAGA 4NCNA 3ICEA 2CL7X 2F9MA 4PFSA 5CLLA 5HKKA 5JMTA 1C9KA 3SNHA 2ZRGA 3QOFA 3MGCA 1N0WA 2IYLD 1PVOA 4QRHA 4Z51A 4KLNA 2WJYA 3Q5EA 4CRWB 3CX7A 3Q85A 5DYGA 5H70A 3WHKA 3TGPA 1S9HA 4B6EA 1T3SA 3O47A 3TSZA 2XSZD 5BQ5A 2F6RA 3V9PA 4OHYA 3Q7QA 5E95A 1E79D 5BYKA 4FWIB 2CLCX 2W2VA 3UMFA 3T5GA 4LK2A 3N5CA 1Z0JA 2QUZA 2D2FA 1M1YE 1AKYA 2VSOA 3ZZ0A 1DO2A 3IQXA 3JZMA 2H7VA 3SYKA 4S2EA 3K09A 2Z0MA 4U02A 5DNYB 2FSHA 5B64A 4DSTA 3RRZA 4ZV4A 1TF2A 4KU4A 5EP2A 2A5FA 3AVPA 1KKMA 3RSLA 4B6DA 1QHXA 3CRVA 4GZLA 2AFHE 3PEYA 3BOSA 3K9LA 4XOIA 1CF4A 5AUQA 3K9NA 3HU3A 4Q1CA 4BFWA 5FBWB 2X8AA 2XZLA 4ERNA 5JFGA 4H1UA 2JLXA 1T0HB 3QG1A 2OBNA 1RRGA 4ZDJA 3AP3A 3IKJA 4AY2A 4HUQA 4TSFA 3PUZA 4UNPA 1RRFA 1Z8FA 1YVDA 1G8FA 4DLYA 4DB2A 3BC1A 1XD2A 5EP4A 2CL0X 4FD2A 2ZUBA 2HYIC 5IDVA 3OHMA 5H68A 1GTVA 4FIDA 3GJXC 2OXRA 3AGQA 3BWDD 4H9GA 1Q22A 1QBKC 1FP6A 4L5BA 4Q1DA 3SYNA 4B33A 3CKLA 3K0AB 3LY5A 3RS4A 3W6OA 2H1LA 2OCPA 4DEYA 1PV4A 4FCTA 1II9A 2FOLA 3SN6A 1TU4A 4XWAA 2ZVQX 5JRJA 2WIAA 4LY6A 4OQNA 5HPYB 3ZD7A 5JEEA 5L8VA 4JYBA 1E9RA 1XTSA 1E9AA 4HB4A 4C3ZA 2HLDD 3KL4A 5JBQA 3CH4B 3I8XA 4EUNA 3ZQJA 4M9SA 1Z0KA 4PC2A 2QI9C 3IGFA 1E2HA 4Z1MD 4BFUA 1L4UA 2W2TA 5AJZA 3S1AB 4P33A 3EZ6A 2FH5B 3AVOA 1O3YA 2GILA 4YMVA 2OM2A 1ELOA 2DWOA 2DY1A 1Q1BA 2ZVPX 2O52A 1L4YA 2ZE6A 3RRYA 3CZPA 5K8TA 3CZQA 3DOFA 3QENA 2D7DA 4PO8A 1GILA 1NN3A 3U4QB 2EFCB 4FCVA 4FXPA 1RYFA 1NJFA 4KJZA 3RLFA 2YJTD 4ACAA 5J4LA 5CK4A 2IS4A 5JRZA 1GG2A 4US2R 1G1MA 2RH5A 3OAAA 4OK3A 3CF0A 4AKHA 3CXLA 4DKXA 1XA6A 4LOAA 1G5TA 2GDJA 2BV3A 1PJRA 1D2MA 3QUSA 3T5DA 3TAHA 1U81A 2J59A 4QBHA 3RAPR 3HR7A 4NP6A 3TAUA 1ZNYA 2GJKA 4NYIQ 3LW8A 4PZZA 1KDOA 3ZVLA 1H8ED 3HYTA 3QKSB 1OIVA 3G0HA 3DZ8A 4Q66C 1QF9A 2ZJBA 3FWYA 3U7GA 3GJ7A 1P9RA 1HE1C 4ACBA 3AP2A 4NYJQ 3I62A 4A6XA 1F2TB 4OL0A 5FFMA 3K70C 4A92A 3SS8A 3NBFA 4M22A 1DAKA 3A1SA 4CGZA 4NZYA 1RFHA 1LY1A 1Z08A 1F5NA 2SHKA 1ODFA 4MRSA 3KFVA 1E9CA 1MO5A 3TSOA 3QEOA 4OHVA 1NIJA 4Q18A 2FA9A 4B48A 3ADDA 3ND9A 2WICA 2GTPA 1RRPA 3AF0A 1IN7A 4PQRA 1FP7A 1Z6XA 1HY3A 5CDFA 1E1RA 3KQUA 2GCNA 1GRQA 1JQJC 2PL3A 3EIQA 3VR2A 4G5SA 3OE7D 3B82A 5D3MB 3SJZA 1NG1A 4GFDA 4C0AC 2IYTA 3OEEA 2GCOA 1WCV1 1KAOA 2H8KA 2OSBA 1PTRA 3AV0B 2ZJ2A 4N0DA 1YJ5A 3MG9A 1T3HA 1OXSC 3LO5A 2ZJOA 1FARA 2HT1A 2GCOB 2OFWA 1ZIOA 4M1TA 1NVWQ 2PT5A 3IDQA 1W2HA 3X1XA 3I92A 5TMPA 4QJ5A 4NKRA 1L2TA 3A58B 4Q4LA 1SULA 1IBRA 1G3UA 1WP9A 4GP6A 2GZHA 4HAZA 1OT3A 3CM0A 1MT0A 4PPGA 3U3OA 2VTKA 4B73A 2RGBA 4YLGA 3BJIA 3K70D 2HV8A 1J2JA 1W4BA 4JL5A 2KB0A 3NBYC 2CK3A 5B30A 1FQKA 1X6VA 3B2EA 1N5JA 2FFHA 1ZU4A 4TMKA 1W36D 5AUNB 2O0JA 2O8BA 2EWWA 2IYQA 3U44A 4JMPA 3QVUA 5KHOC 3RC8A 1R4AA 3B5JA 1QZXA 3Q3JB 5IF9A 2QGNA 2YUUA 2XOKD 1VHTA 1HT1E 4NYIR 4P3YA 4D0LB 4QM6A 3RRMA 3TQFA 1E99A 3I5XA 2ENNA 1D9XA 2O8BB 3GCGA 4L15A 3RSOA 1XPRA 2QE7D 3BH6A 1UBCA 4F4IA 4QM7A 1KZ7B 3FB4A 2PLFA 3NXSA 1VG1A 2PT7A 3HPRA 4NYJR 4US0R 4OHZA 1RZ3A 2C03A 1XEXA 1OIXA 2V6JA 3GEIA 1DBSA 1IONA 3DM5A 4GPTA 3F0TA 5LD2B 2V9PA 2ZRJA 1XEXB 1NBME 1G3IA 3FKSA 3QJYA 3GLFE 2AL7A 1E9DA 1IN4A 1NY5A 3WYAA 4BGDA 1NMYA 3WBJA 2PMDA 4J0QA 4IVQA 3JZAA 5KO2A 3QKUA 4C0BA 1Z29A 2AWOA 4A9AA 1FTSA 1UF9A 2VP2A 3D31A 2GXQA 2X2FA 1S2MA 5A0FA 3VFDA 1MH1A 5FBLB 5FTKA 1JR3E 4DUGA 3I73A 4D2IA 1P73A 3I4LA 2H92A 2OAP1 4Z8XA 5EQTA 2JLVA 4RFVA 3P20A 5B2ZA 3NWJA 4BEBA 2OCBA 2NPIA 5L3SB 2CBZA 4DCVA 4TZ6A 5LBIA 2A5GA 2Q3MA 3K0CC 4DSUA 1II0A 1RYHA 2HYDA 3UG7A 3M0EA 1AGPA 3DVLA 1RJ9A 4DC9A 4QNRA 2XNSA 3WNCA 4KITB 1E4VA 5JLJA 4OI0A 1OKKA 2ZJYA 1Z06A 1FX0A 3KX2A 4WW0A 3PXGA 1E2MA 2N1BA 2Z43A 5HTKA 3DDCA 2EFDB 5FUYA 2G83A 2ROWA 5C1BA 4CF7A 2HXSA 4C2TA 1P6XA 2ZQ5A 2Q3HA 5C2JB 3EWSA 1DAGA 1JBKA 4LJAA 3KKMA 4Q5IA 4F92B 2JASA 1OSNA 2R6DA 1Q0UA 3ZVRA 3VU9B 2VHTA 3MWYW 3KXKA 2GRJA 4YONB 4HB0A 1E69A 4E03A 4OJQA 4D81A 1EFCA 4GL2A 1U2RA 1DG3A 2RGGA 2FFBA 2ZANA 3PCRB 3SE0A 2E73A 4GMXA 2DCUA 4RD1A 4RFSA 4PXAA 4R71A 2QQ0A 4RKFA 2QBYB 2BCJQ 4ASUD 3U2QA 3DPUA 4ZCIA 1E9EA 4MKFA 2DPXA 1Z07A 3QBTA 1WDTA 1ESNA 1JR6A 2ORVA 2AD1A 4TLBA 4JLOA 4RFSB 4QKQA 5DE3A 2C96A 3WMGA 3R20A 2GEDA 4GMDA 2O8EA 4B34A 3RYTC 4Y0AA 2VHQA 1KOFA 2GK6A 4Q7LA 5EJEA 1EX7A 3BAFA 4XD7D 1KI9A 1PTQA 4LC1A 4D4JA 1DTSA 4RKEA 1G20E 2BDTA 3U3MA 1ZD1A 4OK5A 3L0PA 5JHHB 5KOYA 5FBQB 5HCIA 3AKCA 2DB3A 2GA8A 2F9LA 1HQYE 4PPFA 3ZVMA 1DS6A 1S9DA 1YRBA 4TWZA 4R7ZA 5DHAA 4LJ7A 3DKPA 2XAUA 1U9IC 2RMKA 1N25A 4PPQA 2B7BA 2ECKA 4MH0R 2FEMA 1E96A 4Q03A 5AUOB 1VIYA 2IUSA 2J3EA 4GT1A 3GLHA 1NBMD 4V0KA 5AJYA 4BZPA 4L4UA 3K53A 2ZM5A 2JIZA 4XVRA 1OHHD 3SBEA 2J0SA 4W9MC 2WOOA 2IYYA 1KHTA 4BZXA 4JS0A 4XWOA 3KZ1E 1OH7A 2ZSDA 3C16C 3GJ3A 2GXUA 1R10A 4BRUA 3T12A 3SU8A 1KI8A 4YMTA 1M34E 1YR9A 3LLUA 3LRPA 4FN5A 1T3LA 2WWXA 3OIWA 3GLGE 4A0HA 4DSOA 1T5IA 1FZQA 3SYLA 1JR3D 1T5LA 1G3MA 5CB6A 4DEXA 3E2IA 2WSSA 3QXSA 3BBPA 4KFSA 2IWHA 1N0VC 1H8HD 2QRNA 1N3BA 3O8CA 1LF0A 4DBLC 4BPBA 2B8TA 2JDID 1M7BA 4A8JC 1NL3A 3OFND 3UATA 3UANA 2HCBA 4LHVA 3GFOA 4NL4H 1NJGA 2C9OA 3SBDA 4U7DA 4X8HA 4OQFA 4XSHA 1OW3B 1XJQA 2YOFA 1JPNA 5E7JA 3QKTA 4HAXA 5SZKB 4W5HA 2IX3A 2DYKA 3CPJB 1EG7A 5KSZA 5F9HA 1MV5A 3PUYA 4JIMA 2F43A 4XJXA 1CJVC 1SXJA 2BMEA 3RABA 1IY1A 2UZ3A 2JLWA 4L16A 1SVMA 1W2GA 5CIWA 4M1WA 3TSWA 2QRZA 3RVBA 2F43B 5IT5A 1SXJB 3FVQA 3LVQE 1X1SA 1E98A 2ZJAA 1TQ4A 5C18A 5LB2A 1VG8A 5FOTA 3CB4A 5ANRB 1UBFA 4GI7A 2Z83A 4QHTA 4UJ3A 3GLFB 2ZRLA 2CLDX 3RDPA 3DMNA 2IXGA 4P4SA 1IOZA 2D4HA 1JPJA 1US8A 2OXCA 4BRWA 3CF6R 1AZTA 4HATA 2FN4A 5IK2A 1W49A 2E87A 2ATVA 4P4UA 4TTRA 3MJRA 1KAGA 3UIEA 4DSNA 2ZRKA 1DOAA 3T1VA 3TW8B 3A8TA 1XD8A 2G0TA 2ZXUA 4UNQA 3I32A 2WKQA 4NYMQ 3PUXA 4KO8A 2V8OA 4E5UA 2AK2A 1LTQA 2ZI6A 2FNFX 3IO3A 4YMUA 2CCJA 3R9XA 1SHKA 2A30A 3ASYA 1G8GA 3WRYC 3HU2A 3WP0A 3A4MA 4HAVA 2G1KA 1ANKA 4GZMA 1W47A 4ESHA 2REBA 1G8PA 1NY6A 2DWQA 5TV2A 1U8ZA 1XMJA 1FOEB 1KTVA 2V54A 3QXJA 3TUZC 2RGAA 1TUIA 3B1XA 4KFUA 3QXHA 3TNFA 1NSFA 3SQWA 2ZR0A 2MSCB 2P6UA 4ILEA 2OFOA 2P65A 1Q21A 4JVLA 3SZRA 4EFLA 5A5GA 2O8DB 3TRFA 4QL3A 4FW9A 3PFIA 4BFTA 3C15C 2DFKB 1Z63A 1OB2A 3AVWA 2JJ1A 4LBWA 4OBEA 4IKEA 1OLOA 3K0FA 1NF3A 4RCZA 2XXAB 4UXJA 4AYWA 5EXSA 4PC7A 1KJZA 3RWOA 3DHWC 3NEYA 1JXOA 5CB8A 3QG5A 3FTQA 3EPJA 2F3RA 2IEYA 1U0HC 2XITA 3CRQA 3UEJA 1XMIA 2IF0A 3I61A 1ZJ6A 4JLVA 1KK3A 4TYPA 4DLTA 2ZR9A 5KPDA 4DIDA 1SGWA 1Q20A 1XU4A 3MD0A 1OV4A 3QKRB 2PJRA 1NVVQ 4Q21A 5KDDA 4C0JA 4PHFA 4W5JA 4QHSA 2AXNA 2JLSA 5SZIA 3LLMA 3ADBA 1SHZA 4AC9A 2IF2A 4JZKA 2BJWA 2XB4A 3B8HA 1G7TA 1DEKA 1SKYE 3FHCB 1Z47A 3W5IA 1XTQA 4ZO4A 5JJKA 2DHRA 5B57C 2OAQ1 4M9QA 1CU1A 4JLKA 2QAGC 2GF9A 4KYIB 2VLIA 3HWSA 2ZUCA 1N2CE 4MRRA 4NYMR 3RS5A 3W5JA 1NP6A 2NTYC 5DLQC 1FUKA 1PLLA 1R6BX 4NCHA 3VR3A 4LHXA 2WKRA 2GEUA 4Q4JA 1W0KA 1TBOA 3KKPA 2WMOB 4JLDA 4MUAA 1AA9A 4PQFA 4AI6A 2WOJA 2YWGA 1ZVQA 2ELIA 4LJ6A 1W7AA 4CEJB 1DVRA 3GJ0A 3H0KA 5C46F 2WWIA 3I1FA 4LC0A 2X2EA 2IBMA 1OXUA 2D2EA 2QU8A 3RHFA 4AIIA 4D6PA 1EFRA 2ZRMA 3GLGB 4C0LA 5KDLA 2R8RA 1KMQA 3K09C 3NC1C 4LBVA 3UG6A 5JEDA 3FFBA 4MKGA 4A0GA 3DEFA 1XDBA 1WB9A 2VA8A 2V7QD 2ZUDA 4ABYA 5L3RA 1E3MA 1T91A 1XPUA 2WWFA 5JZVA 1F3OA 3EA5A 4Q4AA 1GITA 1BYUA 1CJKC 4BWYA 1S3GA 2JLZA 1VCIA 5UKDA 4AKGA 3UPUA 2RGNC 1E1QA 3AVQA 4LHZA 1JEDA 4MA4A 2I3BA 1BKDR 3QPVA 4WVFA 4O0MA 1I2MA 3GLIA 2HXYA 1KSFX 4C7OA 1NSTA 1BIFA 2P6NA 1EFTA 2YHSA 4LZZA 2JLQA 4R2HA 2QP9X 3T06B 5HKKD 4JJKA 2B8WA 1TF7A 3GLIB 2VBCA 1W44A 1K8RA 4C2UA 1QHHB 4DJTA 1YR7A 2F7SA 3BGWA 4KCGA 3A36A 3CWZA 1NVVR 4V0LA 4EJSA 3VR6A 4PHGA 1MABA 1ZD8A 3P4XA 4HLUC 5FL7D 3SEAA 2ZJ8A 2HJVA 2RHDA 1UKEA 2Z6VA 4TTQA 3BB4A 4M1SA 2GNOA 4JT4A 1XXHE 2CCGA 3QXCA 4KV9A 1MABB 3C8UA 3P32A 4G5QA 5JS7A 1ZNZA 4JLNA 5BYJA 1NLFA 2Q3FA 3QF4B 4WZ6A 4AG6A 4OI1A 4BLTA 5G40A 3EZFA 3FKQA 3EC1A 4PSKA 1VMAA 4G5RA 3VR4A 4B3XA 5SZHB 3NBXX 5J5CA 6Q21A 3KQNA 1GNPA 2MSDB 4A36A 4LHYA 3N70A 4F93B 1N5LA 2NOAA 3B1WA 5LPNA 5FPTA 3BS4A 4FI3C 4Z54A 4DT1A 5CDFE 3V4RA 5F9FA 4A2PA 1YU9A 3ZJYA 4BQSA 2ZRNA 4ZDIA 5BN3A 4GOXA 3T34A 4TSFD 4DLVA 1Y8FA 2H17A 4DT1B 1N6KA 1KSHA 4CEHB 2ZRFA 2QMOA 5F98A 1KO5A 4RZ2A 4Q7JB 3KJGA 2VSXA 1E9FA 2CE2X 1XEWY 4IEEA 3T15A 3TH5A 2WTUA 4ITRC 5DYIA 5JSZA 2CNWD 2BM1A 3M1IA 4BASA 3K0EA 4EIWA 3QPUA 1TQ6A 2ZPTX 1AKEA 3GJ8A 3BFXA 3TKLA 5JSZB 2R6GA 3K9HA 1MO6A 5DHFA 3I5YA 3PV0A 1IJEA 1XTJA 4PZYA 3IBGA 1KO8A 3PVSA 3OIUA 1HEIA 4JLJA 4V0MA 5GADl 2FWRA 2GJ8A 1KGDA 3NHAA 1W48A 4GNKA 2AR7A 3THOA 3TE6A 4AK9A 2OG2A 3LAWA 1Z2AA 4NTZA 4MDFA 4JYCA 1UM8A 3IO5A 4IVPA 4PPNA 3FMPB 2BC9A 3WRXC 3K0AA 4MKHA 1L7VC 2I1VB 1ONBA 2FMXA 4D4KA 2FEOA 4EFNA 5F3WB 1D2EA 2OHFA 2RKOA 2ZRHA 2NO6A 3L43A 1QDEA 2B7CA 4ZDKA 4A2WA 3GQBA 2BKEA 4NPHA 4C0QC 2QENA 2ZYVX 1SKYB 1P5ZB 1P62B 1IQPA 2ZETA 3LNCA 2FJUA 2ZSFA 4IEIA 5EXXA 3WMEA 5BN4A 5FTNA 4ON9A 3S1AA 1G4UR 3ZZTA 3OAAD 3PEVA 1ZP6A 2FF7A 5E3HA 3JVUA 1UEJA 4LCBA 1MO3A 2ZE5A 3HU1A 3GFPA 4TQUS 1AK2A 1IY0A 4Q9LA 4B3CA 2FU5C 4QC2A 1TF5A 3U4QA 2JJ8A 1IY2A 1NN5A 4KVAA 4JVNA 4DIEA 4TL8A 4QXAA 4KI0A 4YQFA 3ZH9B 3W8NA 3BJIC 4PR0A 3KKQA 5TVKA 1N6PA 2FPKA 1KI4A 1IAQA 2WAXA 2W6ID 4V0NA 2PZEA 1GL9B 4UQOA 5JWRA 3KQKA 3V4FA 4Q48A 4ZCLA 1LV7A 2CLSA 3QKSA 3V00A 3IHLA 2KJQA 3KKOA 1R2QA 1G7RA 2HF8A 2J7KA 3CF2A 3K8YA 5FH9A 2WJGA 3D8BA 3MAAC 2ZS9A 3HP1A 3LBNA 4I1VA 3FOZA 5C4GB 4O3MA 4E07A 1BS1A 1F2TA 3FPAA 2QN6A 3QE0A 1QHIA 4BFSA 3LWNA 1YZNA 5JWHA 2A78A 1UAAA 4WIAA 2D74A 3R8FA 4US1R 1W5TA 4C30A 1W4RA 4LPSA 2IXFA 5FR2A 2KSQA 3OEED 2JLYA 1R5OA 1ZM7A 4ZI2A 4Z1MA 2NMVA 3MRSA 1IJFA 2EVWX 3QI2A 3QY0A 3H86A 3U7EB 3CX6A 2ATXA 1YQTA 5JHGB 3O8RA 1EGAA 1AS2A 3GD7A 4Q9IA 2EQBA 3AP1A 1X1RA 1CBUA 4WXPA 2PBRA 2ASEA 2QROA 4Q1AA 5D3MA 1Q57A 2YINC 1ZBDA 2KWIA 3BERA 1IXZA 3RWMB 2FSFA 3EC2A 1VYTA 4EKDA 1BOFA 2C95A 3NG1A 5DIFA 2FPMA 4LWZA 1QG4A 2A5YB 1T8TA 3NKVA 2CK3D 1LS6A 4O2LA 2CVHA 2RGDA 3AKEA 1HT2E 3I3SR 4F4JA 3H4MA 2D7CA 1LS1A 1P7CA 1G6OA 3BH7A 3NC0C 3EZ2A 2P2LA 1XZPA 1XP8A 3MFYA 4O25A 5EZ5A 3ZYCA 3KXLA 5AJVB 3TMKA 1NKSA 3AF1A 4HLDA 4TT3D 3SJCA 3W34A 1P9WA 2DBYA 2ZJ5A 3W8RA 4A6PA 1CR1A 2H16A 1U8AA 1ZNXA 3LQQA 1E6CA 2A7QA 1AGRA 3ADCA 1KDPA 2R62A 1W0JD 3WP1B 4HZUB 1M2OB 3VKGA 3KJIA 2D3WA 5EZ6B 4UXIA 2CHQA 4G01B 2WPDD 4DLRA 1R79A 4MRNA 4TQAA 1XTKA 5JECA 2ZRPA 4Q47A 2ZRDA 3T1QA 1E32A 2WWWA 1W46A 5CM8B 1EXMA 3GLHE 4BEJA 2E9SA 4L8GA 1G18A 3DM9B 1G7SA 1SVLA 4OI4A 3TVTA 2IEZA 3AVXA 1Z6TA 3J81k 2XTMA 1ZCAA 3EW9A 4XH9B 1X8LA 4C0SA 3EX7C 1W4AA 2I4IA 4NCIA 1XZQA 2QEQA 4G5OA 2NIPA 3ZIAD 5FOXA 1RW4A 2BHRA 1XJ0A 4GSYA 3T35A 4DUGD 3W90A 3AH8A 4IHQA 3AGPA 1S1MA 5EUMA 5JWOA 3FMIA 3IUYA 4KLZA 4D25A 1VCNA 2AKYA 4O2RA 1KKLA 3BD9A 3OIYA 2FDCA 1QVRA 2HCJB 1G8HA 1Q1QA 1U99A 2ZU6A 1JB1A 4BLPA 3VR5A 4K8OA 4JVMA 2MMGA 2W2XA 3CONA 4BFZA 2GK7A 1GL7A 5FTLA 2GWHA 1EFUA 4IJMA 5DI3B 1P72A 3NTUA 3LH5A 4QNMA 3I8SA 3U6KA 2JLRA 2ANCA 2AD5A 2PH1A 5L3SA 3K70B 1IXSB 2ORWA 4Q01A 5FUXA 1GP2A 2QY9A 3CR7A 1T6NA 3PITA 5FBRB 2I1QA 4A82A 1Z6YA 2J46A 3GPLA 1COWD 1RIFA 1XCGB 4FMDF 1W36B 1I2DA 3B85A 3RRNA 4QGFA 1NLYA 1G19A 4FMCF 1M8PA 3B9QA 1FTNA 1UADA 3EARA 1GNRA 1ZD9A 1NMXA 4K81B 3E70C 1P4SA 1OFIA 3VX4A 3GFTA 4PO9A 2FZ4A 2OILA 3BK7A 3PUWA 4PANA 2O8CB 1KYIA 1HURA 1M7GA 1N6IA 3VNUA 1KY2A 1G291 3IILA 3P4YA 3QVVA 3EIHA 1YE8A 5E7IA 3VU9A 2Q6TA 3ZGXA 1HE8B 2R9VA 2YZ2A 3H2YA 4LV8B 2P6RA 4IRUB 4EDHA 2QP3A 4OQMA 4M53A 2ZAMA 4KFTA 1KJWA 4PAMA 5FR1A 3ZD6A 3CO5A 1SZPA 4M1OA 1HA3A 1NLZA 2IYUA 2VRWA 2VHCA 2ZAOA 3CLVA 3QEJA 4NONA 3HR8A 1GAJA 2QBYA 1B0UA 1FUUA 5A4JA 4LYFA 2VRWB 721PA 3NDPA 4B35A 1ZINA 2CL6X 2W6JA 3PG5A 1U0JA 2OLKA 3HDTA 3MWKA 4K46A 2WWYA 2BJVA 1E9BA 3PEUA 3RS7A 1OXVA 1Z0FA 2VO1A 5J40A 1N5IA 2ZI7A 1KI3A 2OT3B 4HYYA 4TQ9A 4B3DA 4F4CA 3AVUA 1UBEA 1XTIA 2ZITA 2BBWA 3Q9LA 4TMTA 4DLXA 4HAUA 3U61B 4OHWA 1UKZA 4TMZA 3OESA 1DAHA 4OYHA 2PX3A 5AJWA 1A1VA 5B58C 3PEWA 5DISB 4TMXA 3CRMA 4LYHA 5EE1A 4Q1EA 2IS2A 1F48A 4TLAA 4MRPA 4NCJA 1TMKA 3TR0A 1NG9A 2GZDA 4UNNA 4I4LA 2DR3A 4HAWA 1OH6A 1JNYA 2GETA 1B23P 1Z0DA 2IYXA 2IA5A 2J7PD 5FPYA 1T0JB 1UEIA 2VP4A 3CWQA 3ZS9A 4GOKA 3EZ7A 1Q1EA 2H5EA 4FCWA 3OF5A 1E2LA 2G6BA 2QPOA 1O87A 4PAOA 2DWPA 2JAQA 4TYQA 1A5TA 4NCKA 1VG9B 2VH5R 2BOVA 2LCFA 4D4MA 4ASUA 4BLRA 5KDOA 4X8OA 2IYRA 3THXA 1TNDA 1N6LA 2WM9B 4WZAE 4IDOA 1QRAA 3KUCA 4B74A 3FMFA 4PHHA 5J4KA 5K8LA 1MRSA 3THXB 1JJVA 1VYUA 1AIPA 2PLRA 3SDZA 3QXXA 1YZUA 3CNLA 1OXXK 1ZC4A 3NDBB 2VHUA 2VHJA 4XTCS 5HZHA 1KMHA 1UDWA 5KNBA 1E2KA 2YWEA 4ZDWA 3ADKA 5DN6A 2EFGA 2ZSEA 1Z22A 1DAIA 2BBTA 4MKIA 1KMHB 1KDTA 2IL1A 1R8QA 2VF8A 2ZROA 3W3AA 4TLEA 2REOA 3WHLA 2J45A 3N2IA 3MUFA 3BORA 1Q3TA 4QBGB 221PA 1NBMA 1YR8A 4A0FA 4C0KA 4B2LA 4KFRA 3B9PA 1CJMA 3GLFA 1G9XA 4DHEA 1TQDA 3KTAA 3T61A 3BFKA 1F60A 1BMFA 1LVGA 4RD3A 4HAYA 1R5NA 1K5DA 1R0WA 3KTAB 1N6HA 2ERYA 2GJSA 2QSYA 4URXR 2BMJA 1H65A 1ZUIA 3LX8A 3U3JA 4JJZA 1W4CA 3JVVA 1ZMXA 4AYTA 1JR3A 1U94A 5L3VA 4TMWA 1LF5A 1KZGB 1I4DD 4DDVA 2Z4SA 3VTKA 1H8HA 4R98A 1VECA 3B78A 2A2ZA 2PZFA 2XZOA 2VP5A 3AB3A 3F5FA 5AK0A 2ANBA 4LV5B 4WXRA 1G3RA 2WMNB 1X8KA 4MGKR 2W0MA 2X77A 3MCAA 1P2VA 4Q7MB 1ZM2A 1RVDA 5DSZA 1SVIA 1FW6A 2IS6A 1AQYA 3U6BA 1UJ2A 2CHVA 2EFEB 3LW7A 4JLMA 4Q00A 2BMFA 3OEHA 3P1JA 3C14C 1E2JA 3MJHA 5HZKA 4IFBA 2Q0HA 1TEXA 1PZNA 2A9KA 1U9IA 5IHPA 5AJXA 1AZSC 1OF1A 1GKIA 1DAFA 2W58A 4BLSA 1FL9A 1AJEA 2WAYA 4I1SA 2O8DA 4KVGA 2J87A 1R0ZA 2ZI9A 1AN0A 1LB1B 2BEJA 3ASZA 3PR1A 4HB2A 4KHZA 4ZIRA 2QMHA 2JJ2A 2IW3A 4Q19A 4UNRA 2NG1A 2XXAA 1E2DA 1HV8A 2ODWA 4ZIRB 1A2KC 3TR5A 2J0UB 3IPYA 4RSGA 2JATA 3UMSA 1EK0A 3BXZA 4LPKA 1XFAA 1ZU5A 4ARZB 5FUVA 3EPLA 5EXPA 4DLUA 4DDTA 3SC3A 4PQYA 3A4LA 3AKDA 1EWQA 2FSIA 4OK6A 1K6MA 3GJ5A 4QGGA 2GBLC 3CNOA 1P3JA 2R6CA 4OI2A 5CIQA 3LD9A 3KKNA 4P4TA 2O0HA 4Q9JA 3QKRA 2IS1A 3QNUA 4JL8A 3A1WA 3ONWA 1Z6AA 1D5CA 4A8JB 4JSTA 3UEYA 4MYTA 1E9SA 3BRWD 4JBWA 2H57A 2XTNA 1M7HA 2QAJA 2VL7A 4HSEA 4EJSC 1RRCA 2O8FA 1OYWA 4Q9HA 2ZE8A 3TLXA 3TJZA 3Q7PA 2KI5A 1ETUA 3RANA 1G6HA 3VNVA 1HYQA 2O8FB 3I72A 3Q5DA 1W5SA 1EFRD 3T1OA 1S0UA 5JI3E 4KSCA 2ZSAA 4EPVA 4JLPA 3MMPA 1NN0A 1UPTA 2FFAA 1TQ2A 5L3QA 1HH4A 3BB1A 1GWNA 4YXWA 1GM5A 2XEXA 1G8YA 1S4QA 3L82B 1EX6A 4IDNA 2AXPA 1OXTA 4LDJA 1X3SA 4M1YA 3VMFA 3LVRE 5L3QB 1ZM9A 1G5RA 2AHOA 2DFTA 3B1ZA 5AWFC 2W0SA 3L0SA 3REFA 3Q72A 4CEJA 1WMSA 2C77A 4CDGA 4UJ5A 3BFVA 4P32A 3R7WB 2L0XA 4DWJA 3GLGA 4ZI3A 3REGA 3VR1A 2VP6A 3A1UA 1MRNA 1CR2A 4MYHA 3AUYA 2J9RA 2BKUA 4IXMA 2YV5A 2FPLA 1XRJA 1J7KA 2OLJA 3ICQB 3PENA 4XIGS 4RVCA 3U7HB 2RCNA 4NHOA 4NH0A 1VIAA 2CHGA 2FNAA 4LHWA 4NDZA 1JEEA 2FX3A 4LRWA 2B21A 1GDDA 2XJ4A 3TW4A 2UVQA 1ESMA 2IUTA 3B6EA 3AF4A 4QGHA 1P9NA 2ZEJA 4QBIA 4G1UC 2YNMA 3NEJA 5AR1A 4B71A 4YDHB 2VF7A 2EW1A 1ZNWA 3ZVNA 4DLZA 4DLWA 4FKDA 1SKQA 2AFIE 3EIEA 3WY9A 3OIVA 3CX8A 1A7JA 5FPSA 4OQXA 2X19A 1G4AE 3FMOB 1QHHA 2QT1A 3IIMA 3NH9A 4XVUA 2OO7A 4A4DA 1D2NA 1II8B 4POAA 1JI0A 5KYKA 3UWOA 1CRQA 4EPXA 3PJRA 3CUEF 1LNZA 5J4YA 3GEHA 4PC6A 2P5TB 1J99A 2W00A 4QOSA 1VYVA 2BBOA 4XSGA 2F1JA 3A37A 4LJ9A 1UKYA 1ZIPA 4TYNA 3GP8A 3IHWA 3QF4A 2NPFA 5JCZA 3AM1A 4AG5A 2ZYTX 3TUJC 1CXZA 1OH5A 2RGCA 3FE2A 4URUR 3TUIC 5GVSA 3SFVA 1SQ5A 4OHXA 3FGNA 1TX4B 1P2SA 5AUPB 1QG2A 5FBVB 4FMBB 4BECA 1TAGA 2PZGA 4JBXA 2Z5FA 5GJVC 3EZ9A 2C9CA 1AS3A 1S3SA 2QL6A 4G5GA 1ZM4A 4MGIR 4B3GA 2FG5A 2QM7A 1QHNA 2R6AA 2VQSA 4JL6A 5KSYA 4B3BA 1RKBA 4QGAA 1S8FA 4LJ5A 2YOHA 3K1JA 4M1MA 4BUJA 3THWA 4TTPA 3CPHA 2YWFA 4B44A 3AVYA 1KSJA 4DCNA 4URYR 2CMKA 3THWB 4MITA 4RZXA 4CEHA 3DMDA 1OB5A 5CJ2A 2J0VA 1JAHA 3BH0A 2QAGB 5H8WA 2EU8A 2OCYC 2UZIR 4XTRA 4B2PA 3GEEA 5FTMA 2XJ9A 2VP9A 4HLCA 2XNDA 4URVR 5CLQA 4L9WA 2IUUA 2QQEA 2G3YA 5HCNA 5LDDC 5FL7A 1E2FA 5TDHA 3AEZA 1XMVA 4LSGA 2NQ2C 1Z6GA 1N0UA 2P3SA 3R9IA 3VHLB 1IN8A 3T1TA 2W83A 4P0TA 5G3ZA 2IYWA 2C2HA 2ERXA 4B6FA 1CS4C 2OEPA 2WIBA 3IEVA 2GVDC 3SR0A 2YKGA 5GJCA 4XVQA 1CIPA 4QBFA 5G3YA 1WBDA 4A15A 3ZLJA 3AF3A 1Z3IX 1I4TD 2XSZA 1XMSA 5FOVA 1VG0B 4LBYA 1E79A 1DPFA 2B92A 4I81A 2RGNA 2VIIA 5C4MA 4CW7A 2N46A 2ZREA 4JKYA 4MYCA 4TLDA 3CW2A 1GZSA 2AN9A 2ODBA 1EESA 2IYVA 3EA0A 3PQCA 5CK5A 5EE3A 2Q9BA 1IN6A 2FGJA 1MOZA 1AM4D 521PA 3U60B 2ONKA 4HDQB 4LJ8A 4FWTA 1OFHA 4LJ4A 1IHUA 1KBEA 1KI2A 1E2EA 2LKDA 1NKTA 4HUQB 1JECA 4IW3B 3U3RA 5K8IA 1KDRA 1ZC3A 2HUPA 4GP7A 5TB5A 2CNWA 1XTRA 2R44A 1WBBA 3A1TA 1XD2B 2C8VA 3IIJA 3LBIA 4IDQA 4TL7A 421PA 4E22A 4HLUA 2RGEA 4PAQA 2RB4A 5HE8A 3BB3A 3CRW1 4M2LA 3CNNA 3EPKA 1LFDB 4I1OA 2D06A 3UXMA 2QZ4A 3EXAA 5F2EA 2BM0A 3MWLA 4G3XA 2QTVB 4MGYR 1MKYA 4QFMA 1P60A 4BE7B 4JSYA 4PX9A 3SI7A 3TK1A 2FFQA 2ZSBA 3KB2A 1NIPA 3W9YA 3EASA 3RS2A 5M04A 2HF9A 4Q02A 1RE0A 2FE4A 1R0XA 1XEWX 4V03A 2ZE7A 2P5SA 4HB3A 2OBLA 1Q1ZA 1E4YA 4TLCA 1XJCA 3WBKA 2OV2A 4JVSB 3EG5A 3VAAA 3WMFA 2ENZA 4A2QA 2GAAA 1YZQA 3RNLA 4AKIA 5DI9A 1OFUX 5KU1A 4B47A 3A6PC 2C5LA 2R2AA 1VPLA 2BVNA 3IQWA 4KODA 1E1RD 2HLDA 4HDOB 3E5HA 4EPWA 4RD2A 3L2OB 3NIBA 2AKAB 1TUEA 5LD2C 1XCMA 3G5UA 2ODEA 2NO0A 1Y3AA 4F38A 3A1VA 2YYZA 2VYFA 1KO1A 2GJ9A 3WNBA 3MLEA 1NNEA 5J4VA 4IOLA 4JLBA 2C04A 2PEYA 4CT5A 4ZKDA 3Q8XB 4RD6A 1T9HA 1NRJB 2HDNB 1PUJA 1AQUA 2UKDA 4RY2A 4IOKA 4XWKA 5CITA 4WZBE 5FUWA 3UGIA 2ZYWX 1OYYA 1G3QA 4AKEA 3R9WA 4LX0A 3D3QA 5E4FA 5HE9A 1XXHA 5JI2E 8OHMA 1OH8A 4I99A 1VCMA 3WYFA 3KQHA 2VP0A 5DO9A 4JKIA 5FI0B 4PC1A 4B2IA 5J47A 1XXHB 2BCGY 1Z0AA 3RC3A 2Z4RA 1J90A 2W6IA 2QP4A 4N3NA 1W36C 4L9SA 5SZJA 1XNJA 1KK2A 3D7MA 2IXEA 4HZIA 3C5HA 3P26A 4HUTA 1Z28A 2ZRCA 4PHTA 3CH5A 3DZDA 1ZAKA 1H8EA 1DAEA 2N42A 2YVUA 3K9GA 2DFLA 1OPXA 4HZUA 5FOSA 1WQ1R 4LGMA 3L0IB 3ECCA 1XX6A 3ZZUA 4GBMA 2E1RA 3VQTA 1GFIA 1VTKA 4H1VA 5KTYA 4BFXA 1XPOA 4DRZA 3NVAA 2VEDA 4M0LA 2O5VA 3SQXA 3L8ZA 2PMKA 1TBNA 1HTWA 5BW8A 3NHBA 3KJEA 4LI0A 3B60A 4ZPXA 5KUTA 2IHBA 3B1YA 4C9BA 3EPHA 1GVNB 4B32A 5G53C 1D6JA 4X8LA 2GF0A 2CCKA 3IBYA 2NZJA 3CIOA 1YZGA 3FKSD 2QSZA 4WAUA 3TIFA 2CJWA 2OFXA 1FPMA 2V1XA 2G9NA 3IIKA 5GJWC 1DELA 1PLKA 2ONJA 3B1VA 1VDZA 3FYHA 2CJWB 1VCOA 3VKWA 2WKPA 3UKDA 1OJLA 2J41A 5EP1A 3OE7A 1KK0A 4RCYA 5JCPA 1FFHA 2B6HA 4D4LA 3U3KA 3HPQA 1YZLA
chains in the Genus database with same CATH superfamily
1E0SA 3H7AA 5A2QA 5B7NA 3M70A 1CLUA 3JAKA 3KB1A 3LKZA 4MEAA 2CDNA 2JL1A 5KX5B 4NCBA 1U7TA 1OBFO 4II3A 3DE4X 2NZXA 2AF4C 3WLAA 3NT5A 3EFBA 2CNLA 1BQ4A 5AP9A 4Q7KA 2GVZC 5CVUA 2G6TA 1RHJA 1FQWA 4IDGA 5L45A 3AI1A 5B4VA 4IHJB 2RBGA 3EWNA 4X6YA 2RG7A 4XUDA 1QANA 3QVGB 1PR5A 4W7HA 1G64A 2VS1A 2JYYA 2IYSA 3CR8A 3L8YA 2WPDA 4BTLA 3RS0A 1EB8A 2P0EA 1ENPA 3U4DA 4UHKA 1ONNA 1GOTA 1Y34E 2HMYB 1H4TA 1N6NA 2WSMA 3PXAA 4HGNA 4P38A 1TZ2A 3VZRA 4AULA 1YF3A 5K3EA 1I7QB 3ZY2A 2B99A 4Z8YA 4UM5A 4AURA 4TWRA 2AXEA 1EUDB 4X6UA 3GOQA 3KXIA 1SRRA 2RH8A 5KU7A 2NP7A 1UZUA 2P3OA 4P3KA 1NV9A 4WCFB 2CHFA 3NAQA 3KYIB 2OB2A 4G8BA 4M9ZA 5ALTA 2XOKA 3NPMA 3GEPA 3UK6A 3HKDB 4W7SA 1D2AA 2AYZA 1U90A 5FRDA 1RQPA 3JAWA 3EG9A 1KS2A 2XE4A 1CR0A 2O59A 1U31A 2DBZA 5JJIA 4HLQB 3F6PA 3LBHA 5IPFA 1RLUA 3DE0X 3ECAA 3CH7A 1P7WA 1WA5A 3GPBA 4MWEA 1GL3A 4Y1FA 3K5PA 4HTFA 1RACA 1X0VA 3FIUA 5CYOA 4ARVA 2YS7A 5EJ4A 3U7IA 1KQOA 5EN4A 3NGMA 4TXHA 4KSBA 2HO4A 5KPJA 2XUDA 4GYJA 3P9PA 4ZQGA 3TTUA 4NS4A 2BFAA 2C78A 3X2EA 3AIOA 2JI4A 1PGNA 4MQEA 4YY3B 2OQIA 1ZUNB 4A10A 3OFSA 4ALJA 2EZ8A 2OUKA 4L2IA 2GAFA 5EIBD 1WDMA 3WLPA 4NFYA 5TF4A 4E1BA 5BWNA 2UXCB 1XKLA 3GJTA 4G0YA 1I30A 3DTYA 4I1IA 5CG2A 2RARA 3RVJA 1Z2OX 3OUZA 3L6EA 1YDEA 2APJA 4UEKA 4JXZA 1H69A 1XZJA 3AUUA 5CA1A 1UP4A 1SRQA 2GCPA 4EGSA 4HWKA 1S1CA 2HQOA 5C31A 2XVMA 4REQA 1MORA 2BY4A 3F6EX 3IQEA 4M8IA 2GTIA 3VNAA 3QLVC 4TV8F 1V43A 5KC8A 3L0OA 4N6OA 1YVUA 2V3WA 3AI2A 1Z7KB 1BMQA 1JMKC 2WDZA 3G23A 4RVHA 4W9NC 5A03A 4Z3OA 1CUVA 1ZKMA 3G2NA 4KXVA 5CCXA 4NJMB 5BSKA 4N0EA 2YC4C 4L5CA 1HMPA 2DPHA 4KPYA 2WB4A 4GD3Q 4RPLA 5AVOA 3H84A 1SCJA 1ZW6A 1DBQA 3MYRA 4LV6A 4IOMA 1V5WA 1Y5NA 2HRQA 2OYRA 2Y0EA 4RPKA 1S7CA 3W4IA 2OL4A 4H7EA 2DZDA 3GAAA 3JCZA 4MS1B 2WSYB 4RD4A 4WOCA 3UFXB 5DGCA 3P4UA 1EUCA 2IQIA 4QJ3A 4O4JA 3CBGA 1I94B 3SHWA 1TTHA 2LW7A 2QSUA 4RNDB 1CZLA 1RAIA 3MSXA 3ESCA 3HEAA 2ZVJA 5ILGA 3UJCA 3E7DA 3F5SA 1QCZA 3F73A 1RAHA 2PZMA 3NPAA 4IS3A 5K0FA 1AU9A 2ZIAA 3CV3A 4HKTA 4UCQA 4ND3A 1UKVY 2FPUA 5D5PA 1FFCA 3P9RA 4ZCSA 9LDBA 1DX6A 3LXXA 4XLTA 4H27A 5DBEX 1C0EA 1T2DA 2B98A 2OZEA 3MTEA 5LA6A 1JEYA 3IEUA 5LZ9A 3PD7A 2JA2A 3VJRA 4UQLA 5F5LA 3LQYA 2YXDA 2YC2C 3SJBA 1W88A 3EPRA 2E21A 3C43A 2OBBA 3K6JA 4WXHA 2QX6A 2DSTA 1JALA 3KPVA 1RKVA 2P67A 3AF5A 4LS3A 4MPTA 4GVXA 1A9YA 3L0YA 3QKIA 2GEVA 1G41A 2BBSA 4QJIA 3E48A 4O4LF 1ZAYA 1SXJD 4PTLA 1BWQA 3H2ZA 4Y0VA 5DN9A 4B3HA 2JK0A 2CJYA 1NWCA 5JAPA 3WNVA 2NO5A 2XKAA 3NNNA 5H16A 1G21E 3CUTA 3S5UA 4MYUA 4ZT5A 1J8YF 1NVUQ 4QHYA 1ZIXA 1CEQA 1T3GA 5ELLA 5HF6A 1BDJA 4KQ6A 4K0KB 2ZS8A 3GLHB 1JA9A 1KO4A 4NFSA 4XD7A 4B79A 1BHQ1 4CVNA 1JMVA 4EG0A 5C81A 1UFQA 1VPDA 3RKRA 2W22A 2NU7B 4WTOA 2R84A 1YI1A 2B7LA 5K6AC 5LUBA 2O3JA 5FKJA 821PA 1IXRC 3G1WA 4FFBA 4YCBA 1M0WA 4HGUA 4EQ6B 1GKYA 1YB1A 2CBGA 4RH0A 4R16A 3SJUA 4S35A 3IEMA 1VP3A 3FHTA 4LNUB 1EWRA 5JD6A 3NTOA 4LYDA 4TUYA 4X8MA 3W1EA 3IDSA 1J0CA 5AD1A 2P9FA 2J30A 2LP4Y 4UARA 1XPJA 1AY0A 3CUSA 2IU4A 4MS4B 1KRWA 1BA2A 5HR5A 1XP5A 4NMMA 2QN7A 2DUMA 4H59A 5CU7A 3HCBA 5AW9A 5L40A 3IAM6 1Y7IA 4QGBA 3ZPXA 4TMVA 2X1VA 3DDHA 1PDOA 3HCNA 4CCAA 5TMDA 5FI5A 3E7XA 1KYZA 4YJ3F 3FNHA 1DADA 1TRKA 5P21A 3OEHD 1QPZA 5JTUA 1MJAA 1MMFB 1SD2A 3SM9A 2VBGA 5JAZA 4EITA 3M2PA 4URZR 3MXOA 1P2UA 3GMTA 2YQ4A 4BFVA 2VNKA 1U9CA 1EP1B 3H16A 2VUIB 2QTTA 3VR5H 2O2SA 1XV5A 1TO1E 2QG9A 2BWJA 2GAOA 2XADA 2WR8A 4Y67A 4G85A 1DBRA 2SECE 2QPTA 4XR4A 3HCWA 2HB6A 3F3YA 4HY3A 4MJ7A 4IVRA 1FMLA 3ZC3A 2OBMA 2WDPA 3B7GA 1EE1A 3I01A 1KBFA 2G08A 4IEFB 4QICA 3CINA 4FE7A 3LU1A 4BB6A 2Q21A 1EAYA 2D5BA 2OVBA 4A0RA 5KYYA 4II7A 1NPTO 2G25A 1RRMA 4FJ0A 1EX1A 2P9CA 1NXUA 1NC3A 5TXGA 3VKUA 1N5KA 3SFTA 4BNUA 1J70A 4UBOA 4BMVA 4CN8A 3LLSA 1U2DC 1FTQA 2AUMA 2FX2A 3ANLA 2AQIA 4W7IA 2PUJA 1LBSA 5DK6A 4R31A 3ZN2A 1B26A 3A4IA 2F8LA 2QTHA 1JFVA 2HL6A 1JNXX 1US8B 1Q5PA 3I2FA 3K0HA 4LZLA 4R9UC 3T0IA 1ZQ9A 3QPWA 4X90A 1H2RS 2KBFA 5BY2A 5G0UA 3IYLW 5KQSA 1UBMS 2AJDA 1KQ3A 3T7AA 2X2PA 4BMPB 3PNQA 2R87A 5CVDA 4BZQA 2BI8A 1ACLA 4NEHB 1UH5A 2DQ4A 4DL9A 1ZGAA 5F7XA 1XNGA 1F6BA 1DPGA 4AAYA 4D97A 2PH7A 2O19A 1UIRA 1VCHA 2XTZA 3PC7A 3I9LA 3R9XB 1V8ZA 2X0KA 3UMRA 4IHAA 4KE8A 4F7WA 1F0NA 4XPIB 2C20A 2WIJA 2Y9MB 1RFLA 3RS3A 3FUUA 3WGTA 2FQYA 2OGZA 2PCLA 4B5LA 1R7RA 1ZJWA 1YS9A 4NMXB 4HUJA 1AT1A 2PJZA 1LK5A 2BJHA 1BCSA 1SK8A 2D4AA 1KNQA 3CG0A 1CUWA 2PX0A 5EJIA 4WEQA 1EXDA 1T8UA 1C9DB 2VBIA 1FW8A 5B5SA 4G0NA 1DBWA 1UXJA 5G0TA 5K5EA 3U4CA 1RE1A 3B13B 3N2EA 2WYWA 1A2BA 3SYMA 4AZ3A 1TADA 4IQ4A 1KI6B 3TGWA 3TX6A 4H18A 1GFWA 1NVFA 2QTFA 3FROA 3MJVA 4I4CA 1YBMA 4YQEA 4ZOLF 4UBNA 3T3MB 2HJWA 3UWKA 4X20A 4DCGA 4YR9A 2J3HA 3LQRA 2FGKA 1JXMA 5D6NA 3RLIA 1K6XA 2HEIA 4BNXA 1JQLB 2INGX 2Q07A 4C6TB 4MV9A 1QAQA 1V8OA 2RI6A 4AP6A 2BP7A 4Y2SA 1VI6A 3JYNA 1GQOA 5FT9A 1T29A 2J48A 4FBGA 1H05A 2FSVA 1GKUB 2Q2OA 4O33A 1BMTA 1SURA 1WM1A 3UGDA 2O4CA 2Y4NA 3ILYA 2VQ6A 3C3WA 1HETA 3NTQA 2FP3A 1CVRA 2QQDA 4NOMA 5I4IA 3QVLA 2YZMA 2JEOA 1Z2CA 4DLSA 2CT8A 1PO7A 1HM5A 2P0YA 2GXAA 4JIGA 2NO9A 3GGJA 1AXRA 5EE5B 4MI9A 5I9MA 4EPYA 5FA6A 4D56A 5I8WA 3O8BA 3GWZA 3MXTA 2PSFA 4LJLA 4D46A 1AV6A 5BN5A 3IERA 3TZCA 3THYB 4DLLA 5D5QA 1YDHA 3T7SA 2FZLA 4KQ9A 1O89A 4TS1A 3L8HA 4Z4CA 2E37A 1JZQA 2HPZA 2OYSA 4OJKA 1N4DA 1WOMA 4FW8A 4M21A 2XGJA 2JGNA 5KNCA 2FN9A 1D8TA 5KYUA 3W3ZB 4NE2A 4B76A 1JSXA 3WL5A 3WNDA 3DZHA 3IPLA 3E58A 1R5BA 1QP4A 5J4HA 1XD9A 2A0KA 4AJ4A 4PCAA 4TVOA 1UK9A 4IIGA 1N6OA 5K09A 3E22A 2QN1A 2CF6A 2J1LA 4WZAB 5HGXA 3OLVA 1G17A 5CNKA 4Z0HO 4DIUA 4YRGA 1RZRD 4U5XA 3IR7A 4LYAA 3RU7A 2CWFA 1M5RA 4RWEA 4DZZA 3C74A 2QORA 3I5MA 4DDWA 5WRFA 4ZGWA 2IEDA 5ITZB 3CPSA 1QYRA 5DSTA 4BKUA 1HOXA 4OSPA 3UAXA 1FVHA 1GN9A 2JFBA 5TGTA 3DV9A 2ICAA 3C4QA 1GZ4A 5C32A 3SPXA 1YKSA 2VKQA 3TINA 4GRAA 3SEFA 3HJTA 4RTKA 3K71B 2DQKA 2FP4B 3QSYA 1E5QA 3O31A 3JR7A 1B6TA 4KMMA 2W0TA 2REQB 3A32A 4F2HA 3KNZA 4ZCTA 1W1WA 3LCUA 3LDAA 2V7XA 1SCNE 3EDMA 2IK8A 2QM8A 4ZTUB 4TZ0A 1U7WA 2AZDA 4M7WA 4FDUA 5AIBA 1LW7A 3CH6A 4JR2A 5AW3A 3RRBA 3ILHA 4UE2A 4DXAA 1XSEA 2W42A 5CT8A 4TM8A 1ZX1A 3J7TA 3ONDA 2ZB8A 3G82C 3OZIA 1YCGA 1YDFA 4ZQHA 4N01A 5HKOA 3T9EA 3K20A 1XWIA 1YR6A 4KXFB 1S8AA 3RPEA 4DDUA 5F21A 3VPAA 4K9RA 1JT2A 4Y30A 5IBQA 4FYMA 2Q6KA 3MSCA 3QF7A 1HF3A 2DQSA 3I6ZA 1GPJA 1IYZA 4JJIA 3RGWS 1B6RA 3DT9A 3QBVA 3UAOA 5CD1A 3EA4A 4BVAA 4I5EA 5KOJB 1KVTA 3JQEA 1U5BB 2FXVA 1E0KA 3TZEA 1EH5A 4X5OA 2FSGA 2QLTA 4X45A 4GM0A 1CE8B 4DIFA 5AVTA 1K3TA 1EJ6A 2EP5A 3IP6A 4YLEA 1FUEA 4UXHA 2H1VA 1LA2A 4M3NA 1U0LA 2REXB 1MA3A 2FWPA 2OFPA 2G4LA 4BKOA 2Q1SA 4KR9A 2ROQA 5F78A 3VH2A 3G8DA 4E70A 4Q4HB 2OB1A 3OBIA 4R2IA 3LGXA 3GHHA 1AN9A 3FVRA 2R2GA 4K7JA 1NN1A 2NSLA 3JATA 5GZ6A 4K28A 1FNMA 4TN1A 4B84A 2A5JA 4EJSB 3D3WB 3U7FB 1Z4PX 1WF3A 4NABA 4UULA 1HNXB 1HXHA 1KNXA 2WVJA 4NCNA 4WGGA 2DLNA 1GVHA 2XUHA 3OLQA 4EZEA 2F9MA 4PFSA 5TX7A 1ND5A 5JMTA 5HKKA 1FFAA 1T6XA 2RHLA 4IF6A 4RLSA 2ZRGA 4PVCA 3LY8A 1PVOA 1J42A 2ORYA 1C0KA 2PZBA 4JKOA 4CRWB 4JCCA 3OT5A 1FUYB 1IBSA 5A4DA 3TSCA 5KTPA 1T3SA 1NI4B 3O47A 5B37A 3TSZA 4CMKA 1ZOLA 1XMQB 1E79D 4FWIB 4QUEA 2O0LA 2CLCX 2BUBA 1DLIA 4INAA 3UMFA 3HJBA 1IW4A 3BMXA 3ZDXB 2D2FA 3AM5A 4TKVA 3ZZ0A 1DO2A 2C4HA 4LQDA 3BUSA 4FLMA 4JOSA 1W30A 5DRYA 1UJ6A 2YJGA 1H4SA 1C2YA 5DNYB 1MNAA 5U4XA 3D4IA 2H1OA 1I3CA 4YT4A 1ZCZA 3O94A 3OOEA 1BXRA 4KU4A 4Q37A 3VNSA 3ORYA 2DKNA 3PWTA 1IDN1 1L3CA 2Q49A 3OPMA 2XB8A 4MCIA 3E03A 4QQNA 3HH8A 1VYHA 4ZC8A 3OQIB 3RSLA 3ZE1B 2FAXA 4GZLA 4HC4A 4P36A 4R2KA 1J24A 3A28A 4HG2A 2JH8A 3GZTB 3O75A 4YCNA 3MINB 5A6SB 2W8BA 4MUNA 1YAHA 2WG1A 5FBWB 2OCLA 4KAFA 4L7VA 1LTKA 3I53A 3C7AA 1NFRA 2IITA 4K9QA 4MW4A 1MH9A 1RRGA 1NMEA 4HUQA 4M0KA 3TR0A 5THXA 1SXGA 1XZ8A 3IDAA 3WKAA 2FEKA 2W2LD 2PDAA 3EZNA 2RE8A 2GYWA 1M76A 4QT0A 1K98A 1DU4A 1M8GA 3BC1A 1CYDA 3CLUC 3QJGA 2CL0X 4RA9A 4MTLA 3CRZA 5IDVA 2NU1I 1SVUA 3OHMA 4JB2A 5H68A 3WGJA 4N3AA 3RM3A 1ES9A 1T8RA 2V4MA 4FIDA 4M1QA 3EN0A 3AGQA 4V0LA 1EWKA 1Q22A 5GQSA 3TAUA 3TLBA 1E58A 5JPCA 3LY5A 3RS4A 1RWKA 1V8FA 3ORHA 1PV4A 1II9A 3FPEA 4L02A 2G1AA 4CQMD 1DO8A 1Q0SA 1LU9A 4R51A 2ZVQX 4XWAA 3J80A 2FVXA 4BNKA 5JEEA 2MDTA 3F7OA 1HFJA 1IZ8A 4DCOA 2EW8A 2YMLA 1OVOA 2IYOA 1RHKA 3NT2A 1LQUA 2P5UA 4BNDB 2QI9C 1ARZA 3DFFA 3E9ZA 3GZ4A 1X80A 4CMAA 3I58A 4I9HA 4LRXA 4QDXA 5DMHA 4QELA 3FBGA 1WB6A 3GJZA 4IJVA 2P6PA 3ZWMA 1Q3KA 2FH5B 5EJ6A 4UMVA 3AVOA 3S8YA 3EXHB 4YMVA 3QM1A 1CRPA 2DY1A 1V16B 1L4YA 2ZE6A 3HN7A 1IK4A 1FU8A 3PDIA 1SCUB 3RRYA 5ALMA 2CLMB 4OHMA 1P2DA 3C6ZA 3DOFA 3PLNA 5H9VA 2HIHA 4GZ6A 2Q7OE 3E82A 2ZYHA 3PQ3A 4FXPA 1L5OA 2SGDI 1F4LA 1C3XA 1RYFA 5IANA 3AWIA 3V46A 5HUHA 3UQZA 4HMPA 5JBNA 1RS0A 5JRZA 3GXOA 3ROFA 1H9BA 1E5XA 2VI5A 4UHBA 1DRKA 2DPMA 4O0LA 4AICA 3T99A 2PKQO 3CF0A 4ZYVA 4DKXA 4AKHA 3T5DA 1PJRA 1D2MA 4QXQA 3ZGYA 4QBHA 4KO3S 1RAEA 4NP6A 4S0XA 5DGDA 2RHGB 3VPHA 3GI1A 3QOYA 5CGQB 1QQBA 1W6RA 2BH2A 3G0HA 3AL0C 3SKXA 4OU5A 4BVKA 1QV6A 2Z09A 1SFRA 1P9RA 2ODAA 1JP7A 2QQFA 3BMCB 4QU8A 2IHNA 1UR5A 2HBYA 3HDVA 4PF1A 4ZU3A 4A6XA 2X9NA 1V8BA 3DFZA 4CTKA 4WINA 1VQ1A 3I62A 2R4TA 3OQBA 5MN6A 2DMRA 5B7GA 4IAOA 2F4NA 4KRYA 3NBFA 4J16C 3DBVO 3KB6A 1DAKA 1Q6ZA 1ZA2A 3PFKA 2X0JA 3EUEA 3WRXA 4B5KA 1DTEA 2CY0A 3IP7A 1OWPA 1Z08A 3BIOA 3LT0A 4PLYA 5EGSA 1ODFA 2R7LA 3AFHA 4F4FA 1MO5A 3PD0A 3QEOA 1A98A 3C3MA 4OHVA 2M2IA 2NVUB 4D8YA 1KRXA 3VNBA 3B3AA 4RTNA 2ATIA 4KN6A 2GTPA 2O3TA 4PQRA 3BMQA 3BRSA 4V2UA 3HKEB 2H54A 5E3PA 3OUTA 1HY3A 3JQCA 1E1RA 2E3JA 1RU3A 2GCNA 5EKTA 3D1LA 3U4IA 2RGRA 3OE7D 3B82A 4HEA6 3RJTA 2BGNA 3SJZA 3K4HA 3N8HA 2PMFA 4KQ1A 2BSQA 3P71T 4J75A 1CG6A 2EQ5A 3UHPA 1RCUA 2PZKA 1NXOA 1WCV1 5ES3A 1Y0BA 1PTRA 3X2FA 2FMUA 4IJ6A 2B1QA 2GLXA 2QLBA 2RIPA 4WXYB 3JQFA 5HRCA 5HBGA 2HDOA 4M1TA 4EG4A 1W2HA 3DVRX 1RC0A 3LLCA 3FSEA 3V2GA 3VTFA 2I2AA 2AB0A 4QJ5A 4BRSA 4EVQA 4NKRA 2YY7A 5CAEA 1NUQA 1N9GA 1MNQA 4D74A 4OD0A 1EZZA 3K0KA 2GZHA 2HIGA 3E1KA 5JCOA 3DE6X 1C7IA 5DV9A 4B73A 3WLSA 1P3DA 4C6RA 4R8LA 4RIGA 5ALRA 1W4BA 1ZSYA 2KB0A 5D1HA 5F2KA 4KREA 4K6KA 2I33A 2CJSC 1X6VA 1Z35A 2FFHA 3JPYA 3UZUA 2AG6A 4Y2UA 4HV4A 1D1SA 5K6RA 3QPDA 4TMKA 4DR3B 4REOA 3GDWA 1MHPA 2GN1A 1SBCA 1TCCA 2O8BA 1I7NA 2IYQA 1Y8RA 3DEKA 4RF2A 5DBIA 4Z4HA 2QGNA 2YUUA 1HT1E 3TF5A 1GN8A 1E99A 1T26A 1BHSA 4DAOA 3D4PA 1XPRA 4B80A 1BE1A 1Y6JA 2QE7D 2VK8A 1P9ZA 1UBCA 3BH6A 3C8MA 2O6HA 1N4AA 3CLRC 3SD7A 4QIHA 4RULA 2WK1A 2PT7A 5L6MB 1RZ3A 2C03A 1YRYE 2CD9A 2IYEA 4IFIA 4KI7A 4MSUA 4RF4A 3VZQA 5K0GA 3ISTA 5E2AA 3T3PB 4I8DA 1JS1X 5KEIA 4Y6PA 4YH1A 5CLFA 1DBSA 1IONA 3DM5A 4LNAA 4NZZA 4ZCRA 1LRLA 5LD2B 2V9PA 1C9YA 5T41A 1XEXB 1NBME 4IRXA 3IALA 1G3IA 4FCCA 1FNSA 2I7VA 3QJYA 3GLFE 1XRMA 2FJPA 3W79A 1E9DA 1QYXA 3ZK9A 2C4NA 2RBEA 3V55A 1ADYA 2PMDA 4J0QA 3FUXA 4KWEA 5ALSA 1Y48E 3JZAA 2OZUA 3QFFA 1QQTA 3IV9A 3QKUA 4NEGA 4KPFC 4DAEA 1EM6A 3E59A 4QO7A 3AM4A 2FJ0A 2VYVA 1WSWA 1FTSA 2CJFA 1UF9A 2Z1DA 4NMLA 3K3PA 2BTEA 3EWIA 1IQRA 1BDHA 2UVDA 3T3GA 2XDQB 1AGYA 2DULA 1NJ2A 4X60A 5FBLB 3VFDA 3ZNQA 4AWAA 3G2MA 3N9IA 5CFQA 5A3VA 4INZA 1YFLA 2B9EA 4R2WA 2H92A 2OAP1 1GTL1 4C6SA 4F96A 1QFXA 1DGQA 4U0KA 1KOLA 3ETEA 3G2LA 3U3DA 4DPMA 1BRTA 4DCVA 1X7XB 1X9HA 2Q3MA 4LRSB 4P5EA 4YFVA 3T5PA 2JVIA 5CLJA 2PD3A 3C97A 4C01A 3R6TA 4PBSA 2HYDA 3K5WA 1OFUA 1YZVA 1HG1A 2ZWAA 3CA8A 3DVLA 4P5DA 4UAVA 5AW5A 3RRFA 2R5NA 1EJBA 5IT5A 1AMUA 3OIDA 1IPEA 2P3LA 2GVNA 3G0IA 3L9XA 5NULA 5CDUA 4OI0A 1YT5A 1Z6QA 1FX0A 1PF7E 4DQVA 2ADOA 5HJEA 2QN9A 1K86A 2I6QA 2ZUWA 3QU9A 4HNGA 1T9GS 1E2MA 4PLVA 2FZEA 5DGTA 2P2YA 3PE6A 5HTKA 1SCKA 3R7SA 3UTDA 3ZHXA 3DNMA 4JSRA 4UEJA 1CWUA 4LYYA 2G83A 3RJMA 4DN6A 4YT2A 4UTNA 1B7GO 1FP2A 4CG0A 5SYMA 4UM8B 2HXSA 1SUEA 4BXOA 4I4NA 5BN1A 2Q3HA 5C2JB 3EWSA 1Y1TA 1D6SA 3PXDA 2C54A 4OOEA 1DAGA 4LJAA 3KCNA 4OSEA 3KKMA 1V4BA 3DWIA 1RC1A 3R5JA 4Q5IA 5A4MS 5J1SB 2QXUA 4JXXA 3CSSA 3CG4A 4BNMA 4HB0A 4JLSA 4G0UA 4OJQA 3HDJA 1EFCA 3N7AA 4K5QA 3WLLA 5E6RB 5D3ZA 3O1LA 1U2RA 1QVVA 2OENG 1DG3A 2EZTA 3SE0A 1CUYA 3IQIX 4GMXA 4IUCS 1MVNA 4WZBB 1OU0A 2ZT7A 4EEKA 4RD1A 3Q2OA 4F21A 4R71A 3P9XA 1EK1A 4NXNB 5F3RA 2DPXA 3RGGA 4V0SA 2DX7A 1Q19A 2OV4A 3QBTA 5DHSA 4CI0B 1JR6A 3H5LA 4TLBA 4RFSB 4UQPA 3GNQA 1EM8A 3R20A 4TTIA 4GMDA 2O8EA 3TIVA 5ENZA 4RIEA 1KOFA 5CDTA 2MTBA 1OZHA 1Z75A 1Z34A 4DIOA 1RMQA 1QNLA 4MUXA 4BP1A 1PTQA 4BNHA 1G20E 1JPVA 5CFMA 3F90A 1ZD1A 1IRIA 1HDOA 3DZIA 1T9DA 2OD7A 4RHEA 2QTRA 3RJZA 5HCIA 3AKCA 1UL1X 1VIVA 3PWSA 5DM0A 3ENKA 4PPFA 1DS6A 3W3AD 1XMXA 1P2FA 2BZSA 3PC2A 4R5HA 4R7ZA 1CQJA 2XAUA 3VU8A 3E4CA 4DARA 3TTSA 5EGNA 1GV1A 2X5NA 4PPQA 4W5NA 4B09A 2B7BA 2JIOA 2O2GA 2J08A 5AUOB 3BJZA 1VIYA 2CLFB 5JFTA 5M7EA 2IELA 2VHXA 2V97A 1YA6A 1V1IA 4W9RA 4C1NA 2VDWA 3JTMA 1JDBC 1GYQA 2H85A 2PWYA 3PQFA 4JOCA 4M8SA 1E5LA 1OHHD 1GGKA 2C1EA 2WOOA 1FFXA 2XUPA 1KHTA 5DNCA 4B31A 1TCBA 2DQZA 4AM8A 2IUEA 3AEQA 3EE6A 4JS0A 1FDRA 1NURA 4RMGA 5EERA 2RD2A 1J56A 3GJ3A 4PLHA 4N47A 3WQQA 1F0PA 1XL1A 3HO8A 3SU8A 2QN3A 4ATNA 1M34E 4RHYA 5CEFA 1UQTA 1GAWA 4FN5A 2IZ1A 1K2WA 3TO9A 2WWXA 3MK31 1QRDA 4IDFA 4ZO6A 4PN3A 4DSOA 4PRZA 5BSWA 2XCUA 4OKNA 3VDUA 4G67A 1A50B 4QE3A 2NP6A 1PG0A 4RTPA 3BBPA 2IWHA 1N0VC 1H8HD 3WLOA 5I8PA 4DA4A 1NUHA 1LF0A 1YGYA 3FYCA 5JS1A 3UJ6A 1TM5E 2NYAA 2JVKA 3L7OA 2X0EA 4A8JC 1A9OA 1KZYC 5JPIA 5GIPE 4LHVA 2VG8A 3L4SO 3FZQA 2C9OA 3NYQA 4NL4H 3SBDA 4PPYA 4X8HA 4LCEA 4OQFA 2VHYA 5TS2A 1S2DA 2Q46A 3WGGA 2RHTA 2ZBRA 1XJQA 4X92A 1JPNA 1XZIA 1VZ2A 1PBNA 4LY9A 4PAWA 4EG5A 3OCWA 3L7DA 2Y1LA 3OFVA 5LM3A 1XTPA 3PUYA 4XJXA 8GPBA 1J06A 4GI3A 1SXJA 3WIDA 2FQXA 1E89A 5JSQA 2P6AC 2UZ3A 1Y7HA 1MJ5A 2A58A 1SVMA 1W2GA 3A9TA 4L16A 4ZHQB 1K8XB 3TSWA 5IABA 1IH8A 3R3YA 5I6DA 3MS4A 1RT9A 4LF7B 2QVGA 3FVQA 3LVQE 4R8KA 5DXJA 2FUEA 3WJ7A 2ZJAA 4L7QA 2PXXA 3E84A 5ULLA 3K9WA 3C3YA 3ETJA 4RAOA 4RX1A 3CB4A 3CNBA 4ZRMA 5L6LB 2Z83A 2R3SA 4R41A 3A1NA 4UJ3A 2CLDX 3PLRA 2QVBA 3COJA 1DFIA 1WOYA 4TTVA 3VHRA 3QY9A 4P4SA 1VIDA 4PU0A 1IOZA 3D81A 2X6QA 3CF6R 1BCRA 2YYYA 3DXXA 2FN4A 2E87A 4YAEA 4DSNA 4TTRA 2I3AA 1KAGA 3G2IA 3MJRA 3V2HA 4F3RA 3T1VA 1DOAA 2W7TA 2QUBA 3I30X 3N0XA 4EARA 3QBDA 3I32A 4RENA 4ZVPA 2A0YA 1HNNA 5A04A 1OU4A 4EG6A 3V6MA 5IKPA 2C4VA 2N52A 4E5UA 2PLWA 2AMLA 5A1JA 4GLBA 4QNNA 2CCJA 1RXIA 1SHKA 2JGRA 3CZCA 5BOVA 1WXFA 5IARA 4KGVA 3WRYC 4YP6A 3HU2A 3MTGA 4WVLA 2RK6A 3K5HA 4HAVA 2CSUA 2YNMC 1JFFA 3GHYA 4LZAA 4G63A 4Y1EA 1W47A 3DG9A 3KTFA 5EMMA 1NY6A 4TT8A 4KR6A 1JN0A 3I9FA 3JXEA 1HDGO 1KTVA 1L4FA 3O7WA 3PTZA 2FR1A 4YAWA 1C4XA 1Z82A 1Z36A 4MUGA 3B1XA 3AETB 4F2PA 3OX2A 1KYQA 3UXEA 4Y6QA 4YMGA 5IMSA 4DA6A 4G0MA 1BTOA 1IOVA 5C7OO 2CZGA 4DV6B 4F8EA 2ZR0A 4UC0A 4ILEA 4FKZA 3WL6A 2OFOA 3D6AA 1FMTA 3KYJB 4MWTA 3SZRA 4DM4A 3NEPX 4EFLA 3E3OA 3SJ7A 5C8XA 1QF7A 3FTNA 4FW9A 2C9ZA 1I0ZA 3CLSC 5DX0A 3TPZA 1Z63A 1X1DA 5CFPA 1JQAA 2EZ4A 2JPDA 1RQRA 3K0FA 3U81A 1VL1A 4EYGA 1IULA 1B8NA 1PFYA 1CDEA 1JU3A 2V6MA 3H5NA 2BLLA 3JRWA 4PC7A 5LZ5A 1K5HA 3RTAA 4AYWA 1D3AA 4ERXA 3DHWC 4H2DA 1O8BA 1Z4NA 1NI5A 2IOYA 5LIPA 1NGSA 1YI8A 4K86A 5EZQA 4DXHA 3LHFA 3QG5A 5GGXA 1DQSA 3HACA 3EPJA 2IZ7A 1EPUA 3HG7A 3QTLD 2XITA 4XYMA 1T9BA 3MWDA 1ZJ6A 5BUZA 4K9PA 1KK3A 2ZR9A 1P5FA 4JENA 1WGTA 1Q20A 1SGWA 3MD0A 3RHTA 2ID9A 3QMVA 3K1AB 1LNSA 2P40A 4R9RA 1OV4A 4H0NA 3QKRB 3MJFA 4U2KA 1REQB 3FN4A 2C1XA 2AEEA 3MS7A 4ZO9A 4C0JA 3ZTTA 3K7EA 5LJLA 5KMGA 4MUYA 1YS7A 3ADBA 1SHZA 4PRYA 4G0XA 3LKVA 4B40A 5IM4F 3R5DA 5HK8A 4X84A 5KZMB 4KQKA 2BJWA 1G7TA 1DEKA 3FHCB 4E33A 2DECA 3TI9A 2KW5A 3OKCA 4L4RA 3U0VA 4WI1A 3BQMB 2O0MA 3ZKAA 1IZ0A 2GF9A 2Q4RA 2XCQA 3OCXA 3JASB 4YJHB 4UNIA 5SYAA 3BYZA 2GN0A 2ZXFA 1DEXA 1N2CE 4M0FA 4MRRA 5JANA 1B8UA 4GM4A 5L95A 1BWRA 1Y8QA 2WIKA 2LCIA 3NJ4A 4KTTE 4Q4JA 3T38A 2QRVA 4MRMA 2ZDHA 1G21B 4AFNA 2VPXA 4IY1A 5IVKA 3B1KA 5K0JA 1M6HA 5IKOA 2I99A 3ECSA 1J5XA 1EIWA 4PQFA 1Y8AA 2CVZA 2BCEA 1ZVQA 1ZO8A 4U2DA 5MN4A 3OURA 4LJ6A 3D0RA 5JALA 3H0KA 2FHSA 3LVBA 4Z0PA 5A2GA 4LC0A 4FZJA 2IBMA 3FNRA 2I03A 1YBAA 5ED0A 3EMDA 4NLLA 2OPBA 1F6WA 5HKBA 4A5SA 3B20A 3D6VA 3WNQA 1Z2EA 3K09C 4YYEA 5TQ2B 4P93A 3I37X 3FFBA 1XYYA 1UKAA 1DIBA 3ICCA 3LOQA 3MJCA 3DEFA 4MKGA 4CG3A 4YUAA 1EP2B 3P19A 4MW1A 2YV4A 2GBGA 2WWFA 1SKAA 4Q4AA 3EUWA 3RIXA 5CUQA 5JDCC 1IB0A 3IDFA 1CJKC 1E7YA 4BWYA 2OHXA 2HA5A 4B4WA 1LBEA 5UKDA 3EXFA 2C2MA 4OREX 1SC3A 5KWJA 3F6BX 3GK3A 3BD7A 2VF4X 1BAPA 1JEDA 1M2JA 2GZMA 3E5RA 1JKMA 3Q6IA 5EYPB 5K0BA 2XCTB 4Z0NA 1I2MA 4DIBA 2HXYA 4U6QA 3WV4A 4OF4A 2OV1A 2P6NA 3PIIA 4X24A 5F1KA 7MDHA 3CSDA 4MHOA 4CLOB 1CUCA 1EE9A 2ZKIA 2WF8A 1TF7A 5K0ZA 3DOIA 1MGOA 5BPHA 4JV5B 1F51E 1W44A 3AIKA 1VJDA 5KOHB 3MWEA 1QHHB 1R3DA 2WINI 3WIVA 4C4RA 3IMFA 4CMCA 4JJGA 4UHHA 4D02A 4AMZA 3NQ41 3RFUA 2YWDA 3FOFC 3A36A 1EFLA 2OP0A 4RV5A 3S70A 4RMHA 2I55A 2UDPA 2WV7A 4CIXA 4ZMSA 2LV8A 2HTFA 3UOAB 5A62A 1MABA 1ZD8A 2AIRA 2G06A 3BTSA 5C8YF 4G81A 2HJVA 2RHDA 4UU1A 2Z6VA 3WL8A 1GA4A 3VNQA 5C80A 1LWNA 1XXHE 2CCGA 4KV9A 5ALVA 4YRMA 4I08A 2CNBA 3P96A 2ZB2A 3AYZB 3C3EA 5AVJA 5J23A 1GUBA 5DWVA 2Q3FA 4MR8B 9ATCA 3WWZA 4BLTA 3C85A 1ZHOA 3LUAA 3EAGA 1ZSVA 1RLMA 4ZJUA 1GD1O 1XTBA 2YZ7A 1B4DA 3C7CB 4MWZA 4X7MA 4RK4A 5ILQA 3WIBA 5AVYA 1WETA 1OA1A 4B3XA 3RW9A 3JWHA 3LUPA 2P2SA 3NBXX 5DW3A 4QFBA 3GN2A 2O7VA 3R0IA 4Q0MA 2XNHA 5DDIP 3DEZA 5DYYA 4DMCA 3B1WA 2GZ3A 4IIEA 5D7BA 4JJ6A 5IWAB 4Z54A 4DT1A 1XZNA 2YIMA 5CDFE 3ZJYA 2ZRNA 4NWIA 4C4ZA 1DQYA 1A2OA 3NX4A 4FYHA 4DLVA 1Y8FA 5E9QA 5AW6A 3L93A 3H11B 4WN9A 4AJKA 1FYFA 3G8BA 3VC1A 1UBHS 1JILA 1GR1A 3S44A 1R4MB 2FPIB 2OZKA 5LP1A 1LQTA 5F98A 5EQDA 1QK4A 1W581 1Y6QA 1W8IA 4V1CI 3HVRA 5DHQA 4DV7B 2PQ2A 2VSXA 1N1MA 3PNMA 1XEWY 2YYSA 3ZK7A 1JRLA 3DULA 4ITRC 3FTCA 3M1IA 1XKTA 3QPUA 2BTQB 2E4UA 4OATA 2OO5A 3TLKA 1H1TA 3TKLA 3AY6A 3TIGA 2R6GA 3FR7A 3OZWA 4KDFA 2HCFA 1LKZA 3PV0A 4NV3A 1IJEA