4UXJA

Leishmania major thymidine kinase in complex with dttp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
167
Chain Sequence
RGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSDQLMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSKQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structural and Kinetic Characterization of Thymidine Kinase from Leishmania Major.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 47
structure length 167
sequence length 180
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4uxjA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4uxjA01
2CVFA 1K5DA 2MSDB 5A5GA 4MKGA 5KSYA 1KI6A 4DIEA 1AM4D 4NH0A 5AR1A 4NP6A 3DM5A 3QBTA 1GFIA 2ATXA 3O8DA 4L5BA 1XMVA 2VBCA 4PC3A 4PC1A 1KI7A 3GJ8A 4HLDA 2B21A 5SZJA 2AWNA 3GLHA 2ATVA 2GZAA 1G4UR 3L0IB 2GNOA 4FCVA 1VCOA 2J0UA 3CR7A 3W8NA 1HUQA 3HYRA 3RAPR 3K0CC 4LJ8A 4B44A 4HAZA 2OG2A 2V1UA 2FE4A 3THWB 3OE7A 2WAXA 4TTQA 2YVUA 3LRPA 4IEIA 1TBNA 3IHLA 4A0RA 2FDCA 1U81A 1DEKA 5AUQA 4ZKDA 1VKJA 1OLOA 1AGRA 4MRPA 1KNXA 3PCRB 1SXJB 1U0HC 2OFXA 3W5JA 3IIKA 2J7PD 4TMZA 1TU4A 4DEXA 3EIEA 3Q8XB 1N5JA 4LGMA 3SC3A 4IKEA 4JT4A 2QRNA 1OXTA 2RB4A 2ROWA 4TZ6A 2WOOA 1RZ3A 3I73A 1NN3A 1FAQA 1S96A 4G3XA 1XB2A 2UZIR 4GT1A 2E1RA 1U8YA 4FINA 1P9RA 2Z6VA 4RCYA 4HLUC 2J7PA 5E7IA 1E2JA 1XD2A 3OEHD 3KQNA 4ZDIA 1O87A 3EXAA 3T15A 3U44B 1G7RA 1RRFA 2VEDA 2J87A 1Z28A 2GF0A 2ZJZA 3L0OA 4TL6A 4WOPA 4JBYA 5HTKA 2FSHA 1XD8A 4C0LA 4XWKA 2ZRLA 4FMBB 4HZUA 1KOFA 1CS4C 4GP6A 4QL3A 3TR0A 3ZZTA 5HCIA 4MYCA 3E2IA 3OEHA 1ZC4A 3AP3A 2QAJA 2DFKB 4L16A 4B6DA 4JYBA 3X1ZA 4QFMA 1K5GA 3FFBA 3V9PA 1G21E 2YUUA 2LCFA 3R8CA 3UANA 2YNMA 3W6NA 4DCNA 1D2NA 2JLRA 1LF5A 3UK6A 1CJMA 1GNQA 2NO6A 4FCTA 3DVLA 2DR3A 4AG5A 1KO4A 1E2EA 5CYPA 4LY6A 2WWIA 3BE4A 2ZU6A 3H2YA 3EPLA 2QRZA 4D0GA 1L2TA 2DHRA 4GPTA 4HLCA 5EE0A 5K8IA 3ASZA 4GZLA 3HR8A 4D80A 3BC1A 2BKUA 4CEHA 1W1WA 1XWIA 3AQ4A 3T5GA 4MKIA 1KBFA 1X1SA 4KJZA 4AIIA 3AV0B 3MCAA 2ZYTX 2GK7A 2QE7A 1XXHB 2IX3A 3KKQA 3W34A 2ODWA 3RABA 1CJKC 3AF3A 3LO5A 3R7WB 4EAQA 3B1VA 5K8UA 5B30A 4MGIR 1Z08A 3TQCA 1GL6A 5GJVC 1NMZA 2OBMA 1DAKA 1UKZA 1E2IA 3IEUA 2CHQA 3RWOA 1XBTA 4A2WA 1M2OB 4OK3A 2DCUA 4BASA 4DDUA 2ZRBA 3TSZA 5CB6A 4LSGA 3T1OA 5JI3E 5H8WA 1OFTA 2ZYUX 2VP4A 1EWRA 4GBMA 2QT1A 2ZRHA 2P0EA 4RZUA 4Z1MD 3L2OB 3K9LA 5JJLA 4XD7D 4KITB 4NYJQ 3OESA 3CF6R 4PANA 4V0NA 4JVMA 4V0LA 3ZQ6A 4H9GA 2FZ4A 3QXSA 4QC2A 1RC8A 1I4LD 2IYZA 2LWIA 4OBEA 4Z1MA 1R5OA 1H65A 2ZE8A 4LBWA 4XD7A 4E03A 1S8FA 5AJXA 1OW3B 5FBRB 2HF9A 1GZSA 5EXSA 4GZMA 4TT3D 4C0BA 2FSIA 2RGGA 1AIPA 1N5IA 2X19A 1QHIA 3ND9A 3VR4A 3EZFA 3W3AA 3GLHE 1W4RA 3LQRA 4W5HA 5EXTA 1KO8A 1KMQA 1JAHA 1Q3TA 3CM0A 5HE9A 2QMHA 4Q1EA 3X1YA 5JECA 3UEJA 2J46A 4LBVA 1GOTA 5FI0B 4JLNA 2ZETA 4TSFA 3CNLA 2IYVA 1QHNA 5P21A 1XTKA 5KDLA 1SULA 2OBNA 3AVPA 4YXWD 4TL7A 2YOFA 4OKSA 2C2HA 3AKYA 3QE0A 2WJYA 4R2IA 2HCBA 2HJVA 1UEIA 2HYDA 2IW3A 2XOKD 2Q9AA 1KJZA 4B43A 1N6IA 1RJ9A 2F1IA 1NKTA 4TWZA 4IOMA 1BYIA 4LHYA 3FTQA 4DLXA 1FUKA 3W8RA 4TZ0A 4YXWA 1KNQA 5FUYA 1E96A 4YMSA 4Q48A 3K0FB 1Z6AA 1XD9A 4LHZA 1HURA 1TUEA 3AVUA 4MYUA 2ZJOA 4CT4B 2BBWA 3QXXA 4URUR 2GHIA 2O0JA 2IL1A 1YU9A 6Q21A 2IYUA 2QPOA 4MGKR 4JKIA 1KDPA 4DEYA 2JCSA 2IYLD 5EP2A 4BEJA 4LOAA 3KDSE 3REFA 4NCHA 4UXHA 4MH0R 5TY0A 2CLDX 4UJ5A 4RD2A 2GCOA 1YVDA 3BB1A 4I1VA 1DADA 1A2KC 4QGFA 4X8OA 1OYYA 1P2SA 2AFIE 1OFUX 2A2ZA 4M1MA 2FZLA 3EA0A 3KUDA 2NG1A 3T5DA 5BYKA 3TSWA 1MT0A 1ZNXA 2VQSA 1P6XA 2I4IA 3BFVA 4G5RA 4HB3A 2A5GA 3IPXA 1TQ4A 4L9WA 2F43A 2X2EA 3I1FA 4JSTA 1CIPA 4KSCA 4ZDWA 2GK6A 1VHTA 4EUNA 1QHHB 4QGGA 4B3DA 1FARA 3LQQA 2HF8A 1YZQA 3NBZC 1E2DA 1FNNA 2F3TA 1Q1BA 3RS2A 4YQFA 4URYR 4IJMA 1Z3IX 4BFWA 3THXB 3G5UA 3GJ7A 1A4RA 4HYYA 1SXJC 5UKDA 3CRVA 3KQKA 4QM6A 3K0EA 4EPVA 2W58A 3LX5A 5JZVA 4I81A 3PFIA 3ETLA 3LDAA 3WRYC 1P2UA 4CEIA 5FOTA 5JWHA 4XOIA 4URVR 4DVGA 1JXOA 2CE2X 3TW4A 3PEUA 1PLJA 3WBJA 1CRPA 5G3ZA 3Q7PA 1KMHB 2CBZA 4NMMA 3WMEA 1FNMA 1FW6A 2J0QA 3QI2A 5TV2A 2ZS8A 1G5RA 1OHHD 2ZM5A 3GLFA 1G7CA 5FTKA 3T1TA 2J0SA 1ZRHA 5KNCA 1G7SA 4ILEA 4JIMA 2GEDA 1E4VA 1KJWA 3RNLA 3BRWD 1E9SA 5L3VA 4DLWA 4O2RA 3I3SR 3K9HA 3CZQA 4A2QA 2K5UA 1E1RD 1IY2A 1OHHA 3RVBA 3TE6A 2ZRJA 2XXAA 3SE0A 3BJIA 1OFIA 2RHMA 2IS6A 1X8LA 2AK2A 3AVTA 3ZS8A 3X1DA 2WZQA 1TEVA 3C4JA 2OBLA 3QXJA 4M1TA 4HLQB 4NYIR 1E1RA 2JJ2D 2ZS9A 1NVVR 4BECA 1F3OA 2H1LA 5FR1A 1IN6A 1TMKA 1UKVY 4DUGD 1E0SA 1ZD1A 4LI0A 1EGAA 5J5CA 2BJWA 1T91A 1T3LA 1Z06A 3I5XA 1AKYA 3G82C 2ZR7A 3KJEA 2ZRIA 1KBEA 5FPTA 2JJ2A 1KGDA 2EYQA 3W6PA 2WIAA 3KL4A 5FBVB 3ZGXA 4UKDA 1FUUA 2GXSA 1AA9A 1ZMXA 3LBHA 4DUGA 4ZI2A 1IN5A 3N2EA 3LFUA 1N0WA 1R4AA 1UBGA 4U02A 4EQ6A 2EWWA 1QHGA 2ZSAA 3CF2A 2GEUA 3DKVA 3LBNA 1CKEA 2L0XA 1OXSC 4KXFB 1GDDA 4Y0AA 1T6NA 2B8WA 2JDID 3ZZ0A 5JLJA 1G19A 1AS3A 3P32A 2IWRA 4EPWA 5C4MA 4D25A 1BS1A 1Q3HA 3UGLA 1VCIA 2O8FA 3BH0A 4PXAA 2VPPA 2IYYA 1KZGB 4C3ZA 1US8B 1DVRA 1G64A 3DM9B 3RHFA 2JDIA 1K6MA 1ZUIA 4KODA 3DO6A 1T5LA 2ENNA 1ZM7A 2X8AA 4Q7JB 1I2MA 3PUVA 1FOEB 1KI1A 2ZPTX 1IXZA 3GJXC 4BFSA 1E6CA 2ZANA 1F2UB 2G0TA 2XB4A 4M9XA 1O3YA 2IA5A 4S2EA 1D8TA 2GESA 1M6NA 2F9MA 1KSFX 3MWKA 4EPXA 1ZINA 2VHCA 4PAOA 2V7QD 4F91B 5GJBA 1Q57A 3FOZA 4QKQA 4QRHA 3VU9A 1IHUA 5FPYA 3SEAA 4DHEA 4OJKA 1NJFA 5CIWA 1KY3A 1UPTA 4ERNA 1LB1B 1DTSA 3SQWA 2BKEA 4AKGA 1TF5A 2V7QA 2VO1A 3QKSB 3AGQA 1YR7A 1CF4A 4B48A 1E98A 1SKYE 3K9GA 1EXMA 4PPNA 2FOLA 1OXXK 3B8HA 1BIFA 2KB0A 1HV8A 2GJSA 1R5BA 2O0HA 4Q21A 4EFNA 2AD5A 3L0SA 3SBDA 4URZR 5JI2E 4A8JA 3THYB 5GADl 4LCBA 2DFLA 4GMDA 2QUZA 1NVWQ 2OCBA 3GFTA 4Q00A 4BLSA 2O5VA 2CL7X 4WZBE 1KSHA 3BBPA 4W9MC 2P6NA 1XTRA 1JPNA 2ZRMA 4DDVA 1HEIA 2IC5A 1U0JA 1NLZA 2JGNA 4AC9A 1OXUA 2ZYWX 3UIEA 1NG1A 2REOA 4AK9A 3GLFE 1OKKD 3B13B 4V0KA 2QNRA 1BYUA 5C18A 3Q72A 4ARZB 3GLIB 2RGDA 1A7JA 4BLPA 1GRRA 5FH9A 4V03A 1KO7A 3GFPA 2A9KA 3CUEF 1E79D 5EE9A 4AI6A 2WJIA 4Q4HA 4PC2A 4YONB 5CLLA 2C8VA 3QF4B 2JIZD 2WHXA 3KXIA 1FX0A 2R9VA 4EJSB 4YC7A 3NDBB 2JLUA 1U9IC 1XJQA 4HAVA 2FG5A 4NZYA 1P7CA 3E1SA 2FJUA 3FGNA 4IOJA 1KK0A 1E79A 4BLRA 4DCUA 4Q1BA 3U4QA 5G3YA 2JIZA 3NC1C 3MMPA 2EU8A 3KXLA 2P5SA 3CPEA 3V00A 1E9FA 2ZI6A 3RS7A 2W0MA 4RD0A 1WXQA 1KDRA 3FMFA 1COWD 1NSFA 4QNRA 4TYQA 4OJQA 3TUZC 4LJYA 2YWHA 3BH6A 3AUXA 3T1VA 1G7TA 3VQTA 2HLDD 2IYRA 1OSNA 1U2RA 1U94A 2WICA 4PQFA 4Q5IA 1VCNA 1MRNA 1OH6A 3WYFA 1TU3A 3FDIA 1CRQA 3AKDA 2A5JA 3QKRB 4G5QA 2J0VA 2GCPA 4IXNA 2PZGA 1DELA 2NPFA 2IUUA 1COWA 5D3MB 4NDZA 3UEYA 3C16C 2JATA 2WTUA 1WRBA 1ZAKA 4PHHA 2OESA 1Q21A 2HLDA 4Q4AB 2J5XA 4LBYA 1ZVQA 2H7VA 4KFUA 3SN6A 2YOGA 1J7KA 4V0MA 1DS6A 1R5NA 4C0AC 1VECA 2XJ4A 4X8LA 3NEJA 4Q03A 3NH6A 1XDBA 4M1KA 3CXLA 2OT3B 2ZTSA 4US2R 4OL0A 4TLBA 3UMRA 1F2TB 1JR6A 4DSNA 2WJJA 1LS6A 1Z2AA 4C4PA 821PA 4M4SA 2BHRA 1QHYA 3TW8B 3CRRA 2CLCX 2VIIA 5J4VA 3WRXC 3NHBA 2WKQA 3CIOA 1Z07A 3U7FB 4O25A 4W5WA 5DGXA 1Z0FA 2YWFA 4KHZA 3ICQB 2QZ4A 4I1UA 1BH2A 3VKHA 2QT0A 3IQXA 3SR0A 3D6TB 4B71A 4TYYA 1PUJA 3CR8A 3SFZA 5LD2B 4XVUA 1U99A 1QHSA 2ZRAA 3MWJA 4KCGA 1EFTA 5JMTA 2PZFA 3NDPA 3BERA 1G3IA 2E9SA 3AKCA 1DBSA 4Q4JB 4DB4A 1E94E 2OFWA 2BJVA 4NTZA 1RFLA 1NLYA 2C98A 2ZU0C 5IK2A 4WXRA 4B34A 3A6PC 2D7CA 4M22A 5BW8A 3A36A 1GNPA 1KK2A 3MLEA 4Q9HA 4JLVA 4BZQA 4F4CA 1I2DA 2NZ8A 3A4LA 4FMCF 3X1XA 1J90A 2P2LA 2B8TA 4GL2A 2QP4A 4Q9JA 2ZVQX 3DEFA 2IUSA 1OPXA 1NP6A 2RKOA 3HPQA 1CXZA 2ZJ8A 3HU2A 3QUSA 1G18A 2YYZA 5CLQA 2RH5A 3B9QA 5DI3A 4BRWA 4CRWB 3ND8A 2B7BA 2PJRA 3ZIAA 2JEOA 2HYIC 1N2CE 1UF9A 1MABB 1TX4B 2ZE6A 3MSXA 4PTLA 2DFNA 2XEXA 3IDQA 1QG4A 2A78A 3RDPA 4XSHA 5JRJA 5L3SA 3K0AB 4A36A 3VNUA 1WA5A 2DWOA 1E9AA 2ZRDA 4D4LA 2NO9A 3CNOA 1PLKA 4JLMA 1PZNA 1GIAA 2BMDA 3CH4B 4LHXA 2ZRPA 4DSOA 3KKPA 3QPUA 4TQAA 3TMKA 1TL7C 4ZIRB 3QPVA 2O8DB 3UPUA 1XMSA 4OHXA 1EX6A 1TQ2A 2GDJA 4FMCB 1Q12A 2VHJA 2EQBA 4C0JA 1EFHA 2RGXA 1YZKA 5KPJA 4NKRA 4BZXA 3QOFA 3EIQA 2A3RA 4LYJA 1U8ZA 1TEXA 3QIAA 4NU0A 5B64A 1G8HA 3JZMA 4C2UA 1HH4A 2BBSA 2OCAA 2ORIA 3C14C 3IIJA 1AS0A 5EE3A 2WVJA 3AVWA 4HDCA 2ZUCA 3Q3JB 3WNDA 1FZQA 1ZYUA 2GBLC 1KI6B 5HE8A 4AY2A 1E2HA 1TPZA 5TMPA 2QPTA 5FUXA 3TJZA 2CJWB 3KY9A 2ZIAA 4P0TA 1E2GA 2VSFA 5JRZA 1D9XA 4ZV4A 4I1OA 3CF0A 2P6RA 3QXCA 3U7EB 2EFDB 1IJFA 2QQEA 2AHOA 4D26A 2FFQA 1H8HA 1RPZA 4V0ME 2VH5R 3SFVA 3AB3A 1KKMA 4GSYA 3TUIC 4A4DA 1EK0A 3GFOA 5KDDA 3SU8A 4AD8A 4B76A 1YHNA 3VFDA 1P62B 2QP9X 3DZ8A 3SOPA 1HQCA 2ZRFA 3UG6A 2XNDD 2IF0A 2GAOA 4KSBA 3ZVMA 3NWJA 1E2PA 4OK6A 4HEJA 2F1RA 1U90A 1QRAA 5D3QA 4TTRA 2QG6A 3AH8A 2YOHA 4JMPA 1RYFA 1D2EA 2BOVA 2XNDA 3QENA 5FL7D 5H68A 4EJSC 2QL6A 3RYTC 2RGBA 1D5CA 5EXPA 2IXFA 4DSTA 1ODFA 2DWPA 1KI8A 4BFVA 1Z83A 5FBLB 2NIPA 2GJAA 3NIBA 4HZUB 4R7ZA 5FL7A 1IJEA 3B5JA 3PEWA 1E32A 1Z0JA 4E07A 1E4YA 1XEXA 3FVQA 4M9QA 4P3YA 3QY0A 3W3ZB 1M74A 1UEJA 1N6RA 1AZSC 4A15A 2ERXA 2OZEA 5KHOC 1XEWY 2B6HA 4PZYA 1J2JA 3D8BA 1IAQA 4LJ9A 4PHFA 2HEIA 3FMIA 1G3UA 1MO4A 2YWEA 3SDZA 2IS1A 4KFSA 221PA 3IQWA 4PAQA 5EXXA 5TARA 1NKSA 1X8KA 4UNRA 2QP3A 5M04A 4RZ3A 3IUYA 2IXGA 1DAEA 3D3QA 5E4FA 3RRMA 3T06B 3TBKA 2YINC 2RGAA 2O8CB 1E2NA 3VHLB 1HA3A 2EW1A 2C96A 4D6PA 2XGJA 3LXXA 1E9DA 3IEVA 3RC8A 3U44A 3ADCA 2ZJBA 5FOUA 3TGPA 1NG9A 3CPHA 4DRZA 2ZXUA 3NTUA 1P72A 2H18A 1ZD9A 2VP6A 4RD6A 4R98A 3NHAA 2FEMA 4NE2A 1E0AA 3FHOA 5B58C 2UVQA 4GFDA 1R2QA 2C78A 4BGDA 5AJZA 1JBKA 2OUKA 2B7CA 3VR5A 4ZKEA 2YWGA 1FQKA 2OLKA 3Q85A 2J59A 1BO6A 4UJ3A 2GCNA 1GRNA 1FL9A 2CE7A 5LD2C 4KVAA 2BWJA 4DWJA 4DDWA 3I61A 4RSGA 4US1R 4AYXA 2CMKA 2A5DA 5FL3A 4JKYA 2OEPA 4G5OA 3VMFA 1Z6TA 2AFHE 4DLUA 4MQBA 1KI9A 1XNJA 3SZRA 1KAGA 1W36D 1TQ6A 5DO9A 2UKDA 2R44A 1KJYA 4ESHA 3KFXA 1F48A 1XPRA 4BLTA 3LW8A 1RYHA 4ASUD 2P5TB 5JWRA 1E2KA 2Q3FA 3ZLJA 1XFAA 3R7WA 5HPYB 5KYKA 2NZJA 4RFSA 4DSUA 2J3EA 2CHVA 2Q9CA 1E0JA 3EARA 3EG5A 3LLUA 1NN5A 3OFND 4MITA 5C2JB 3I8SA 4RVCA 2O8EB 2MMGA 3WYAA 4ASUA 4JBWA 3GJ5A 1KSGA 4TMXA 4IDQA 5FTMA 5BXQC 2XZOA 1R7RA 3BD9A 4FWTA 1H8ED 2GVIA 1ESMA 1FPMA 2V1XA 4R2HA 3I8XA 2GEVA 4XVQA 4KU4A 2ZSBA 3CX7A 4TT3A 3EPHA 1UJ2A 3A4NA 1Q1QA 1XCPA 2ZRCA 4HB0A 3S1AA 2D2FA 1JXMA 1H8EA 1GKYA 2C9OA 3R9XA 3CWZA 1CP2A 2RGNC 2BCJQ 3V4FA 1W0KD 3L8YA 1Z6GA 4TYWA 4YMVA 1LV7A 3A4MA 1II9A 3GLGA 2QBYA 4GMXA 1E9EA 4B2IA 4PR0A 5EQTA 2DWQA 3CONA 3BIFA 3PUZA 1NIPA 1WE2A 3LNCA 4KAXA 1XTSA 4QJ3A 2NO7A 5KSZA 2PLRA 2E87A 2O0KA 1RKBA 5IRCD 1I4TD 2W83A 1E2FA 2XOKA 2CHGA 1GKIA 2VRWB 3CH5A 4FMDB 4XWAA 3DPUA 4OHZA 3AF4A 1R79A 4F4IA 2XTMA 421PA 3PUWA 1UFQA 1NJGA 3EAQA 4JT2A 4EKDA 1ZBDA 2RGEA 5CK5A 1VIAA 2XAUA 3L0PA 3MRSA 4LYHA 5KDOA 4OHYA 3RWMB 2QN6A 5HKKD 4JSYA 5AJVB 5EP4A 1GILA 1XEWX 2PCLA 4B2PA 1P73A 5E3HA 2G83A 3JZAA 1AS2A 5FR2A 4G01B 1F6BA 2O8BA 2G0NA 2V8OA 1UKYA 2Q0HA 3B6EA 3W6OA 5A0FA 5CB8A 3B9PA 1DAFA 5HKKA 3AUYA 1WMSA 1PTRA 1JI0A 2NQ2C 4Z8XA 3K9NA 3H1TA 2WSMA 3K0FA 4NYMR 2KJQA 4OHWA 1SKYB 2R2AA 3QF7A 1E9CA 2IBMA 5J40A 3MJHA 5EP3A 5KPDA 1N6NA 3CZPA 2D3WA 4C0HA 2N42A 3KXKA 2EFHB 5SZKB 3I4LA 3UFFA 2QORA 1JALA 1PTQA 3M0EA 4IFEA 2D2EA 2D4HA 3WP1B 4QBHA 4D4JA 1L4UA 2GVDC 3SJBA 4XIGS 3QBVA 2CEAA 3TVTA 1ZU5A 2VTKA 1CEEA 1E99A 4ITRC 4DB2A 1W44A 3I32A 3U3RA 3GLFB 5A4JA 2ANBA 4LHVA 4HDQB 2CL6X 4DLZA 2H57A 2CNWD 2VLIA 3KB2A 2XNSA 4AKHA 3OIWA 2IYXA 3VR3A 2ZSDA 3A37A 2QM7A 2E73A 2XSZD 3ASYA 3RANA 2FFBA 3O47A 3P26A 4LC1A 2ONKA 1RRPA 1IBRA 4EPTA 4ACAA 4RKEA 3RLFA 3U6KA 2CNWA 3I62A 1R0ZA 4I1SA 4KYIB 5JHHB 3B1WA 1WCV1 5JWOA 5DLQC 4CEJB 4YMTA 1T8TA 4BRUA 4Z54A 2J41A 5KU1A 2BCGY 2FNFX 3NBYC 4H1VA 4L9SA 4URXR 2D06A 2GA8A 5TVKA 1KK3A 5F9HA 4DCTA 1WF3A 1XJ0A 2QAGA 2W2TA 1UAAA 4LX0A 5J47A 5JJIA 4MRSA 2VF7A 1K8RA 2FPKA 4JL6A 1SQ5A 4JJKA 3U3JA 1W4CA 4MDEA 3T61A 3CX6A 5JSZA 3KJIA 1NVXQ 3KX2A 3D7MA 1NI3A 1M7HA 2FFAA 1OH7A 2QTHA 3PUYA 2QROA 1EESA 1RFHA 1OXVA 2BC9A 3K70B 1UDXA 2HDNB 1I4DD 4XTCS 5K8TA 4Q66C 2G6BA 4EQ6B 4NCJA 3ADBA 1SVOA 3T1QA 1KAOA 3KQHA 5JS8A 4FN5A 3GLGE 2IK8A 2TMKA 2AD1A 5KO2A 2OV2A 1G6OA 1EX7A 4C7OB 1UM8A 1G8GA 2P67A 2CXXA 2QTVB 2O8FB 1DPFA 2ZRNA 1A5TA 1PUIA 5FBQB 1E3MA 4XVRA 3T12A 2IHYA 1GKUB 2A7QA 1ZJ6A 5CIQA 4AWXA 3G0HA 2WWHA 4PHTA 4B74A 1XU4A 2XTNA 5JFGA 2FA9A 1KK1A 2OILA 3KUCA 3OZXA 1XRJA 3F3YA 1Z22A 2R8RA 4QGHA 2WJGA 3BFXA 5DNYB 2D7DA 3VNVA 3SQXA 2ENZA 1FP6A 5AK0A 4A0GA 4OQFA 1IXRC 2QM8A 4V02A 3C5CA 3TQFA 2IEYA 1KI4A 2WM9B 2QMEA 1G291 1A1VA 1X8JA 3K0SA 1GVNB 4BFZA 5L3QA 5FOXA 3VR2A 2VHUA 3KQUA 1SZPA 5J4LA 4Q7KA 1NBMD 2RHDA 1DAGA 3H4MA 1JR3D 1WB9A 1W2HA 1VCMA 3B1XA 1BOFA 4TLAA 4NPHA 2ZEJA 4KLNA 3JVUA 1VHLA 5DHAA 4LC0A 1YZUA 3BGWA 5BN4A 3KKNA 1NBMA 4P33A 4QM7A 1JR3A 2V6IA 4P4SA 2YC4C 1G6HA 3NG1A 4MGZR 3RC3A 3AM1A 4U5XA 3REGA 2AXPA 1JEEA 4B6FA 2V3CC 4EPRA 1YE8A 4ZDKA 2CCGA 4B75A 1KO1A 2FWRA 1VYTA 5AWFC 3SYNA 2GJ9A 4BUJA 3K8YA 2ZJYA 2WOJA 1VIYA 1UADA 1Z0KA 2BBTA 4P4UA 3WXMA 3P27A 2CDNA 4NONA 1E2MA 5L3RA 2IXEA 2P3SA 2CCJA 2FEOA 2BEKA 5GJCA 3TKLA 3KKMA 1Z2CA 1EWQA 1DARA 4K46A 1WBDA 3EASA 1UBEA 4R9UC 3HU3A 1XPUA 1D9ZA 1GWNA 2J45A 1TQDA 2QPAA 4TYPA 4Q7MB 1NY5A 2ZI3A 3ZVNA 1N6OA 1WDTA 4ESVA 5FOSA 3SYLA 1MR3F 2QENA 2VHTA 4CT5A 3QKSA 4N1AA 2GETA 4NYIQ 3ZQJA 2ONJA 4B3CA 3HYTA 4DCVA 1NVVQ 3ZZUA 5BWMA 3FHTA 2ORWA 3SJAA 1CLUA 2C9YA 3EZ2A 3MGCA 3VR6A 1E9RA 2B92A 2REXB 2DB6A 1NSTA 2WIBA 1VG9B 1OT3A 2VA8A 5AJYA 2WPDD 5FPSA 1OKKA 4Q4LA 1G3RA 2OM2A 1KDOA 4DDTA 1AGPA 3U6BA 2FSGA 4EDHA 1CTQA 4DXAA 2HJGA 4RZXA 2AN9A 1P2TA 2N1BA 1MOZA 2FFHA 2WPDA 1XPOA 5C4GB 2ORVA 3K0CA 5AUNB 1M1YE 4Q19A 3EPJA 1R0YA 4QBIA 1ZUHA 3FFAA 4IOLA 1KHTA 1LNZA 3GD7A 3TUJC 4ARZA 5FUVA 3GLIA 3LY5A 2UZ3A 4HUQB 3IPYA 3HDTA 1JB1A 3C41J 1R8QA 1GM5A 3LA6A 3QF4A 4B33A 1FTSA 1NMYA 2GAAA 8OHMA 5EE1A 2GZHA 4M8NE 1OIWA 1XP8A 1IY1A 2CK3D 3MWLA 1N5KA 2FN4A 2PLFA 2OAP1 3WNBA 2ZJ5A 3H0KA 2ECKA 2BMJA 2IYWA 4RFVA 5B57C 3KQLA 1IN7A 3GMTA 1NIJA 1AQYA 4HLUA 5E95A 1OFHA 1R10A 3P4XA 721PA 2MSEB 3FYHA 3H84A 4Q01A 2DY1A 4DLSA 3A1TA 1FMLA 4MRRA 4PO9A 2FGKA 1N6LA 1Z6XA 4CYMA 5H70A 1HT2E 1OYWA 4HSEA 1U0LA 5EJEA 3BJIC 4HI0E 4BFUA 2XJ9A 2BMEA 2F55A 3QG1A 5JHGB 4M1WA 2Z4RA 3ADKA 4ZDJA 4WAUA 2D74A 3QKRA 3ICEA 4LYFA 4L8GA 3PG5A 2G88A 4B73A 2Y8EA 3QXHA 4EIWA 3PVSA 4PC6A 2WWFA 3TK1A 5C1BA 2FMXA 3RS0A 3VTKA 3KZ1E 3IHWA 4IOKA 1XCMA 4UXIA 2IF2A 2O52A 3SBEA 2JLXA 4B3GA 2VP9A 1NBME 3A1SA 3IBYA 5GJWC 1JR3E 5KNDA 4QHYA 1QHXA 2C5LA 4IFBA 4C0KA 1SHKA 3K70C 5LPNA 3EIHA 1ZC3A 3GEEA 3BH7A 2PMDA 1U98A 1EG7A 4Q47A 5E7MA 1XTIA 3THOA 1J8YF 3ZJYA 2GXAA 5DI3B 1V43A 4QXAA 2JLYA 1GG2A 1B23P 3C5HA 3HWSA 4DBLC 4TL8A 5EUQB 4CW7A 4XSGA 5SZHB 4GOXA 3A8TA 1HTWA 5ANRB 4WXPA 3EW9A 4OHVA 3RRYA 3K53A 4DT1B 1DAHA 5EZ6B 2F9LA 4MRNA 4CF7A 1NRJB 3IBGA 1S0UA 4EFLA 1Z63A 1RE0A 1ZNYA 4US0R 1W5SA 4OQMA 1Q0UA 3GJ3A 3VKWA 4D0LB 1FQJA 3U7GA 1BKDR 2ZAOA 2WJVA 5EP1A 2MSCB 2Z5FA 3NH9A 4M0LA 2WSSD 5G53C 4BLOA 1OB2A 2V4ZA 3EWAA 4DC9A 2SHKA 3WMFA 5FOVA 4LV5B 4JVSB 1KTVA 1VG0B 1CR4A 2YV5A 4JLOA 4ZCLA 1W4AA 1S1CA 1XEFA 4WZAE 3SS8A 4EPYA 1ZIPA 2VYFA 2FSFA 1CR2A 1W48A 4IDOA 3PR1A 1XF9A 1P75A 4D81A 4M9SA 2WSSA 3OIYA 1QF9A 3DMNA 3SHWA 3GJ6A 3TSOA 2ZS7A 1F60A 4XWOA 3U3KA 5TXGA 2F1JA 4FW9A 2F1HA 4IRUB 3O8RA 5DYGA 4V0OA 2JLZA 1KI3A 4KFTA 2W0SA 2GRJA 1FTNA 2KI5A 5DE3A 1MABA 1YR8A 4C0SA 4GP7A 1YZTA 3TVDA 4BZPA 4LJ6A 4ZI3A 3AP1A 1VTKA 2ODNA 3UG7A 4IEEA 3QNUA 2GF9A 1QVAA 4QHSA 3GLIE 1WBBA 1AKEA 1S9HA 2H16A 4JS0A 1GNRA 1AJEA 2VP5A 4FXPA 4IVPA 2ZI7A 1NL3A 4LBZA 3LLMA 2LKCA 3R8FA 4TLDA 3K09C 4KVGA 2JLVA 3RS5A 3GLHB 4E22A 1II8A 3UMSA 3AEZA 2O8DA 2JLSA 3SJZA 5KUTA 2J0UB 2NO1A 2CCKA 1OB5A 4MA4A 5CYOA 1Z0AA 4QOSA 2BIFA 3ECCA 2IHBA 1DG1G 3Q5EA 3B60A 1SHZA 1TF2A 4WW0A 2I1VB 1KO5A 2WBLC 2NMVA 3M6AA 3KTAA 3N2IA 1JQLB 1NN0A 3AF1A 3AF2A 1GUAA 2IS2A 4I4LA 3Q9LA 2JLWA 1VMAA 1OE0A 4DKXA 1ESNA 3CKLA 1GTVA 1QVRA 2QU8A 4K81B 1DG3A 4M21A 4M1SA 4RCZA 1XTQA 4ZO4A 4ZPXA 5FBWB 3WP0A 4ZCMA 4NCKA 3NBXX 4P4TA 3OE7D 3W90A 4AYWA 3E5HA 4NYJR 3SJCA 2Q21A 1N3BA 3QKTA 2CJWA 4LDJA 5DH9A 2QMUA 3TR5A 4FI3C 3PENA 4JBXA 4HATA 4BE7B 2GJ8A 4PPFA 4YDSA 1IONA 4HAWA 4B32A 4LJ7A 2HV8A 3ZVLA 1XD2B 3SHFA 4U00A 3CO5A 3IGFA 1XEXB 2J9RA 1LFDB 3C8UA 1ZCAA 2FGJA 3FE2A 3FKSD 1IQPA 3LVRE 4D4KA 3HU1A 2DPXA 2RGCA 3KFVA 3GQBA 2IS4A 4CGZA 1QG2A 1IOZA 3WBKA 1G8YA 1SXJD 3THWA 1G9XA 1LY1A 1PLLA 4MKFA 3FKSA 1L8QA 5FOWA 4OI2A 4OYHA 2ZJAA 5FI1B 2LKDA 1OJLA 2DFTA 4R71A 1R0XA 1Z0IA 2OAQ1 1LVGA 2ZYVX 4A92A 4RJLA 2IYQA 3N5CA 5IDVA 3I72A 3U2QA 5FPHA 1V5WA 4NCNA 1AQUA 4LYAA 2ZSEA 4Q9IA 1SXJA 3VKGA 2FV8A 4WZ6A 4Z8YA 5CJPA 4QNMA 1CR1A 5HR5A 2OHFA 5EZ5A 3J81k 4O2LA 3WY9A 4CEHB 2PEZA 5J4HA 4LZZA 5HZKA 4F93B 3QVVA 1BMFD 1W4BA 4FD2A 3GEHA 4FWIB 1EFRD 1Z0DA 2XX3A 4YMWA 4KFRA 1UDWA 2AKYA 3ZVRA 5K8LA 1YKSA 2BVNA 2QTFA 3KJGA 4ZCIA 4NL4H 3RSOA 1J8MF 2ERYA 5G40A 5LB4A 4NBSA 4W5JA 3O8CA 1BMFA 1FP7A 2HXSA 5HZHA 4LV6A 1EFRA 3QPWA 1ZCBA 2KSQA 4GRAA 3EZ6A 1S1MA 4GDFA 5GVSA 5FTLA 3SNHA 1HE8B 4YMUA 3P20A 2JJ8A 3LWNA 2QE7D 4IDPA 1N6HA 2XITA 3FMOB 3PXGA 3TLXA 4B47A 3PJRA 1CR0A 2FF7A 3U5ZB 1RRGA 2A30A 5DYIA 3PIRA 4W7SA 4TMTA 2O8CA 1T3SA 2ELIA 1N25A 3BAFA 3DL0A 3W9YA 4DCSA 2GXQA 2W2XA 1TAGA 4LPSA 1XZPA 1B0UA 1GP2A 4RFSB 2VSXA 2REBA 4A0FA 2GVZC 2QGZA 3ZD6A 3MAAC 1W36B 1XTJA 4MUBA 4JLDA 3CBQA 1OIXA 1XXHA 1E69A 3U61B 1P9NA 1R6BX 3AVQA 1W49A 3OEED 2DB3A 5DISB 4IDNA 5EE5B 5JS7A 3LV8A 1IY0A 4QG7A 2HT6A 2ZI9A 4QGAA 5KSPA 1FMJA 2ZJ2A 1DO0A 5JJKA 1W5TA 4LK2A 3FHCB 3ONWA 5KNBA 3LW7A 2FPMA 2NGRA 3RS3A 3OEEA 4TL9A 2N46A 2H5EA 4FMDF 5B2ZA 3NVAA 3S1AB 3OFNA 2GWHA 1X86B 4UXJA 2I1QA 3UGDA 1LTQA 2EFCB 3F0TA 4N0EA 3QJYA 5DHFA 4A2PA 5CITA 3GLGB 5BYJA 2KE5A 2A5FA 2AR7A 2QBYB 4MGYR 4UNPA 3WHKA 3OF5A 4O0MA 1RJ9B 1KI2A 2ZVPX 4RD4A 4Q9KA 3RRNA 4FIDA 1MO5A 4HDOB 2GXUA 5JEDA 1YR9A 4TSFD 621PA 1Z5ZA 3OIVA 4S35A 1SGWA 2BMFA 3UKDA 2NPIA 1S4QA 3IIMA 4JJZA 4LUCA 1IN4A 4B3FX 1DOAA 1Z8FA 1ZP6A 2VSOA 4DLVA 2O8EA 2ASEA 4QBFA 4XTRA 3DOFA 3L8ZA 2I3BA 1W0KA 4HAXA 4JLKA 4K8OA 4II7A 1MO3A 1N6KA 2ZUDA 2RCNA 2AK3A 4A6XA 3T35A 5FTNA 4QBGB 2HT1A 3P1JA 1HQYE 1AZTA 1P61B 2W2VA 2GCOB 2GKSA 1G4AE 3KKOA 4KYUA 4RD3A 4QJ5A 4TQ9A 1XX6A 1P5ZB 1ONBA 4HAUA 4RD1A 3AGPA 4F92B 5IT5A 3FKQA 2ZRGA 3WYGA 3EC1A 1CU1A 2A5YB 3GCGA 3MJRA 5LBIA 5HCNA 4B6EA 1M7GA 1AK2A 2O8BB 4DLYA 4M53A 2PBRA 4CVNA 2BBOA 1OH5A 1SXJE 1ZD8A 3FMPB 4GOJA 2QSYA 1GAJA 3TH5A 3SI7A 1ZM3A 4PC7A 3CPJB 2F43B 1TADA 1YR6A 1M7BA 5LB2A 2BEJA 2QA5A 2Z0MA 3AKEA 2PX3A 2CLSA 1MO6A 3A58B 5IHPA 2VRWA 2ZQ5A 4PSVA 2ZR9A 2R6DA 2PX0A 1N5LA 2QEQA 2VHQA 4JLPA 1G5PA 3JVVA 4MRVA 2EYUA 2WWWA 1QBKC 521PA 1YJ5A 3MG9A 3R20A 4DLRA 1VYVA 3DHWC 2W00A 3IO3A 4G0NA 4BFYA 3NBFA 2GJKA 3B85A 4JL8A 4CEIB 1PVOA 1KYIA 2VP0A 1EFUA 1NLFA 3ADDA 2ZR0A 2GTPA 5J4YA 1L4YA 1SVLA 1QZXA 2BV3A 5C46F 2DBYA 1CJUC 2W6JD 3EZ9A 3MFYA 3UMFA 1E0KA 4UNQA 1YQTA 4TYNA 1T3HA 4FCWA 4JLBA 3IKJA 1U9IA 4PZZA 2V55B 3EC2A 2OO7A 4Q02A 3BB4A 3B78A 4P32A 1A2BA 4PSKA 1JAIA 3A1VA 4N3NA 4ACBA 2AKAB 2OCPA 5CM8B 2AWOA 2OXCA 3LXRA 2W6JA 1RW4A 3V4RA 3B1ZA 4D4MA 1D2MA 2ODEA 5CK4A 1QHHA 3TRFA 1W47A 3UWKA 4F38A 2HUPA 4OI1A 1XXHE 2OCYC 5DIFA 2XXAB 4XJXA 4B3BA 4D0NA 4M2LA 3THXA 3OIUA 4PFSA 2HCJB 4TN1A 1TTTA 1LW7A 4URWR 2NTYC 4HZIA 2QAGB 1LS1A 2XSZA 4PZLA 5GVRA 3TIFA 2Z83A 3ZD7A 4AYTA 4PQRA 4Y0VA 5CM9C 4U7DA 3LH5A 5EUMA 4Q7LA 3R9IA 3BB3A 3VHXA 4DJTA 3BK7A 5JSZB 4D2IA 2ZREA 1NNEA 4I99A 1MV5A 2FNAA 3B7GA 4C30A 1ETUA 4IDHA 3B1YA 1CBUA 3ZH9B 1DAMA 2BM1A 1G1MA 3ZS9A 4DZZA 3GJ4A 1KMHA 2ZAMA 4Q9LA 3BORA 4ON9A 2H92A 4OK5A 3U3MA 1NF3A 1KIMA 4D82A 1KDTA 3EX7C 1RRCA 3GP8A 2G9NA 1FFHA 5LDDC 3U60B 2IUTA 1MKYA 4HB4A 4UQOA 2NO0A 1YRAA 4LWZA 4PO8A 3CB4A 4TQUS 2G1JA 4IXMA 1E2LA 2X2FA 3P4YA 4KLZA 4CEJA 2BM0A 3UGIA 4XH9B 2HXYA 2R6GA 1E2QA 1D6JA 2JLQA 3OAAD 3UXMA 1XMJA 1AN0A 2PEYA 4NHOA 4Q1CA 1R8SA 1SVSA 1WP9A 3MUFA 1XA6A 1P9WA 2XB2A 1XCGB 3WMGA 4OQXA 1VG8A 3B2EA 3K70D 4M1YA 1JNYA 3VX4A 4C2TA 3I5YA 1KY2A 2H8KA 2PMKA 4Q1DA 3OAAA 4M9ZA 5FFMA 1G41A 2X1VA 3FWYA 3TAUA 3VAAA 5F2EA 2NOAA 2C04A 4MKHA 1J99A 1HYQA 4FKDA 2IWHA 4KO8A 1Q20A 4CDGA 5L3QB 1KSJA 1W36C 2RMKA 4NYMQ 2XZPA 1P3JA 2XZLA 4TMKA 1XZQA 4TMVA 1GL9B 4Z51A 3BWDD 2WKPA 4L9MA 5TB5A 3TAHA 5JCPA 4AKIA 1S9DA 4HB2A 4L4UA 1Q44A 4LPKA 1VYUA 3B82A 3DMDA 3VU9B 2YJTD 4C7OA 1S3SA 2G3YA 1JECA 1DO2A 2MMCA 1ZM9A 3E70C 4P4SB 2Q3MA 1KZ7B 1W2GA 1S2MA 1W46A 2IT1A 2ZI4A 4LV8B 4AKEA 4HUTA 5CJ2A 2EFGA 1ZM4A 3AVOA 1T0JB 3EZ7A 3DOEA 1UKEA 3CRMA 3PITA 3KB1A 121PA 4MYTA 1NMXA 5BN5A 4JLAA 5DN6D 1IM2A 1Q1EA 1US8A 1DAIA 1HY3A 2YC2C 3NC0C 4BWYA 4A8JB 5FPKA 2IYSA 2QSZA 4B2LA 5AUOB 4YDHB 1MH1A 1U8AA 3ZYCA 4AURA 5KSOA 2QQ0A 2ZSFA 2WAYA 5JBQA 1GITA 3DDCA 1DE0A 1MRSA 4L15A 3EPKA 1VPLA 3Q7QA 1F2UA 4JYCA 5DN6A 4MUAA 1OH8A 1TUIA 4IW3B 2R6FA 2WMNB 3BS4A 4JVLA 3VX3A 5H1YA 5F98A 3LBIA 4Q18A 2C9CA 4P31A 3C7KA 2Z43A 2R65A 1RVDA 3F5FA 1SVKA 1HE1C 4RZ2A 3CWQA 3FPAA 3RRZA 3AVXA 1S3GA 4BLQA 1E1QD 1X3SA 3PEYA 2WWYA 2PCJA 4JZKA 4G5GA 1SVWA 2CVHA 3PUXA 3QG5A 4Q4HB 3A1UA 3NXSA 3SYKA 1M8PA 2JASA 3BOSA 1FX0B 4C0QC 1IXSB 2GBLA 1NVUQ 3QVUA 4Q1AA 5L8VA 2WWXA 4BFXA 1NY6A 1P60A 1E1QA 1ZU4A 3X1WA 5BN3A 3K09A 1II0A 1W0JD 3PEVA 3QSYA 1T8UA 2V9PA 4JL5A 3THYA 3H86A 3U4QB 1Y8FA 2ANCA 3CX8A 2GILA 1T9HA 4M1OA 3NEYA 4X8MA 4PO1A 1SKQA 5F3WB 3TNFA 4E5UA 1YZGA 2BDTA 4JLJA 1W0JA 2JJ1D 4DIDA 2IEZA 1G16A 2QGNA 1ELOA 2KBFA 2R6CA 3QKUA 4B35A 2J7KA 2ODBA 3L82B 3UATA 3CNNA 1TF7A 4BFTA 4A1FA 4A0HA 1CJVC 4TLCA 1YRBA 3QEOA 2JJ1A 3I92A 4BEBA 4A6PA 1C4OA 3CW2A 4PSAA 2H17A 2P6UA 3ZDQA 1W7AA 3NKVA 4PPGA 3CRW1 3M4YA 3GJ0A 4RY2A 2G77B 2PT5A 1XMIA 1P4SA 1YZNA 2FU5C 5CDFA 4EJSA 1SVIA 3CRQA 5FTJA 2AXNA 2WMOB 4WA7A 2Q3HA 1Q22A 2ZITA 4KBFA 2PZEA 2WKRA 1G17A 2YZ2A 5FUWA 3U7HB 3IILA 4NCIA 2W6ID 4QHTA 4WBSA 5G41A 4X8HA 1OIVA 1OF1A 5ELXA 1G3MA 2CK3A 1RIFA 1PV4A 1G20E 4IVRA 5BQ5A 2QI9C 3AP2A 3UWOA 1UBCA 4PX9A 1Y63A 1XJCA 3R9WA 2WJHA 4LJ5A 3X2SA 2W6IA 4HUQA 1T5IA 1SVMA 2QAGC 4PHGA 3C15C 2R6AA 5AUPB 2OXRA 3LVQE 5D3MA 1JPJA 4KI0A 4TTPA 2G1KA 4LHWA 4TLEA 1Y3AA 4C9BA 1CULC 2GZDA 4Q4AA 4POAA 5AJWA 5SZIA 4UNNA 2YHSA 2F3RA 4E09A 4OI4A 1UBFA 3U3OA 2VP2A 2C03A 3HP1A 4F7WA 5JEEA 1Z29A 4N0DA 4TMWA 4PAMA 1VG1A 2AL7A 3HJNA 4A82A 1ANKA 2F6RA 1P2VA 4EFMA 2ZUBA 1G3QA 4OQNA 1JEDA 4PPQA 3DZDA 3N70A 4KV9A 4WIAA 3VR1A 1F2TA 1ZNWA 3IO5A 5KTYA 1N6PA 4GI7A 2Q9BA 5F9FA 1YZLA 5DI9A 4LJAA 4BPBA 3MWYW 3WHLA 1ZUNB 5IK2D 3F8TA 5TDHA 1QDEA 4OQLA 1C9KA 1G8FA 2QMOA 2OE2A 1TBOA 1JJ7A 1X1RA 5KOYA 3MD0A 4MDFA 1G8PA 1NN1A 1T0HB 2PH1A 1WQ1R 2IYTA 2WV9A 1OV4A 1A82A 4HAYA 4OI0A 3A1WA 2FX3A 2Q6TA 4IVQA 1PJRA 5JCZA 2D62A 5L3SB 1E9BA 4GNKA 3BFKA 4MYHA 1J70A 4Q4JA 3W5IA 2C77A 1LF0A 2XTZA 1T4GA 1ZIOA 2EWVA 1VDZA 1N0UA 1L7VC 2J1LA 1IN8A 3KJHA 4BQSA 3ZIAD 3RSLA 2C99A 1Q1ZA 1Z6YA 5IF9A 3GPLA 1GRQA 1Z47A 4WVFA 2JAQA 3LX8A 3LD9A 4O3MA 2PJZA 4PQYA 2AX4A 2DYKA 4QJ4A 2X77A 2WWGA 3L43A 3PQCA 3WNCA 4J0QA 2Z4SA 1R0WA 4IHQA 1EFCA 4RKFA 3RS4A 1ZM2A 2OSBA 4LRWA 2VL7A 3QEJA 1TNDA 2KWIA 4DT1A 3T34A 4AG6A 5DSZA 4DLTA 3K1JA 2EFEB 2KBEA 5J4KA 1JJVA 2QY9A 1GL7A 3DKPA 1G5TA 3HPRA 4GOKA 1CJTC 1F5NA 3EWSA 2PL3A 1KKLA 2OLJA 3AF0A 3CLVA 2VF8A 2ZE7A 3OHMA 4G5SA 3K0AA 3AVYA 2R62A 2V54A 1II8B 3Q5DA 4UNSA 4A8JC 3EA5A 2CL0X 2RGNA 2ZRKA 2P65A 2ZI5A 2OFOA 3BXZA 1GSIA 4CIDA 3O8BA 1HT1E 3QQ5A 4JVNA 4Q1FA 4CZ2A 2C95A 1ZW6A 4ZIRA 4B3XA 2PT7A 5CDFE 4LJ4A 3D31A 4KBGA 1ZNZA 2JA1A 5E7JA 1C1YA 3GEIA 2EVWX 3KTAB 2ZE5A 2FPLA 2F7SA 1M34E 4YLGA 1N0VC 4A9AA 2ZROA 3M1IA 2FH5B 2RAPA 4G1UC 3PV0A 3LAWA 1JQJC 4F4JA 1X6VA 2V6JA 1H8HD 4H1UA 3HR7A 3FB4A 3AVVA 4ABYA 2YKGA
chains in the Genus database with same CATH superfamily
2CVFA 2NSJA 1CY6A 4IINA 1RYDA 5TT1A 5A5GA 2WJZB 4JZYA 3L5OA 4MKGA 1KI6A 4DQ0A 3FCXA 1AM4D 4NH0A 1X1EA 1XNHA 1RXUA 2HL6A 4MI1A 5FLKA 1U3TA 4U2BA 4Y2SA 3NJRA 4CM9A 1DKNA 2VBCA 4PC1A 1UK8A 5DM2A 1LFAA 2TMDA 2HLPA 4HNSA 1H3EA 4KQHA 3AHGA 1USUA 4FCVA 5AM2A 3CR7A 1TKRA 4WLNA 3W8NA 3HYRA 1LK5A 2FW0A 2OZKA 3K0CC 4LJ8A 3TIXB 1ESZA 3KUUA 2V1UA 1U8XX 2FE4A 4XCQA 1QZUA 2HO4A 1TYAE 4TTQA 1PK9A 3GRFA 2VPYA 3WDKA 4IEIA 1DWUA 4RE6A 1DC5A 2YV4A 1DEKA 4JAVC 2VSQA 5AUQA 4Z7NB 3IAS6 3DXFA 3EG9A 1JE0A 3OFSA 3HY4A 3KHUA 4MRPA 5FWXB 3QFSA 3M1LA 5CPBA 4AJOA 1T2EA 5AK5A 1WUJS 3HDHA 2BMWA 1HF3A 4UE2A 1PK7A 2GA9A 1RWOA 4JP2A 2AVDA 2C83A 3LUGA 1YS9A 3PXAA 5A5DA 1RZ3A 2XRMA 1M1XB 1SZDA 1GCGA 4GT1A 1HMYA 1GO2A 2UZIR 2O7SA 2Y1OA 4S1NA 2J3IA 1GZDA 4FINA 1P9RA 3L8CA 2J7PA 5JSUA 1E2JA 3JQEA 1XD2A 4LGYA 4ERXA 4GE3A 4ZDIA 1JG6A 4NDAA 4R84A 3EXAA 4XLLA 4RHYA 5F64A 2BR4A 2IHVA 5DLPA 1RRFA 3F78A 4QRDA 2GF0A 5GV7A 3L0OA 2NU6A 4WOPA 4JBYA 4YA6A 2FSHA 5HTKA 2PSDA 2XUPA 1UDCA 1M9NA 2ILTA 1CS4C 2QRGA 3M6XA 4AT1A 2VOJA 2Z30A 3D7KA 4MW4A 4TSRA 2WJWA 3G2LA 3LDGA 3PDHA 5IFKA 1JWAB 2GHTA 4B6DA 3FYCA 4FZRA 4L16A 1K5GA 4EHJA 1G21E 2EJCA 3W6NA 2FPPA 2GLUA 2YNMA 3KELA 4WNCA 5EQFA 4P98A 4ZOAA 4A23A 3OPNA 2JFVA 1LF5A 2W2MA 1QVZA 3ZBQA 3UK6A 4LY9A 1ZJWA 1KMMA 4EENA 1BE8A 5L6LB 4H0CA 4AZSA 5CYPA 2Z98A 3EIWA 2WWIA 3QNWA 5EJ2A 2QZ9A 1JH8A 3VO2A 1SH7A 2YHAA 3FYUB 3RIEA 1L2TA 2DHRA 1E8NA 5K8IA 3ASZA 1I4WA 3DUFB 3QWFA 1TKBA 1RKXA 3HR8A 1ACLA 1H9BA 2O3SA 3AF5A 3ETCA 4D80A 4Q15A 4TWJA 4UPEA 1L5QA 3L1HA 3T5GA 3C7CB 3O2QB 1X1SA 2P6OA 4DV1B 1P1FA 2PKQP 1E5TA 4ZEXA 4AJLA 4F72A 2X5XA 4PFJA 1AH2A 3L8FA 2NV0A 3O8QA 3W34A 2BEUB 1CW2B 4NBNA 2ODWA 3JPYA 5TX7A 5JDCA 1Q16A 3B1VA 1UJ5A 3CXRA 2JFQA 1EBUA 2CJSC 4Q1VA 1I2BA 5CVTA 1THGA 4PIMA 2PS3A 5GJVC 3AFHA 1DAKA 1UKZA 2HSJA 3IEUA 4UVIA 1XBTA 1JA9A 2FWPA 4J0FA 2BH9A 4O29A 4UARA 3E8XA 3JASB 5NULA 3PF9A 2ZRBA 4LSGA 4Q4CA 5KTMA 5JI3E 3RYCA 1OFTA 3B52X 2VP4A 4LDZA 1RLJA 4AZWA 5BVHB 2DLCX 2RSLA 3L2OB 3GRUA 3IPCA 3AHCA 1PR1A 1R66A 1YB7A 1Z34A 4KQ1A 4NOMA 4PW0A 4NYJQ 3OESA 4ITVA 2EKZA 2E4AA 3C6QA 4FILA 4QXMA 4V0LA 4V39A 5TNXA 1VJTA 4H9GA 1EQAA 2VJOA 3GMDA 2X41A 1L8LA 1RC8A 3KOWA 5AVWA 2VQ6A 2OYRA 3W77A 3AQIA 1L1FA 3FWHA 3GROA 2YQPA 5DT2A 4II2A 4LBWA 1DQRA 1CUYA 3BJMA 3T7JA 1FS5A 4MPIA 2X3FA 1RM3A 1GADO 2ZPUA 4G1CA 4KDEA 5A7GA 3L6EA 2HF9A 2R2GA 3AU8A 3H2JA 3G1TA 5EXSA 4EO4A 4REOA 4GZMA 4TT3D 5CW1A 3DL2A 3LLSA 3AUAA 3L7NA 2FE1A 5IMSA 1N0HA 3STTA 1N5IA 3VR4A 3R09A 3W3AA 1ISJA 3GLHE 1W4RA 3O74A 4W5HA 4AJ4A 2GCIA 1KMQA 3CM0A 2HZBA 3IDFA 2BFBB 3JATA 2VYCA 3CXUA 4O3FA 2QX9A 2O4UX 4YCSA 4JLNA 2ZETA 4MQMA 1BTOA 3BA6A 1GQSA 4ND3A 3CNLA 4BPRA 2IYVA 3PQ6A 2QKYA 1QHNA 1D4AA 2FG7C 3OZGA 4RVFA 2OVOA 1AT1A 4L6AA 4AF8A 3WBBA 4YXWD 2ZJ1A 1MJ5A 3DULA 3MIZA 2WJYA 2ATIA 1ULHA 2HCBA 4RAOA 1UK9A 3LE8A 4JN6B 4X5OA 1T2NA 3V1TC 4E3ZA 1UEIA 5JSFA 2F1IA 4TWZA 4IOMA 2EX1A 3VVCA 2WG0A 1BYIA 4P8RA 2QU7A 1D07A 1ND6A 2P1ZA 4U2EA 4DLXA 4ZAXA 5E8JA 2DC1A 1YRHA 2PL5A 3ESXA 2B9VA 3L0ZA 3L0YA 1KNQA 2QRKA 3S40A 2VPQA 2PVPA 2YYSA 2SECE 2J3JA 1Z6AA 1WUYA 2DT5A 5DTIA 2WPNA 3QW4B 5C8DA 2ZJOA 2BBWA 2VF5X 3JQ6A 1TLFA 1YU9A 2Q41A 3ZBUA 1TJ4A 4R16A 2QPOA 1QK4A 3G3EA 1R4MB 3GAMA 2JCSA 1KVUA 3MOGA 3A4VA 4MQ6A 1KMNA 4F4UA 3KDSE 4WKCA 3KIPA 4TV9A 3RSHA 5L95A 2CLDX 2I4MA 2OBFA 3H9QA 4UJ5A 3KUXA 1UINA 1Q6YA 1Y8QB 4RD2A 3LBYA 2WSBA 3W1VA 4X8OA 4U1RA 1OYYA 3K30A 4O4IF 3IMFA 2CSXA 2DRIA 2Q8QA 3RQSA 2FZLA 2NVOA 3EA0A 4CQMB 4ZARA 3KUDA 4J7UA 1RI3A 5B4VA 5CFZA 2WLSA 2HR1A 1LRKA 1ADGA 1U7TA 2D00A 3ZNQA 3BM5A 1ZNXA 1QF7A 2VQSA 4EJ6A 2IU6A 1M6VB 4RIIA 2I4IA 1L4EA 3BFVA 5C7YA 1WSDA 2X3YA 3IPXA 1AMUA 4ZT4A 1Z33A 3EC7A 3AR4A 3ZHXA 3FVRA 1EG2A 2X2EA 4NU5A 3JD0A 5HQTA 2NQTA 1KR2A 1MBZA 3LUHA 1S4MA 1E60A 2B37A 2W90A 1CJBA 1OZAA 1FARA 2XADA 1QGAA 3LQQA 3E05A 1YZQA 3NBZC 5D3ZA 1E2DA 1FNNA 1C50A 3RUPA 2F3TA 2H1WA 3AILA 3H2KA 1HLFA 5T4BA 2BSXA 4YQFA 5JXJA 1DMRA 1QU2A 2HQRA 1IATA 4TOIA 1I1NA 1IHDA 1A4RA 4KGZA 5CBKA 1SXJC 3CRVA 3HSKA 4JT8A 2HZ7A 3CG4A 4QM6A 4EPVA 3W8EA 2W58A 1YKFA 2HF7A 2AOUA 2AW3A 1NXOA 1M1NA 2E4XA 2P40A 3FNHA 4KFCA 1P7YA 5L3ZA 3F3MA 4QX6A 4DQLA 5AW5A 1P2UA 4RTMA 1ZVVA 4CEIA 1ECLA 4K9MA 2WG2A 1TIKA 4XOIA 2I78A 5HDBB 5A62A 1RZRA 3DDUA 2PTGA 4OXYA 1N7GA 4OQEA 4V1CB 2CE2X 1TKAA 2V59A 1PLJA 3PEUA 4GOMD 5ILGA 5DBEX 3Q7PA 5KI6A 5IJ0B 2ZUTA 3FIJA 3CUVA 5EKUA 4DQVA 2OZUA 3GFQA 5TV2A 1NU6A 4W5OA 2ZM5A 3GLFA 1DKOA 1G7CA 1Y9DA 1VPDA 5LIRA 1ISIA 1ZRHA 3IS3A 4B8ZA 2C4WA 1G7SA 5KNCA 1WVIA 4JIMA 5TQ2B 1EXVA 2Y66A 5I7RA 1KJWA 5L3VA 1HSOA 2WIFA 2QG9A 3FLBA 1EFPB 1K0FA 5A05A 1IY2A 1OHHA 3RVBA 4CF5A 5BQ3A 4EY3A 3DD1A 3D6NB 5JXGA 4Q34A 3HKDA 5JTTA 1X8LA 2J5QA 2AK2A 4X1OA 3DAHA 2PUCA 2PSSA 4XQ0A 2ZTHA 3SLGA 2GEFA 5KMGB 4WOBA 3BE8A 4B7AA 3S1SA 3IUJA 3KLOA 4M1TA 5C8YF 1DRWA 1C3VA 4IDFA 4LK3A 3HO1A 5DNCA 1F3OA 4Z4FA 2O23A 5FR1A 1IN6A 4Z4QA 1FDTA 5CFQA 1ZD1A 1C7EA 4H6VA 4LI0A 1S6YA 5J5CA 3K3PA 3TJMA 4DBVO 2R8OA 4JC8A 1OAKA 2EV9A 1T3LA 3AOEA 5C0OE 5LQMA 1Z06A 1TAQA 1MTZA 1RR6A 3QOYA 4TM7A 3G82C 3HBNA 3KJEA 5TGDA 4FOLA 2JJ2A 1J5EB 4F5EA 1HDGO 4XIFA 3K35A 2A5LA 4UKDA 1FUUA 3VTAA 3ZGXA 3NGMA 1S3IA 2WU8A 4I6JA 4IGIA 4L8YA 5E2AA 1XRMA 1P3DA 5EXEA 2BGTA 2QLTA 4BKMA 3H16A 3KK0A 4PZUA 3RS9A 1J5PA 1EUDA 2EWWA 1QHGA 2WM3A 3B6ZA 4OFBA 2B99A 2VPXA 2GEUA 3LBNA 4TMFA 1LDNA 2L0XA 2RHLA 1QKJA 3KWJA 1L3IA 3AK4A 2K2QB 5DEIA 4C4RA 4L08A 5B2FA 2JDID 1LRJA 2WKSA 2IWRA 4MK4A 4EPWA 5HZGA 5ALLA 5BN4B 5CNIA 3OE4A 2Z9BA 4R83A 3FVVA 1VSVA 2VA9A 3BH0A 3SBXA 4PXAA 2O3RA 1HPLA 3P0IA 3GGJA 4KWCA 1G64A 3OZCA 3PFFA 4W5RA 1TECE 1JZSA 2QUAA 2ZWVA 3RHFA 1ZVMA 4KODA 1U63A 4UOEA 2P6MA 2HOQA 4QNNA 4Q7JB 2IIVA 2H4HA 1FOEB 1NP3A 2ZPTX 1Q74A 3GJXC 2C9ZA 4DMUB 1SOVA 2X14A 3AI3A 1OJ7A 4M9XA 1AUQA 3SC4A 3FC3A 2GESA 3EVBA 1M6NA 2F9MA 2UYYA 2A0UA 4TXJA 5CDYA 1XHLA 4JDPA 1ZINA 3U0VA 1DP4A 4A91A 5FULA 4G5HA 2ROQA 4QYXA 3IAS1 2DLDA 4GZ3A 2Q5HA 2ZUWA 4QRHA 3GUUA 2CNNA 2BGWA 1IHUA 5ALXA 4OJKA 4IVNA 1EWYA 5CIWA 2ODDA 2E6KA 4RHTA 1UPTA 1C9YA 1DO8A 1JEQA 1LB1B 3O4FA 4Q3DA 1Q19A 5ALHA 2IEAA 4ARUA 2F3QA 3AGQA 2C2BA 1N9GB 1U3FA 3T95A 3ET4A 1ZMTA 1DT5A 1LNQA 4L6CA 4Z1OA 5JQWA 3BWCA 2Y0MA 1KQFA 3NYQA 4NC9A 2O19A 4GM4A 1JT2A 3BD7A 3KRTA 2QXTA 3LUDA 1OXXK 3QMMA 1UZAA 1EFVA 2SGPI 1HV8A 1L5ZA 1XZLA 2GJSA 1E66A 2H3EA 1UOOA 2AD5A 2HUNA 3DE3X 2FQXA 5FA8A 1IVSA 4URZR 3L6RA 1YS6A 4A8JA 3THYB 5GADl 2GFIA 4NVRA 4HXEB 5HCUA 3WIDA 1IUOA 5K3AA 2EW8A 4RORA 1QFJA 3O84A 3C24A 5B36A 3BJRA 3EAFA 4C04A 1KDYA 4HEQA 2AMYA 2V3VA 3TO7A 3EXEB 2PBLA 4X6LA 3Q8MA 2JAWA 4AC9A 4WKPA 4EMSA 2ZYWX 3QMPA 3WQQA 3UAVA 2ON6A 4Z3KA 4MV3A 3KPJA 2GERA 2OC4A 1NG1A 3BN3A 1D1SA 1KIFA 1OKKD 2QNRA 3B13B 3FLEA 4ENWA 5ALRA 2HC9A 5IAOA 3IT0A 2J07A 4X3CA 2JW5A 2P91A 3PLAE 2JANA 1VI6A 2XVMA 2HREA 1GRRA 4BLPA 5FH9A 3GJQA 3GFPA 3MINB 3F9RA 1SA0A 2PKCA 2A9KA 3SYTA 5EE9A 3WQSB 4AI6A 2JYYA 3KXDA 4YONB 1O6CA 4HRYA 5CLLA 3U7IA 3P9ZA 5I3CA 5F7JA 1EB8A 4G5YA 2P79A 2R9VA 1YNOA 2M1XA 5CW2A 4EJSB 2FPIA 2P2ZA 2PXAA 3OTGA 1IOLA 1KZ4A 3CX3A 2XIJA 3SQOA 4BX0A 4FEEA 2A88A 1QANA 2FJUA 3E7XA 4LGVA 4BNZA 1M34B 1Q2XA 3DUWA 4GHWA 2VF4X 5D00A 4G26A 4CMHA 4DA0A 4DCUA 4LYGA 3U4QA 1PVVA 5G3YA 2JIZA 2HQ1A 1M8GA 2DTXA 2EU8A 2I4OA 3KXLA 2P5SA 3ME5A 2EGUA 2W0MA 4Y2HA 1E7QA 1WXQA 1J0AA 2W4QA 3EN0A 5CUQA 3PX7A 3FMFA 3QVXA 2N47A 2X23A 1COWD 1NSFA 3TKAA 2GIVA 4N39A 1PJAA 3WLQA 3ZV6A 3LLCA 4B80A 2G7ZA 3G1UA 3ITEA 3ORSA 4LJYA 3T1VA 5LDHA 1G7TA 4INOA 1FFDA 1VIVA 2IYRA 5CYFA 3VQTA 1WXHA 3WRWA 4A6PA 3CVXA 3OCYA 5EL0A 3AJ9A 1OH6A 1H66A 1TU3A 4ETNA 4COKA 1WB6A 1H0KA 2XGMA 4G5QA 5GGYA 1ABEA 2GCPA 4IXNA 2PZGA 1DELA 1L1RA 1T43A 3T1HB 1WKXA 5D3MB 4NDZA 3UEYA 1O7JA 2FEWB 2H06A 3KS9A 1MGPA 1CVRA 1ZI8A 3IPAA 3V8EA 1ZAKA 2O0LA 2XA1A 3BF8A 3L7CA 3HFGA 4LFBB 4WKOA 1POXA 2CFIA 3CNEA 4LNUA 3SN6A 3ZHSA 3WAGA 4V0MA 1GLNA 2O3JA 3PQ5A 4YJHA 2XJ4A 2HB6A 5G1NA 2C3PA 1KU0A 2BF7A 2B5WA 2HM7A 2P75A 1OLXB 2B4TO 4I2VA 1GGMA 2QIOA 1BHO1 1U7DA 1RC0A 4AKSA 2OT3B 2E89A 4C3OB 1FVHA 1Z6QA 3VOSA 1ZD4A 3OFJA 1JU9A 4CLXA 1F2TB 2I6QA 1NLMA 1JPVA 4I4NA 4LISA 2BTQA 1LS6A 3CW9A 3OXLA 4RIGA 1K27A 2CXSA 4CF6A 2R66A 1QHYA 3TW8B 3V8RA 2QJWA 5CFLA 2DLNA 1U28C 2E2WA 2J6IA 3HJHA 3D4OA 4MWEA 4RHEA 4KQEA 2ST1A 3CIOA 4O25A 1WCIB 4IXDA 1SKUA 4E32A 4RHFA 2QZ4A 3P2IA 4I1UA 3AONB 3HCBA 4U9HS 2AF4C 3OZEA 2B30A 4R9NA 3SR0A 3ZDZB 1NT2A 1OGIA 5LD2B 4XVUA 4PFQA 2R1UA 4IHJA 1QHSA 2JGKA 5ERXA 4KCGA 3UFBA 3V8NA 2GBPA 1EFTA 1AQLA 5JMTA 3AKCA 4Q4JB 3PC8C 2CLMB 5K3EA 2X13A 4IRXA 3AUJB 1L4MA 2C98A 4RVUA 5DWQA 4HRVA 3FRJA 2QL7A 3R5SA 4B34A 3A6PC 2IS1A 5K0ZA 1GNPA 2QMQA 3AI1A 1AHHA 2J3DA 2K87A 2XKJE 1DC7A 4HDMB 1W34A 5D5HA 5K0EA 4DL9A 2AOVA 1YC5A 3LHKA 3A4LA 1OYVA 1ORDA 1VYHA 1J90A 3HSSA 1QH9A 1E3JA 3AEQB 4IKOA 5E3IA 2P2LA 4WLFA 5FD8A 1Z7GA 4AY3A 4M88A 2VDPB 2XYQA 2EBWA 3HFJA 2G40A 2YHUA 1JNXX 1WV0A 4Q9JA 2JFHA 3UWMA 2ZVQX 3ANLA 4B31A 2JGMA 1Z2NX 2KM1A 1A8SA 1ZL0A 2X58A 1Y5NA 3FGZA 3B6IA 3HU2A 4TVKA 3QUSA 5CLQA 2YYZA 5TGZA 2RH5A 3B9QA 2VCEA 1ZH0A 3I05A 3IURA 3O9ZA 4MTLA 4O5AA 4R69A 1Q0SA 2E82A 2I2WA 2JEOA 2PU7A 2VYVA 4CR6A 2HYIC 4HF7A 5CURA 2DFNA 3VDQA 1YVPA 4D79A 2QVBA 3IDQA 1QG4A 1Y42X 2QR2A 2VSYA 4GRIA 4YREA 2XDQB 3KHKA 3H5WA 4QQNA 4XB6B 2HJRA 1U0FA 3FZEA 5JRJA 3QWHA 3IULA 3K0AB 4ZTUB 3UOWA 2PXXA 2L17A 3EYWA 5GONA 3GBVA 4I3FA 4J0GA 5B7QA 2ZBUA 3GRPA 3VXKA 1GIAA 1JLLB 1MG5A 2BMDA 4IMRA 3NO4A 4OIFA 3SF0A 2ZRPA 1HYEA 3KKPA 2NUAA 2Y1CA 4BQPA 4ZIRB 5HQ3A 2IE8A 3OICA 5CDHA 2O8DB 4N0PA 3ZCRA 2OG1A 4C0JA 3ZCTA 1FNDA 1N8KA 3LFTA 1V16A 1B00A 3QOFA 5DYYA 3JSXA 2ID8A 3EIQA 1XQVA 1NR1A 3H5NA 5B53A 4RS3A 3TVYA 1S5PA 2QNIA 4NU0A 1KAHA 4OLJA 3EGEA 1N7HA 2AG6A 1EX9A 1Y89A 2XQIA 1AZWA 3C14C 1KIAA 3D7SA 1AS0A 1Y1CA 3H8WA 2WVJA 1NTOA 3N86A 4YJFA 5EE3A 1B8PA 4HDCA 4J0DA 5DXAA 4BX3A 4YPVA 3V7WA 5HE8A 2CY0A 2I6XA 5EN4A 1AHNA 2F3UA 2IYEA 1QC5A 1VJDA 2YUIA 3AY6A 3L6OO 5JSQA 4OXXA 5EI5A 1EHIA 3CF0A 3K5IA 3AJ8A 5JNVA 3L8EA 1QB7A 3U7EB 2EFDB 4NZ9A 2Y2VA 4Z49A 3DA8A 2AHOA 3QE4A 4D26A 3G0BA 1Y3BE 1RPZA 2WUVA 3MBIA 4E5KA 3AB3A 3DZHA 3TQSA 3TUIC 3EXFA 4OP3A 3RC9A 1JHUA 3VC1A 4RJTA 5C81A 3GQBB 2B83A 2OBBA 4EHAA 1YGPA 3DZ8A 4EF5A 5IUJC 4HBGA 1N8SA 1H2AS 3R8XA 1P9LA 4D9HA 2XNDD 4FBLA 4G9EA 1TJYA 2PQ8A 1C80A 4HEJA 4K2AA 1HR0B 3I53A 1VBFA 4ZT3A 5J2UA 3ZZ1A 1ZITA 1GEGA 2WU3A 4YRNA 1QIDA 2MINA 1D2EA 2BOVA 2ZB4A 2IJGX 2AI2A 3RFCA 4WKGA 1W9HA 5C3MA 1WEKA 3MQ2A 3I83A 5EKSA 5H02A 5KJ1A 1IY8A 2ZXEA 3CUKA 1GXSB 2IXFA 3B3JA 4DSTA 4MULA 1CUWA 1EPUA 1Z2OX 1KI8A 1Z83A 2H00A 3DJFA 5FBLB 2GJAA 2W22A 1H0RA 1HYGA 1EWVA 1Y3CE 4YAOA 1E32A 2X5KO 3QU4A 3EIUA 5I4IA 3FVQA 3PWSA 3GFVA 1EK2A 1QMGA 2ZXFA 1BVRA 3RVQA 1U0OC 3STHA 1UEJA 2JCVA 3D3WA 1E8MA 4KXYA 2QQGA 3W3ZB 5BP7A 2ERXA 3I76A 3LOQA 1LBTA 4PZYA 4L50A 3D8BA 1E1MA 1IAQA 1AKTA 2HSWA 4MWSA 1T8SA 4XQCA 1Z56C 1U2EA 4K6GA 3LUFA 1B8OA 1MO4A 4B4KA 3W06A 3JQ7A 2FLWA 3JZFA 1QZTA 2WVAA 1GNLA 4TQGA 5IU6A 4PAQA 4RMNA 5EXXA 1ZRMA 5I9TA 3DWEX 3U1BA 1J1UA 1L3CA 4LDAA 2D0IA 2VDOB 5M04A 2AQKA 4ND2A 5AK3A 4BNWA 1DAEA 1M75A 3AZPA 1H42A 1BHJA 3D3QA 1YCHA 2KYRA 3Q1KA 3QFFA 4GICA 3RRMA 5JYBA 2O8CB 1HA3A 4HH3C 1L5KA 1NZFA 3RCBA 3E8MA 4RTQA 4W5NA 3LKVA 4U2CA 2A0XA 1EVZA 4A6DA 2XCOA 1RBZA 2IFTA 2R5WA 3KT0A 3LXXA 1E9DA 1XLTA 2BHSA 2C4MA 4GVLA 4X60A 2H1HA 4RVDA 2FKAA 1CQIA 4UVHA 4PNZA 4NENB 2ZJBA 3UTDA 1Q0HA 3ADCA 3UK7A 2A35A 1SY7A 3GFFA 2V0GA 4KE7A 4DRZA 3NTUA 4G1BA 3SR4A 1X7YB 3SSAA 1XGKA 1YZHA 4HX9A 1ZD9A 4IQ8A 2FEMA 3GEBA 1NW3A 4Y2TA 3FHOA 3KJNA 1IHXA 2M32A 3UKJA 4C7MA 4MMXB 3L40A 4MRAA 1JBKA 4BVGA 4WOCA 1A88A 1XMPA 3KEOA 4INZA 4E08A 1TTHA 3PGJA 1BO6A 3BFJA 4GBGA 4UHBA 3UBMA 2V0NA 1GRNA 3OLXA 3S2IA 3S1LA 4NS1A 1Q9BA 3RC2A 4QE3A 1THTA 5B7GA 3MILA 1JJFA 4KVAA 1DKUA 4ZMRA 1Q7RA 4WGGA 4RSGA 4US1R 3LPDA 2D6FA 1S20A 4ADSG 5FL3A 3PA8A 4JKYA 4D8WA 1KOGA 4NU6A 1QQAA 2IRWA 1X38A 4Y6LA 3ITKA 4ES6A 1WIWA 3SZRA 2Z1DA 2GO1A 1TQ6A 4N47A 2UKDA 1GJRA 1FTQA 1N2OA 4IQ0A 1V3TA 2P7HA 3VPCA 4C87A 3IOMA 5ED4A 2KMPA 2REQA 4BEVA 4RXTA 1XPRA 1MMFB 5BURA 3LW8A 2IITA 4ASUD 2P5TB 4X71A 5IJZA 5JWRA 1DTWA 1E2KA 2Q3FA 4EB6B 1T2DA 1EVQA 4BGVA 3R7LA 3R7WA 4PZDA 1FA9A 1POWA 4G65A 2Q9CA 1R5JA 1PT9A 1T9DA 3T7IA 4BO8A 1A72A 3NVMB 5C2JB 1DWPA 3I8SA 1O57A 3M4NA 1ZXXA 3DHNA 1XRPA 3QYPA 4MVJP 1SHTX 3RGGA 4TKUA 3M3DA 2OECA 3SMVA 4BP3A 2MTBA 5BNTA 2VXCA 2XZOA 3RU0A 1QIMA 5HIIA 1T2FA 3HRIA 1V8PA 1O6BA 2GEVA 1KQ3A 1LH0A 3ZWAA 4YMIA 4R2XA 4CLOA 2R68A 2ZSBA 4NAUA 1AKVA 3ZLVA 1QGUB 3CX7A 2HRBA 4DQUA 1Y4DE 3D3KA 3VNBA 2B3TA 1PTJA 5KC9A 4WT7A 1VL5A 4K9OA 3BDVA 1Q1QA 2ZRCA 5HMLA 3UJ6A 5BVGA 2YS6A 2D2FA 3ZE0B 5CIYA 4DA9A 2M9MA 5JAIA 1E64A 3CWZA 3CURA 1CP2A 2RGNC 4AMUA 4CIAA 3R9XA 3M4ZA 1QGOA 3D9QX 1XDSA 3UF0A 4AJNA 5AT1A 2Y05A 2B4RO 4A8TA 4D3DA 1H6BA 4Y6OA 4YMVA 4C01A 3NETA 5FOQA 1II9A 5K8JB 4QDZA 2ZIXB 2NP7A 3R6WA 1O94A 1Q95A 2VAXA 3VM6A 3OJEA 4JBHA 4XDHA 4MWBA 1UQTA 1TTQB 2V97A 3H9UA 5T6MA 1KQNA 2XWQA 4BXOB 1CZUA 5EQTA 1RPJA 2DWQA 4G0YA 1CUXA 2DZDA 2Q6OA 4FU0A 4KOAA 4RV4A 3LNCA 1P2DA 1MNAA 4I0WB 4IQFA 4KAXA 4MB0A 4RA6A 4W1RA 5J1TB 1H22A 4L28A 3GEPA 1K8YB 2I4LA 3K5PA 2GFQA 2QYOA 1YU6C 4S1VA 4F6LA 2HQOA 5IRCD 2W83A 2DE0X 5IF3A 4QO7A 1E2FA 2CMHA 1NP7A 2XOKA 1BXKA 2AMJA 2HHCA 2IZ0A 2CHGA 3HHEA 3MFQA 3N8NA 1GKIA 5CBPB 2VHVA 3C6XA 4U8HA 1BH6A 2A33A 4PYOA 4TSKA 3VO9A 2I22A 1HLGA 2XTMA 4IUDS 2FETA 1T6XA 1CUIA 2XUZA 4NFYA 1K9VF 5DTMA 1R6TA 1S3FA 3EAQA 4JT2A 4RAQA 2G1PA 2CDCA 3RFTA 5JBIA 4EH1A 5CK5A 4JCVE 1OTYA 3EVTA 3N39C 4CLHA 3RWMB 2X9VA 3S5UA 4ZAGA 3UGKA 5AJVB 3WLFA 5LXTB 4XGIA 2PCLA 4UE6A 3T52A 1NF9A 1HE5A 2XMQA 4I9HA 4IS3A 3UAGA 5JIBA 1AS2A 4RA9A 3ER9A 3T7KA 5FR2A 1F6BA 1T4BA 4XLZA 4WL0A 5HHTA 3N58A 2OFPA 2G0NA 1UXKA 2G5TA 3NAGA 4O4HB 5A0FA 4X92A 4C06A 1UPBA 5HKKA 1CE8A 1T36A 4JR1A 4RBNA 2NQ2C 3IJRA 3R3JA 3K9NA 4XXHA 4B4VA 3H1TA 4X1YA 1YB1A 2KJQA 3EXG2 3NHKA 1T4CA 2IBMA 3BRCA 2G82A 4IO1A 1IMOA 5HWSA 2X0IA 1KBQA 3D7LA 1F3LA 1HWYA 1N6NA 4G0MA 5E1MA 4RK6A 3TZEA 5J2TA 5EWLB 4G1VA 1WCYA 1VDDA 1M2GA 2D3WA 1UBUS 2XKBA 3PR3A 5JZOA 2N42A 3KR1A 5KWJA 1SD2A 2WZBA 4FDUA 2YZ7A 4MQFB 2D5LA 4QICA 1F0NA 2Q99A 1UMCB 2EARA 1Z4MA 2WDZA 5GOTA 1YOBA 1ICIA 2I67A 2JRLA 3GYGA 3IBFA 4X6YA 5SICE 4RJ2A 4CV0A 4UDNA 1L4UA 3PEFA 1CETA 3CJTA 4D8VA 3SJBA 5GOZA 4BQQA 4ZOLF 1H2FA 2CEAA 3Q2IA 4KR0A 4P3NA 4ITRC 1V7QA 3CN9A 6AT1A 1F6WA 5HRUA 1HEUA 2R25B 3U3RA 5ADVA 3TSCA 3K70B 3E15A 3D8TA 1VKHA 3DBRA 3PC6A 4LHVA 4XLTA 1Q83A 4ZQIA 3UB4A 4BQNA 2UUAB 3FYSA 3KB2A 3WGIA 3NGLA 1TGSI 1C7ZA 2IXTA 1SFRA 4HL6A 4JI5B 2JFOA 2V8BA 4K87A 3RANA 3KSMA 4EP1A 4LC1A 3R3WA 1RWKA 4QYIB 2ONKA 1RRPA 4QOHA 3U39A 1R15A 2MHCA 5IVDA 1NMSA 4DMKA 2CNWA 4ZQEA 1E63A 3I62A 2PNFA 2EFYA 3B1WA 3E58A 3P2KA 1GG5A 2PKRA 1T8TA 1OROA 3PL5A 4R8SA 4LZWA 1NV8A 2HA0A 1QH0A 3B7PA 2PSFA 2I3AA 2BCGY 4PGGA 4H1VA 3TNLA 2D06A 3BSWA 4A5SA 4HDKB 1UK6A 1PUXA 4HFRA 1EUYA 4JU9A 4RZQA 1Q1GA 2OGZA 4FKBA 4K6MA 4FKZA 1NRXA 3ZW9A 4XIYA 3EXG1 4F3CA 4ZHQB 2VUUA 5DJ5A 1UAAA 1Y1PA 4MS1A 5JJIA 3VV3A 1AA6A 2FDXA 4BB6A 5F3DA 5BUQA 2VF7A 3NHMA 2FPKA 4UPDA 3D3NA 4JJKA 2TMGA 2HTEA 3CX6A 4YVFA 4MOWA 1M1YA 3KX2A 4IZIA 3UXYA 4AN4A 3U09A 1B15A 1M7HA 2FFAA 3R2JA 2W2NA 1P74A 1MCZA 4B5LA 3SKXA 1OXVA 1YQQA 4C7XA 4ZMSA 4JA2A 4XTCS 4Q66C 2Q4RA 4QTUB 4L3WA 5T4FA 5D6NA 5DPMA 4FT4A 1M8JA 2XYVA 3OI7A 4EQ6B 3HA7A 3ADBA 4TS4A 3CH7A 1OWMA 4FN5A 3V32A 1N2HA 1SQ6A 3GLGE 3P9SA 3CZ9A 4OPMA 2NU8A 3DV9A 1QB8A 3N3BC 4KQIA 3ANSA 2HJHA 4MQEB 4LSMA 3A1DA 4YXFA 4OSEA 5BUCA 3AY7A 4RULA 2O8FB 1E3MA 1E59A 2YHBA 5EMLA 3A9CA 4BMPB 5KTPA 5HX7A 1ES9A 2OCGA 3ER6A 3TTYA 3DG9A 4AWXA 1EX1A 2DQYA 4B74A 2M98A 3QITA 3ECSA 5JFGA 1KK1A 2ZJFA 1Y4UA 3AFOA 2JA2A 3GHYA 1Y3FE 4QGHA 1BW9B 3RRBA 5CB4F 5DNYB 4LRYA 2IPNA 2QN8A 4RV9A 5EHGA 8MHTA 3IEKA 2H1FA 4A0GA 4OQFA 1IXRC 2QM8A 4V02A 1L5GB 2CLHB 2ZTMA 3R0JA 1GYPA 4GPBA 3TQFA 1AGYA 1DX9A 2H2WA 3TXXA 3ESZA 4V1CI 1KI4A 2WM9B 1E1DA 4O8CA 1X8JA 1HNWB 1UZUA 3JS5A 4NMXB 2PKXA 3LK6A 4HWRA 4WESA 1TK2A 4DC0A 1SZPA 3H04A 2C2WA 1NBMD 2RHDA 2Y1WA 1DAGA 1GGJA 1HZJA 1O9HA 2CN1A 2HDOA 4HRAA 1WW3A 1GTL1 1VCMA 2D1RA 4U0JA 1BOFA 3A9SA 3K5HA 4TLAA 2WYIA 3GWGA 1ZR2A 3L04A 3TLBA 1LDEA 1D3AA 4YJKA 3WR5A 4XX1A 4E5PA 5KWVA 4LC0A 4G9BA 5KKCA 3BGWA 1FX1A 1T1GA 2NT3A 4OQPA 4KXVA 4EUEA 2BP7A 1NWHA 3Q12A 1XCJA 1NOIA 3HEAA 4H18A 1OBVA 4MCAA 3I30X 4HQFA 3BCSA 1R4NB 5D1HA 3MMZA 1U04A 2V6IA 3NTRA 1GCUA 3OQIA 5GZ6A 3WJ7A 3ZLUA 4DJFC 2XCSB 1I6MA 3AM1A 1FU4A 1YI8A 3REGA 2AN3A 2V3CC 2XI4A 1YE8A 1ZPDA 3E3MA 3U17A 2CCGA 4EPRA 2DG2A 2FWRA 5JZBA 1JGTA 4E11A 4B9EA 4EY7A 2X0JA 3ED5A 2GJ9A 4Q93A 4QU0A 4BUJA 4BGUA 1F1BA 3BWXA 2ZJYA 3EGVA 3N53A 4KTTE 3RSCA 1YONA 1YZYA 2OB1A 1OY1A 1SZCA 2YRXA 3DFMA 3NV9A 4YAEA 3VPAA 3WXMA 2CDNA 3ZWOA 4BO2A 5LZ2A 3QPCA 3K72B 4PZCA 4MVWA 2BEKA 5ARCA 4E2XA 1WXFA 2DT8A 3TKLA 2QRVB 3TFWA 4KG7A 3H9GA 2IV3A 1P6QA 2AUTA 4JGIA 4KMOA 1WBDA 1BJRE 4CLEA 4R9UC 1AMNA 3HU3A 1D9ZA 1GWNA 2J45A 2LCQA 4XPIB 3S28A 2I3DA 4F9GA 5CXUA 4RLHA 2ZI3A 4GYWA 4E94A 4YAIA 1WDTA 2HMYB 3EFOA 4ESVA 4EVIA 3C2QA 3QWAA 5FOSA 3SYLA 1FVOA 2QENA 3HVUA 1NTRA 4XOUA 1J9GA 4OHKA 1QLWA 1JQAA 2ZSUA 5JSHA 3PHBE 2ONJA 4QLOA 1NVVQ 3ZZUA 1G63A 5CMLA 3FHTA 2ORWA 2FRDA 2E48A 4M37A 1BA2A 3EZ2A 1QH8A 3T3MB 1V1RB 1XDDA 4ARBA 3UENA 2IP2A 4EF6A 2VDJA 2B92A 3ETHA 2AOWA 2JIMA 3NJ8A 5FPSA 1YC2A 2BFDA 3BICA 2CKMA 2XYRA 3G88A 5TS3A 4JDUA 4F6CA 2PT6A 1ZVJA 1VRVA 2FUG6 2BF4A 4K2HA 2VTDA 2NTNA 1WW2A 3HBJA 4HDSB 4EDHA 2XRZA 1JMKC 3CEAA 1ISPA 3BXHA 4EVSA 2CKDA 4BV9A 1R6VA 4IMJB 2OBYA 3HNOA 1MOZA 2WPDA 5CU7A 1YR2A 5GTDA 5AUNB 4Q19A 4B87A 2WP8J 1T8PA 4FLEA 1Y9EA 3TFOA 3N28A 2QMZA 4DIUA 3H2BA 3DBLA 3HB4X 1EGHA 4LC9A 4ARZA 1EJ6A 5DNWA 2NZYA 3TUJC 3GLIA 2X9GA 2FPOA 2UZ3A 2RK3A