4UXJA

Leishmania major thymidine kinase in complex with dttp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
167
Chain Sequence
RGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSDQLMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSKQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDINE KINASE
publication title Structural and Kinetic Characterization of Thymidine Kinase from Leishmania Major.
pubmed doi rcsb
source organism Leishmania major
total genus 47
structure length 167
sequence length 180
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4uxjA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4uxjA01
2GRJA 2WWFA 3LVRE 3VR2A 3SU8A 2X77A 3MFYA 3K0EA 1CR0A 4EJSC 4PQRA 4F38A 1XZQA 4NYIQ 2ANBA 4DDUA 5TMPA 1AS2A 2AKYA 4P32A 3AVUA 4NBSA 1WQ1R 2FE4A 2GZDA 4E5UA 3AVTA 5SZIA 4NCHA 4KLZA 1G8HA 3E5HA 2EFDB 5DH9A 5BYJA 4F4CA 3MGCA 4K46A 1SVMA 1KAGA 2HCBA 1E9RA 1RRFA 2QTFA 5EE0A 4IDQA 2V1UA 1XDBA 1XFAA 4B43A 2NO7A 2G1JA 3CX8A 4X8HA 3BJIC 3GLHE 4JSYA 2GJ9A 5G3YA 2WWIA 2ZS8A 4W7SA 2JLZA 2V3CC 2RGAA 1F2TA 1UKZA 2IBMA 1XJ0A 3GD7A 3TQFA 1E1QA 4P4SA 4V0OA 1Z28A 1E1RD 2FZ4A 5FL3A 4I1OA 3W3AA 2GESA 3CR8A 3EZ6A 1F2TB 1E2MA 1CR2A 4NCNA 1E2FA 1C4OA 4HAWA 4P4SB 2R6DA 1R5OA 5JCPA 1U99A 4M9XA 1FQJA 4LBYA 3CRRA 2WJGA 1OXVA 4GBMA 2TMKA 2JLRA 3T35A 1CLUA 1TPZA 4B6EA 1U9IC 1ZU5A 2KE5A 2NO9A 2WMNB 3CWZA 3JVUA 2ZI9A 3MWLA 3Q7PA 4URWR 1FP7A 2XJ4A 4W5HA 3GLHA 2C78A 1KI9A 1W0KD 4URVR 2ZR7A 1Z6GA 1N0UA 2YJTD 1LV7A 1HQYE 1II0A 2I3BA 2ZVPX 2AFHE 3GLHB 1P2UA 2BV3A 3W6PA 4OKSA 2ZRPA 4TLCA 4OK5A 3WHLA 1UKVY 2FX3A 421PA 1W4RA 2QE7A 5KSPA 1WXQA 4H9GA 2F43B 3LVQE 4Q48A 1W44A 1UFQA 4B2IA 1AGRA 1M7BA 4KFTA 1KI1A 1VCNA 1JB1A 1R8SA 2GCOA 2ZRLA 2CL7X 5EP3A 4IXMA 2GILA 3MLEA 1OH6A 1KMHB 1AZSC 1E4YA 1G5TA 1GNPA 4XH9B 3KQKA 3MG9A 4QBFA 2PZEA 3LH5A 2GCOB 1UADA 1U8YA 1G3UA 2ATVA 3AKDA 1ZIOA 2QEQA 3GJ0A 1OH7A 2GAAA 4LRWA 5FBWB 3BH6A 2ZIAA 2BCJQ 2V9PA 3FHTA 1S0UA 1HYQA 2D7DA 5CM8B 3RABA 4LJ5A 1P73A 2ZJBA 3QBTA 1P72A 2F3RA 4CEIB 2Q3MA 3FHOA 4MKGA 4DWJA 4DZZA 4W5JA 1PUIA 2HF9A 1RFHA 1ZUNB 2O5VA 4IFBA 4C2TA 1AKYA 3DKVA 3UANA 2XGJA 3GJXC 1L2TA 2FWRA 4O3MA 2J0SA 3MUFA 2RGCA 3FDIA 5D3QA 4POAA 3A36A 4M1MA 1U8ZA 3NBYC 5AJVB 3ADDA 4Z8XA 2MMCA 3KKPA 1WBBA 1IY2A 3IDQA 5C18A 2YOHA 3H86A 1SGWA 1ZJ6A 1G291 3EZ9A 3HYTA 4V0LA 2ZSAA 1ZNZA 4KHZA 4NHOA 4P4TA 1E0KA 4R2IA 3W6NA 3X1DA 2KBEA 3QKSA 4Y0AA 5FUYA 4E07A 3KXLA 1NY5A 4OQFA 2J1LA 4BLTA 1UJ2A 2ZXUA 2ANCA 5BWMA 5FTJA 3X1ZA 2NMVA 1NKSA 5H70A 1DAMA 1TF2A 3QKSB 5FOSA 3TE6A 3DMDA 3ZZUA 4AYXA 4R7ZA 5JEDA 2UKDA 3V4RA 3KXKA 4GL2A 4EQ6A 2IF0A 4OQXA 3T5DA 4OHWA 2IX3A 1CRPA 2XSZA 3DHWC 1N6RA 3U7GA 821PA 5FPYA 4NCJA 1U8AA 3RWOA 3I8SA 4IOMA 2ZRIA 3AQ4A 5C2JB 3DEFA 2FOLA 1NY6A 3AF2A 4GNKA 2JLXA 1RRGA 1JQJC 3WP1B 4OI4A 2PZFA 4JL6A 4TL6A 2IYTA 1AZTA 3UGDA 4TLAA 3U5ZB 2H16A 4EFLA 5F9FA 3EPJA 4ILEA 1XMJA 2QP4A 1KZ7B 2JJ2D 2R6AA 4G5GA 2QI9C 2Q6TA 2ZJZA 1RJ9A 2JJ1A 3GJ5A 1Z08A 3B82A 2FH5B 2J45A 3OFND 2WWWA 4PSVA 1DAEA 1G18A 3H4MA 2ZROA 3RS4A 1GRQA 4IJMA 1A5TA 1CIPA 1X8KA 1X1SA 3PEVA 2F1RA 3CB4A 3PEWA 2DFKB 1RJ9B 1OFHA 1KDRA 2IXFA 3AM1A 4A2PA 1NBME 1MO6A 3SYLA 4PO1A 2QA5A 1GOTA 2C9OA 5EJEA 4IDHA 3A4MA 3TUIC 3ZDQA 4D81A 4BGDA 4JLOA 4DLVA 4LJAA 3LLMA 3SN6A 1YRAA 2JJ8A 2D2FA 4B33A 3IILA 4LC1A 1R4AA 3HU3A 1Q3TA 4Q03A 2ZI4A 4JLVA 3G0HA 1ZNWA 1QVRA 5HCNA 1S96A 2CL0X 5A4JA 1U98A 1IXZA 2GWHA 2N46A 2OO7A 1AQUA 5TARA 3AGQA 4JVNA 1YZTA 5LBIA 5FBVB 2V55B 2CE7A 4GDFA 2BMEA 1NN0A 1QHGA 2HF8A 5EXTA 3WYGA 1IQPA 1GG2A 1NBMA 1P61B 4OJQA 3THOA 1BMFA 1G7RA 2XNDD 2L0XA 5EZ5A 1K8RA 1OKKD 3VR5A 5EE1A 3K9GA 2RGXA 1DAKA 2CEAA 3L8YA 2DWPA 5DYGA 1XPRA 5BQ5A 3BB3A 3BC1A 1MRSA 3PUWA 4IOKA 4PPNA 1IN7A 4JJKA 2ZE5A 2VIIA 2ZRAA 2C96A 4MKFA 2O52A 2GCPA 3M0EA 1HT2E 2OAP1 3SR0A 3LW7A 3ASYA 2LCFA 221PA 2R2AA 3LQQA 3NVAA 2YOGA 1DVRA 2ZE8A 4Q4HA 4UXJA 1S1CA 2IF2A 3C4JA 1XWIA 3TAHA 4RD1A 3R7WA 3H1TA 4P33A 1IXSB 3NWJA 1SXJA 1TEVA 5HKKD 3V9PA 1UM8A 5K8UA 4II7A 4Q4HB 1XD2A 1H8ED 4M1WA 4CW7A 3QVUA 4DC9A 3MJRA 2H8KA 4UNSA 1G3RA 1OHHD 3R7WB 2Q9AA 1SXJB 1NJGA 3BE4A 3QVVA 4KO8A 4DUGD 3EPLA 1EX6A 1XD2B 721PA 2G9NA 2GZHA 4HAZA 4DLTA 4NYJQ 1KGDA 1EFUA 4XIGS 3EW9A 1KO5A 2FEMA 3MMPA 3HPRA 1IN4A 1MH1A 1GFIA 2QP3A 4RFVA 1OIXA 4GZMA 2J0VA 3VQTA 3N70A 3SOPA 2WIAA 3BIFA 1M6NA 5DLQC 1CKEA 3TSOA 3UKDA 2CCKA 4AKEA 4IVQA 1GIAA 4F92B 3JZMA 5BYKA 5AUQA 2ZU6A 1D8TA 1GDDA 1BIFA 1RRCA 1MV5A 2JIZD 2ZU0C 4B44A 5GJBA 2RGDA 1AIPA 3HPQA 4DB4A 3TAUA 4IHQA 1W2GA 4QJ4A 3QJYA 3CPJB 3IIKA 5JZVA 3AVPA 1YHNA 5E95A 4IOJA 1JBKA 2VLIA 4XVQA 4MRSA 4QJ3A 3GLGE 1HEIA 3KKQA 3BORA 4Y0VA 2C5LA 3K70D 1O3YA 1ONBA 4ZPXA 1GILA 3B7GA 4Q4AA 2YYZA 4TYPA 4CF7A 4C0AC 2I1QA 5JMTA 3KQLA 4V0ME 1KJYA 2OHFA 1VYTA 3KUCA 3NH6A 4C0QC 1E98A 4KITB 4D0NA 1YU9A 4Q4AB 4OBEA 2C98A 1P2SA 3WXMA 2VSFA 2QSYA 4RVCA 1FNMA 4B6FA 4HAUA 2VP9A 1OW3B 1TU4A 5JI3E 2DHRA 2W2XA 2VP0A 4RKEA 5FOTA 2F1HA 2JLWA 5TDHA 1OXUA 4PZYA 2ODBA 1X8JA 1I4DD 5EP1A 1TQDA 2G3YA 4KFSA 2HJGA 1KOFA 2VA8A 1NSFA 1QHIA 2XOKA 3K09C 5TXGA 4LY6A 3K70C 4TTRA 3GLGA 4MITA 5IDVA 4PAOA 1FPMA 4YXWA 4DDVA 1VHLA 3EG5A 4OK6A 3QIAA 2OEPA 3TK1A 2EVWX 4TT3D 1IHUA 5C4MA 2FSGA 4B3FX 3GLGB 1W0KA 1YZQA 4JYCA 5LD2C 1KO8A 3NDBB 4KJZA 1TTTA 3KXIA 3NEYA 2UZ3A 1M7HA 4W5WA 4QC2A 3V4FA 1T4GA 2HJVA 3QG1A 4EDHA 3EA5A 2FU5C 4TSFD 2DFNA 1ZCBA 4TTQA 1W48A 4LX0A 5A5GA 4FMCB 1GNRA 1E0JA 3LFUA 3EARA 4P3YA 2C03A 4OQNA 5UKDA 5JCZA 3AKEA 3K9NA 1DO0A 1VDZA 3TVDA 1R0WA 4GOXA 3BERA 4KYIB 2GJ8A 4O2LA 2C99A 4AI6A 1JEEA 1KI6B 4Q7KA 1NLZA 3MJHA 2GA8A 3BFKA 4PC1A 2QGNA 1NN1A 2P2LA 4QM6A 2PZGA 1KO4A 3UWOA 4YMWA 1BYIA 1P62B 4WXRA 4QKQA 2XTZA 1KI2A 3M6AA 3I5YA 4BLSA 3RVBA 1HH4A 4IOLA 2XTNA 3I73A 1UDWA 5E4FA 2Z43A 3U3OA 4RCYA 4X8OA 2EU8A 5DI9A 2BVNA 4DKXA 4KSBA 1P5ZB 4KLNA 1G9XA 4TMVA 3SS8A 4UJ5A 5CYOA 1LF5A 1P3JA 4PX9A 4HZUA 1DAFA 3OIVA 5B57C 3O47A 1GWNA 4RD6A 1QHXA 5GJWC 5JHGB 4MUAA 4C0BA 2KBFA 1PTQA 3RS2A 2ZM5A 2A5JA 2ZYTX 1QHYA 4M1TA 4A8JC 2DB6A 4Z54A 1X6VA 2RKOA 3I72A 5JEEA 1VCOA 4GSYA 1D6JA 3VTKA 1TADA 4XD7A 2HLDD 2WJHA 1QDEA 4P31A 1IAQA 2F6RA 3SEAA 4PSKA 5HZHA 3B2EA 2XB4A 4ITRC 4KCGA 2AKAB 1EFHA 2I4IA 5J4YA 5AWFC 1E2QA 5BN3A 3I92A 3HJNA 3OIWA 2IYWA 1XCPA 2YOFA 4LPSA 4ZV4A 1JQLB 1FFHA 1XBTA 5GVRA 2PEZA 4B3CA 3QE0A 2GXUA 2BM1A 1PJRA 3TUJC 4I4LA 3EZ7A 3U3KA 4PHTA 3EPKA 1ESNA 1E9DA 1XTSA 2D3WA 3T5GA 3VNUA 4ERNA 2WAXA 4LDJA 3IIMA 3NKVA 3UXMA 2JATA 2QAGC 3A4LA 4C0LA 5FL7D 1O87A 4XVUA 3X1WA 4UQOA 1WF3A 1IJFA 2GVZC 1XB2A 4BASA 2ZS7A 2FMXA 4HZIA 4RD3A 1JAHA 1CJTC 4F91B 4HAXA 2LKDA 3FB4A 1KBEA 3HP1A 2CK3D 3T1VA 2P0EA 2QM7A 1KK3A 2KJQA 3ZLJA 2H57A 1U0HC 2ZRMA 4DCUA 3DVLA 2A5YB 2AD5A 1SKQA 5TY0A 2GVIA 1FUUA 1G17A 1FX0A 2J7KA 1XD8A 2VHQA 3P4YA 2FEOA 4XTCS 2X1VA 4FMBB 4H1VA 3JZAA 4UKDA 2A7QA 3L0OA 4ZIRA 3LBNA 1TQ6A 1T91A 4Q9HA 1JJ7A 2RCNA 2VHCA 1FX0B 3GPLA 4MYTA 2AD1A 3AF1A 4BFTA 1R5BA 4BECA 2MMGA 2PJRA 3I4LA 4D82A 4JBWA 3TW8B 1COWD 4ZIRB 3B85A 3T1TA 3LRPA 4OHZA 1KJZA 1Z6XA 1ZM4A 4GOJA 1E96A 3U3JA 4EIWA 3U6KA 2AK3A 1KKMA 1JR3D 3CX7A 2FNFX 3SBEA 4GOKA 2WV9A 4LWZA 2IHBA 1ZM3A 3CIOA 1GITA 1G6HA 2QT1A 1J7KA 5CLLA 1RPZA 1EWQA 2CNWA 1G3QA 3QKTA 4HLCA 3C5HA 2GVDC 1NJFA 4A0FA 1TNDA 2WAYA 4DEYA 4CRWB 5FTNA 3UGLA 3CNNA 1OH5A 1FQKA 3MAAC 2ZR9A 3O8BA 2ODWA 4M1SA 4L9WA 4JMPA 2J7PD 4DHEA 2P6RA 2PEYA 4KYUA 1FZQA 2CHGA 1JALA 5DHAA 1F60A 3NHAA 4MQBA 4X8MA 5DYIA 5DISB 3U7EB 4BEBA 1LY1A 3CKLA 4GZLA 3QKRA 1XTIA 2OV2A 2EWWA 4HB0A 1Q1ZA 3RSLA 1RE0A 4B2PA 2DWOA 3PIRA 2CVHA 5JWOA 4M1KA 3QKRB 3SZRA 4LSGA 3D7MA 4IXNA 1K6MA 3TLXA 1HTWA 1TF7A 2PMKA 5FTMA 3W5JA 2CE2X 5JHHB 2D4HA 1P2TA 1Q20A 2X19A 5HKKA 1W36B 2J9RA 2W2TA 3K0AB 3LLUA 4M53A 1XA6A 4Q1BA 4US2R 3EAQA 1ZP6A 2NO0A 5DN6D 4QHYA 2W00A 2IWHA 1OE0A 1A4RA 4WZ6A 2IW3A 2B92A 2FA9A 1ZD9A 2PLRA 1OJLA 2RHMA 2ZUBA 1Q1BA 3IHWA 4B32A 1GUAA 4L16A 1N6KA 1HURA 2Z83A 1S9HA 4UXIA 2W0SA 4R98A 1BH2A 4PANA 1NIJA 5A0FA 1XXHA 1NL3A 1GKUB 3QPUA 5JWHA 3H2YA 2IEZA 1OB5A 3P20A 4Q1EA 2FPMA 3F0TA 2CBZA 4ZCLA 2XZOA 3O8DA 2WBLC 4JT2A 4PZLA 5KPJA 1M34E 5FBQB 3J81k 3GEIA 2BBTA 2W6IA 2G0TA 4QNMA 1DAHA 1NMXA 2OFXA 1CULC 1UAAA 1W0JA 5KNBA 3H0KA 1W7AA 4RZ3A 3AGPA 2NPFA 4RSGA 4CIDA 4DXAA 1T8TA 2XX3A 3EASA 4KXFB 4RZXA 2W58A 4D80A 2JIZA 1CJKC 1DO2A 3ETLA 1E2PA 4I1VA 4UNPA 2WWGA 3QEJA 1P2VA 3AVXA 4TYNA 1HE8B 4US0R 3BFVA 1VPLA 1ZCAA 4XWOA 3PUYA 2ZANA 3KFXA 4WXPA 1R0XA 1G21E 4QJ5A 1E79A 2C04A 3K09A 3PUZA 4M8NE 3CZPA 1OSNA 5GJVC 4XSHA 4LJ4A 1FAQA 2GK6A 4DT1A 2XZPA 2GJKA 5EXSA 3Q7QA 2QUZA 5J4LA 3FHCB 2QQ0A 4BZXA 3PEYA 3K70B 4DBLC 5K8IA 1VCMA 4DT1B 5DIFA 2HT1A 5FBLB 2ZUDA 1UBCA 2QENA 3NBXX 1RRPA 1P6XA 3REFA 2B6HA 4O25A 3W6OA 1H8HA 3ZVLA 1LNZA 3QXCA 4RD0A 1K5GA 4A6XA 1D2EA 1JEDA 1GAJA 2ZPTX 4RJLA 4D25A 5L3RA 4NCIA 2CVFA 5BW8A 1II9A 4A0GA 3W3ZB 2F3TA 4D0LB 3CXLA 4PSAA 1JXOA 1XZPA 3B1ZA 3FMIA 1OFIA 2Z0MA 1KSGA 3HWSA 1SVKA 4FCWA 2WOOA 5KDDA 4LV5B 2IK8A 1AN0A 3KB1A 4IW3B 4YDSA 3UMRA 5HR5A 4M9ZA 2ENNA 3B78A 1VTKA 1Z6AA 2JA1A 4AKIA 3QSYA 3Q5EA 5AJZA 4N0EA 4NYMQ 3IBYA 3AP2A 2R44A 1Q57A 4D4MA 4YMVA 3QF7A 2WWXA 2GZAA 3B9QA 1AGPA 2ZREA 4NH0A 3LWNA 3ZQJA 2EFCB 3A1WA 4AURA 4OHYA 3TRFA 3BB4A 4JLPA 1R10A 3UG6A 5JJKA 3B8HA 1NF3A 3MRSA 4CEJA 4Q9KA 2EYUA 2MSEB 4LHVA 5F2EA 4UNRA 3OAAD 2IYZA 2OG2A 3LNCA 3PG5A 2V6IA 2BMDA 3NTUA 1J8YF 2WIBA 4WZAE 4LJ7A 4CEJB 3SHWA 1PLJA 4DCVA 1G1MA 5CJ2A 2K5UA 4Z51A 3UWKA 2E1RA 1XP8A 5SZKB 4A8JA 1B23P 5EZ6B 2LKCA 4DCNA 1KO1A 1OLOA 4L9MA 3PJRA 1MO4A 2HXSA 1D2NA 3VR1A 3MD0A 4NE2A 1U90A 2VYFA 4Q19A 4LYHA 5EP2A 1S8FA 2R6FA 2WPDA 2OESA 5F3WB 3BWDD 2O8EA 4QNRA 4YONB 1C9KA 1NIPA 1ZC4A 3KJEA 1KSJA 2HCJB 2O8BA 3VFDA 5HCIA 3C5CA 1TBNA 3RS7A 4F4JA 4OI1A 1RC8A 4YQFA 2D06A 1HUQA 2SHKA 3UEYA 2ZYUX 2O8BB 3RC8A 3BH7A 4OQLA 5FOUA 4AY2A 2OFWA 4LI0A 3SE0A 4BZQA 5E7IA 4Q7MB 5EUQB 2PJZA 1M2OB 3KKMA 3QXJA 5FOWA 3X1YA 2B7BA 3GLIE 3CRVA 3UATA 2V54A 2ZRJA 4ASUD 4DLSA 1WBDA 5FH9A 3D31A 3CRW1 1P75A 4EQ6B 3QENA 1UDXA 2BWJA 1A2KC 1ZU4A 2F7SA 3ECCA 2J87A 1NVVR 3VMFA 2VP2A 3NC0C 2GJSA 2HT6A 1DOAA 2H7VA 3FMFA 5C1BA 3KZ1E 2AX4A 5CB6A 1S3GA 4D2IA 3VX3A 2V7QD 3CRQA 4TN1A 4LHZA 3R9WA 4DJTA 4TL9A 1G8YA 1X1RA 2G0NA 2WWYA 5P21A 5EXPA 4BUJA 3CONA 2ZSDA 3KY9A 3I3SR 5FL7A 5JS7A 2ZQ5A 4Q4JA 3WBKA 4HLUC 2IYYA 2QAJA 2C9YA 4A4DA 3JVVA 1GL9B 2XZLA 3N2IA 3GLIA 3VKGA 5FFMA 3ZQ6A 1XCGB 3FKSD 1VMAA 4AYTA 5HE8A 4Q4JB 1QBKC 4EPYA 4Z1MD 1OXTA 1LB1B 1GRNA 4OL0A 2R6GA 2A5GA 2ZI7A 5BXQC 2CK3A 3WMEA 5J4HA 1NN5A 2J3EA 1YE8A 4Q5IA 3GLIB 3AVWA 3VKHA 3LO5A 5DI3A 5CM9C 2NG1A 2EFHB 4KU4A 1W4AA 2VF8A 4C0JA 3VU9A 1OV4A 1X3SA 3ICQB 2IYQA 4MRRA 5DI3B 2ZJOA 4Q7LA 3MWJA 2VSXA 4JLKA 4MRPA 2P6UA 1E2JA 3B60A 2DY1A 2YWEA 3CR7A 3VU9B 5J4KA 1US8A 2VHUA 3MWKA 5BN4A 4C0KA 1COWA 2GK7A 4B3XA 4DIDA 3WBJA 3CX6A 4BPBA 2WWHA 2ZR0A 3OE7A 5B58C 1LS1A 4MGIR 5IHPA 2D62A 3IUYA 4HB3A 3RSOA 1OYYA 4JKIA 1SXJE 3NIBA 2EFGA 3L0SA 5HTKA 2ASEA 3LXRA 4MYCA 5J5CA 4ZKEA 2W2VA 3PUVA 3SQXA 3CF0A 5SZJA 1U0LA 3Q3JB 2ZTSA 2QTHA 1E2EA 1GL7A 1D2MA 2OCPA 1N5KA 1G3IA 4EPRA 2ZRFA 1T8UA 5BN5A 1HQCA 5ELXA 1Q1QA 4LJ6A 1OXXK 3RANA 2J41A 1N6PA 1QF9A 3QQ5A 3N2EA 3TMKA 1XPUA 5KSZA 1NNEA 4TLBA 1TUEA 2ELIA 1WDTA 3NEJA 5DO9A 3ZJYA 3QUSA 2ERYA 1PZNA 2J7PA 4GP7A 4YMUA 1Z0AA 3EWAA 4B75A 5J40A 4Q4LA 2WM9B 1XEFA 2Z4SA 3PFIA 1RIFA 4LC0A 3GLFE 1RYFA 3IPYA 3VX4A 4NYIR 2H5EA 4CDGA 1EFTA 1P60A 3BOSA 3WNBA 3VR4A 4LBZA 4AYWA 3T1QA 2ZJYA 1NSTA 1T3LA 2O0JA 5IK2D 1C1YA 1E9AA 4LV8B 1GP2A 4E22A 5KTYA 1MRNA 2NGRA 4L4UA 1YZNA 2CMKA 3B13B 3U6BA 4XWKA 3AH8A 4QBIA 5GVSA 2GAOA 4WVFA 4LBVA 1MT0A 4V0NA 1KY3A 4EJSA 3Q72A 1DBSA 1E0SA 2C2HA 2OT3B 5DN6A 4TMKA 1E69A 2ROWA 1E2DA 4NDZA 2R6CA 2AXNA 2QSZA 3TNFA 2WZQA 4EJSB 1A82A 2QORA 3AKYA 3PCRB 1VECA 4B2LA 3GLFA 2O8FA 2CL6X 4F93B 5DSZA 4BQSA 3I1FA 4DLYA 2B21A 4GT1A 1KDOA 2YV5A 3FFBA 1U94A 2AXPA 2QMEA 2VEDA 3RS0A 5JJLA 3Q85A 3BJIA 4KI0A 3GLFB 2O8FB 1CS4C 1Z3IX 2FPKA 2ZSBA 3NC1C 4JLMA 2R9VA 5KUTA 4JVMA 3CUEF 4DRZA 5H1YA 1SQ5A 4Q18A 2GXQA 1S2MA 1L7VC 4TL7A 3CPEA 1XU4A 3ZVNA 2VO1A 3TIFA 2BJVA 3FE2A 5L3VA 4HLDA 4U00A 1KAOA 4JSTA 3VR6A 3KJHA 2IHYA 4QXAA 5KDOA 1JAIA 4IDPA 2ZUCA 3FYHA 3NG1A 3K9HA 4JYBA 3V00A 3WYAA 3RYTC 2IS6A 2QQEA 4TQUS 4CEHA 1E2GA 2YWFA 4TMZA 2DBYA 4B34A 4GRAA 1Q0UA 2N1BA 4PZZA 1HY3A 2R65A 3M1IA 5DGXA 3TR5A 4GMDA 1TAGA 1U9IA 2ATXA 1XEWY 3DM5A 3PVSA 2X2FA 4CEHB 4HLQB 3I61A 2W83A 3KKNA 4CGZA 2DFLA 5H8WA 4HDQB 4Q00A 1KSFX 4NYMR 1E1RA 4EKDA 2BKUA 1WMSA 3QKUA 3EXAA 4EUNA 4URXR 1KKLA 1L8QA 1LS6A 1T0HB 5J4VA 4YDHB 5FR2A 2ERXA 4Q9JA 3QOFA 4R2HA 1Z0KA 4JVSB 1KI7A 5AUNB 4IEEA 1KK1A 4PC6A 5CDFE 4NMMA 1KY2A 1IY1A 1P9RA 1Q12A 2I1VB 3UMFA 2J0QA 3NH9A 1T6NA 4B74A 2ZVQX 1MABA 3BD9A 2ZRGA 2ORVA 5KSYA 2ZJ8A 1FW6A 2H17A 2BIFA 2FZLA 4DLWA 2DR3A 1XX6A 1SVSA 4FWTA 1MABB 4LJYA 2ZSFA 3FMPB 4HDCA 4LZZA 1KZGB 4Q02A 3B9PA 1MO3A 1XRJA 4HUQA 1L4UA 1ODFA 1Q21A 1RW4A 4EFMA 3QPVA 2YWHA 2ENZA 1R0ZA 1YZLA 1KK2A 4JVLA 4JKYA 1N6NA 4HUQB 5HE9A 5LB2A 4WA7A 2JAQA 2Q21A 4PC2A 3QBVA 1TL7C 5CDFA 4TMWA 1H65A 1E94E 1QVAA 2QE7D 2W0MA 1J70A 2ZJ5A 3F8TA 2GDJA 3LQRA 4OJKA 2HYIC 1K5DA 1J90A 3SFVA 4MUBA 2NIPA 5C46F 1FP6A 2GBLC 2ZRCA 2CDNA 4I99A 4B76A 1JNYA 3LY5A 4MGKR 1XTRA 2QMOA 3K0CC 3X1XA 4U02A 5CB8A 2UZIR 4DIEA 2H1LA 1U2RA 2XAUA 2GEVA 4C2UA 2WSMA 3A4NA 4JLBA 5JSZA 2VP5A 2QMHA 4S35A 4QHSA 1KMQA 3UGIA 2OBMA 4EPWA 1YR8A 1HV8A 4AG5A 5JSZB 3UFFA 3AV0B 4QGGA 3QY0A 2CHQA 1FNNA 1LVGA 1J2JA 2HV8A 4MDFA 2NTYC 4G3XA 2OAQ1 2IYVA 1M1YE 1I2DA 4HZUB 3P26A 4ZCMA 4R9UC 2IC5A 3RS5A 2IYRA 5FPTA 4OYHA 2O8CA 2FSFA 2QGZA 1TX4B 1PLLA 1S1MA 2GNOA 3LW8A 3CF6R 1XTJA 1YKSA 1LF0A 4KV9A 2O8CB 1GSIA 4FWIB 3Q8XB 2ORWA 2ECKA 2JCSA 1E4VA 4FI3C 2OE2A 1MOZA 3I5XA 1UKEA 2ZRBA 1OF1A 1GTVA 4LYAA 1SVWA 1W4CA 1Z07A 1JI0A 1G4AE 2RAPA 2CXXA 2NO6A 2RB4A 1T3SA 3K9LA 4IVRA 1KHTA 5CK5A 2P5TB 1XNJA 3CWQA 1QG2A 1CJMA 3HU2A 4ASUA 4HLUA 3PENA 2YUUA 3SDZA 3ZS9A 2O0KA 4BFZA 1Z6TA 3KJIA 4A1FA 6Q21A 1EK0A 2ZSEA 2H18A 2FGKA 3DL0A 5EXXA 4BFYA 2JLUA 5K8LA 4HAVA 4LV6A 4YMTA 2IS1A 1ZYUA 3T34A 3WRYC 4MA4A 1JECA 2RGGA 3QEOA 2V7QA 5HPYB 4CVNA 1HT1E 2QBYA 4KFRA 4K8OA 4MYHA 1WRBA 2JJ2A 1YVDA 3CNLA 1FUKA 1DEKA 4LUCA 4MGYR 4AIIA 2KB0A 3WP0A 2ZRDA 3EIEA 1E0AA 3OFNA 8OHMA 1R7RA 1WCV1 4BFWA 5FTLA 3IO5A 4FKDA 4V0KA 2QBYB 1Z47A 2QZ4A 2IUUA 4TLDA 2FGJA 3EWSA 2JJ1D 5LDDC 2G88A 2IUSA 3SC3A 1G19A 3IPXA 3RS3A 5AUPB 3FKSA 1VIYA 1X86B 4ACAA 4D26A 4YC7A 4DLUA 4QFMA 5L3QA 5JI2E 1R0YA 1S9DA 2REOA 1IXRC 4TQ9A 5EUMA 4DSOA 3P27A 1T9HA 1WE2A 2VPPA 1GVNB 3QXHA 3FTQA 3B1XA 5L3QB 3IO3A 1ZRHA 1XCMA 5FOXA 4QL3A 2WJJA 1JPNA 3DOEA 2DWQA 4F7WA 2RH5A 2V8OA 3SHFA 2D7CA 1YQTA 2ZRNA 3THXA 3I8XA 3OHMA 3CLVA 4PPGA 4B3BA 4QM7A 2FSHA 3PITA 3DPUA 4PAQA 1VIAA 4CZ2A 4HEJA 3THXB 3IEVA 3R9XA 1V5WA 1ZM7A 1IONA 1BS1A 2OXCA 4XJXA 3SBDA 1EGAA 3CO5A 4FMDF 5AUOB 4LCBA 2GXSA 4NYJR 4QOSA 1TQ4A 2AN9A 2XNDA 1DTSA 1OKKA 2ZI6A 3U61B 3THYA 1IJEA 3BB1A 1NBMD 1ZD1A 4M0LA 4ZDWA 1BMFD 3ZD6A 3E2IA 2BMJA 1QZXA 1UBEA 1P4SA 1ZAKA 1UBFA 3SJCA 1T0JB 2WOJA 3OEHD 4JT4A 4Q1DA 4QBHA 1PVOA 3A1SA 3MSXA 3UG7A 2FN4A 2P3SA 2ZITA 1XXHE 5B2ZA 4EPTA 1Z8FA 5C4GB 4G5OA 2OCBA 2XNSA 5FTKA 2E87A 1CXZA 3KX2A 3GJ6A 3LXXA 3KQNA 3TUZC 1BYUA 3KB2A 4LHXA 1ETUA 2Y8EA 4I1SA 4ARZA 3P32A 2KI5A 4D6PA 2IYUA 4C0SA 3ZZ0A 3TKLA 1H8EA 2XEXA 4QG7A 3W8NA 5HZKA 4C0HA 3NDPA 1QHHA 1OHHA 2IT1A 3SYNA 1E9BA 2IL1A 3TSZA 4ARZB 3DM9B 4LOAA 5FI1B 5IK2A 4DUGA 1VG8A 1U0JA 3ADCA 3UK6A 2FFHA 3GFOA 2ZEJA 3HR7A 1QHHB 4ZDIA 1G3MA 2F1JA 4URZR 4JLDA 1N6HA 1N5IA 5TV2A 3K1JA 1I4TD 5F98A 2QP9X 1L4YA 1Z83A 2Z4RA 1KDTA 5KDLA 4FW9A 1W47A 4M9SA 1W2HA 3H84A 5DHFA 1XXHB 1IM2A 4U5XA 1AJEA 1MR3F 3U2QA 1OPXA 1NLFA 3A1VA 3GMTA 3ZGXA 2A78A 1DE0A 2DPXA 2QM8A 4ZO4A 4C30A 1E6CA 1M7GA 2ONJA 2E73A 2ZI3A 4QGHA 1G7TA 4Q21A 2FDCA 4PPQA 1Z22A 3W9YA 3RHFA 4ZCIA 3C14C 2DYKA 2P5SA 1KJWA 1UPTA 4LJ9A 2JASA 1AS0A 4TZ6A 4O2RA 4BEJA 3BGWA 2X2EA 4Q1AA 4BFXA 2XB2A 3OZXA 4MYUA 2NQ2C 3RNLA 3EIHA 2PT5A 4L9SA 4FMCF 5CJPA 3VNVA 2DCUA 1CTQA 2YNMA 4PQFA 1VKJA 5EE5B 1IY0A 4AD8A 3FMOB 1KDPA 4DSNA 5JRJA 3CH4B 2NZJA 3AVQA 1KI4A 4BWYA 1HE1C 3SQWA 3AF4A 3LBIA 2J0UA 1E9CA 4HUTA 5EQTA 2ODNA 4RCZA 2YINC 4BFSA 2OBNA 2J0UB 2VHJA 4Q1FA 5F9HA 5FR1A 4BRUA 2B8WA 4PHFA 2UVQA 3M4YA 3S1AA 5LD2B 3QXXA 3ZIAD 4B47A 3T12A 2BHRA 4PR0A 3WHKA 2O8DA 1UKYA 4GP6A 5JS8A 1YR9A 3C8UA 3U4QA 4DSTA 4U7DA 3ONWA 2WMOB 4D4LA 3S1AB 5G53C 2WTUA 2XOKD 2O8DB 2ZRHA 4TT3A 3U4QB 4YXWD 4M22A 1SHKA 1XJQA 1G6OA 4KFUA 2OLJA 3BH0A 1ZUIA 5CIWA 3OEED 2XTMA 4G5RA 4I1UA 2HUPA 5AJYA 1P9WA 2GBLA 2JGNA 4DSUA 3ADKA 3K8YA 1XPOA 2YC4C 3K0CA 3B1YA 3BFXA 4PO9A 2ORIA 4TSFA 1CJUC 1NN3A 1TU3A 2F43A 1E9SA 3E1SA 1IN6A 2WHXA 1F48A 1RYHA 2ZRKA 3GEHA 5JLJA 4JL5A 3GCGA 1IOZA 2MSCB 3C15C 3LBHA 2GETA 4IKEA 3W34A 2QN6A 5JRZA 1KMHA 2EQBA 2J46A 1VHTA 3TQCA 4TWZA 4YLGA 4MKHA 1ZUHA 2GF0A 4BFVA 4D4KA 4NPHA 4ZI2A 3DO6A 4D4JA 1TBOA 4TYQA 2FG5A 3P1JA 3KTAA 4W9MC 4C4PA 4DCSA 2QROA 4HSEA 1E2HA 2QT0A 4Q9LA 3AVVA 1FARA 4E09A 3L43A 5TVKA 1EG7A 3AB3A 1G7CA 2XXAA 1YJ5A 3F5FA 3B1WA 3D8BA 3KTAB 3L0IB 2RGNC 4N0DA 2F55A 4BLQA 4F4IA 3WNCA 4CEIA 4ESVA 4A8JB 3DDCA 4LJ8A 5JFGA 2V4ZA 1G64A 4D0GA 1WB9A 2OLKA 3KQUA 4IVPA 2G6BA 2VBCA 2XXAB 4L5BA 3A1TA 2FSIA 1QG4A 1Z2AA 1LFDB 2QNRA 3GJ3A 3BK7A 3G5UA 4FN5A 1KSHA 5KNDA 2WJIA 1IBRA 4G01B 3U44A 2IYLD 3GFTA 1UEJA 4KBFA 2HXYA 1OFUX 4TL8A 4Q7JB 4BE7B 5JBQA 1SVLA 1N25A 3CM0A 3RRMA 4N3NA 2O8EB 1FOEB 1YZKA 3GQBA 4MGZR 3U44B 1YR7A 1DELA 4P0TA 3EC1A 2HLDA 5LPNA 4Q01A 1OFTA 4OI0A 4M1OA 2IYXA 2JDID 1KNQA 2BCGY 3VHLB 1UBGA 1FL9A 4PQYA 1KO7A 2QAGA 1W5SA 4XD7D 2RHDA 2AK2A 2J5XA 3A58B 4QHTA 3UPUA 1S4QA 2ZAOA 2YZ2A 4ZKDA 1ZNYA 1F6BA 1E9EA 4UNNA 4NONA 3ZH9B 1E3MA 2QAGB 2E9SA 2A30A 1G8GA 4V02A 2DFTA 2W6JD 4IDOA 5KOYA 3DZ8A 5L8VA 1ZM2A 4CYMA 4FD2A 1DADA 4QRHA 2VTKA 3DZDA 2X8AA 1OXSC 1D5CA 1SULA 5J47A 3HR8A 2O0HA 2WVJA 3KFVA 5DNYB 5KO2A 3AP3A 1W5TA 4RD2A 4WAUA 3QF4A 4JLAA 2HEIA 3FPAA 1LW7A 1B0UA 2VH5R 1OT3A 1ESMA 3B6EA 2BBSA 3AKCA 2BM0A 2LWIA 3QF4B 1E2IA 1N3BA 2OXRA 1VYVA 4A2QA 3X2SA 2JLQA 4UXHA 2C8VA 1TMKA 2CLCX 1GKIA 2F1IA 2PLFA 1JR3E 4E03A 2FFBA 4NU0A 3W90A 5L3SA 3TH5A 1G20E 4LGMA 2QPTA 2GXAA 4G5SA 2CLSA 1VG9B 3TBKA 5CLQA 1NKTA 2FJUA 2P6NA 2PX3A 5L3SB 1Q3HA 2OCAA 3LX5A 3VR3A 4PC3A 2Q3HA 2MSDB 1II8A 3U7FB 3RRZA 5AJWA 4B48A 4BLPA 3ZVMA 2PBRA 4TMTA 1FMJA 2FV8A 4X8LA 3OIUA 4HDOB 4IEIA 621PA 2FFQA 2PX0A 1YR6A 4CT5A 4DLRA 4Q66C 1II8B 2AFIE 4LHYA 4WIAA 2WJVA 4JIMA 3LAWA 1DAGA 1US8B 4DLZA 4YMSA 4JLJA 1JR3A 2QL6A 3EC2A 2CCGA 4XWAA 3WYFA 3KDSE 3O8RA 1HA3A 3ND8A 3PV0A 3RDPA 3WMGA 1AK2A 2BDTA 2D2EA 2OZEA 2YKGA 5AK0A 2GJAA 5G3ZA 1J8MF 3TR0A 1R5NA 3EZ2A 1BOFA 3BXZA 4DLXA 1FTNA 4A0HA 1GKYA 2CNWD 2PCJA 3LV8A 3ND9A 3L82B 2HDNB 1N2CE 3EA0A 1I2MA 2OFOA 1XF9A 3T06B 1RVDA 4JBYA 3BRWD 4TTPA 2G83A 1ZINA 2A5DA 1R2QA 1Z0FA 3KKOA 5FPSA 5KSOA 3DOFA 4A9AA 4K81B 4PXAA 4OHVA 1JPJA 1FMLA 3OEHA 1EX7A 3KUDA 4KBGA 2WKPA 4MDEA 1KBFA 1QHNA 1JJVA 2BKEA 1AM4D 2CHVA 1Z06A 4Z8YA 2HYDA 2IXEA 3O8CA 3ZVRA 3IQWA 4RY2A 5CYPA 4BLRA 3DMNA 5E3HA 4DEXA 4A6PA 2IEYA 4FIDA 2VP4A 4M9QA 2IXGA 4NL4H 5CK4A 3SI7A 2A3RA 1W36D 4UNQA 1DAIA 1DARA 3RC3A 2IS4A 4AG6A 3T15A 3U3RA 2ZYVX 1KNXA 1E2LA 2PCLA 1VG0B 3GFPA 4A0RA 1OB2A 1AQYA 3K53A 4M21A 3BBPA 3VKWA 5KHOC 2A5FA 2AWOA 1Z0JA 2OBLA 1SHZA 4G1UC 4H1UA 4JL8A 4M1YA 4OI2A 3WNDA 4LYJA 2NO1A 4RD4A 4WOPA 3AVYA 3CBQA 1RKBA 3QG5A 1CP2A 4A15A 2BEKA 4OQMA 4GPTA 4WZBE 1EFRD 3CNOA 2WKQA 1TF5A 2P67A 3PXGA 2OM2A 4LK2A 1XMVA 3AF0A 1BO6A 4TMXA 2IA5A 1W36C 3GP8A 2WSSD 3GEEA 5FPKA 5JECA 3EX7C 521PA 3I62A 3QI2A 5TB5A 3TGPA 4PO8A 1ZW6A 4IDNA 1N6IA 3UIEA 2CCJA 3T1OA 3RLFA 4FMDB 3DKPA 3HDTA 2W6ID 1T5LA 2RGEA 1XJCA 1W0JD 4ON9A 3RRYA 5K8TA 2ZJ2A 1EWRA 3AVOA 5KPDA 2OUKA 1NG9A 2QG6A 2R8RA 5KU1A 4FXPA 2QPOA 1AS3A 1N5JA 1KIMA 1ZIPA 3RWMB 1E99A 1ZC3A 2KSQA 1DG1G 1W49A 3A6PC 3NXSA 4EPXA 2REBA 3SJAA 4ZI3A 4B73A 4JJZA 2DB3A 4AKHA 3IKJA 2V1XA 3SYKA 3LD9A 1E1QD 1OYWA 2FNAA 1E79D 1G7SA 2C9CA 2JLSA 3PEUA 5E7MA 2PMDA 5AR1A 1W46A 4N1AA 2VL7A 4LBWA 1M8PA 3ZZTA 5CIQA 1JXMA 1GL6A 4DVGA 3WMFA 3RAPR 4DB2A 1G4UR 1OIVA 1E32A 2GEUA 1QHSA 3P4XA 4Q47A 3ZS8A 5JJIA 4O0MA 4B35A 2VSOA 2IYSA 4DDTA 3AUYA 4EFNA 2AWNA 4EPVA 3ZIAA 4PFSA 2G77B 1G41A 2PL3A 4LYFA 4MKIA 4S2EA 3TVTA 1H8HD 3ICEA 1VYUA 3R8FA 3CRMA 3FFAA 1OIWA 1EXMA 2BC9A 1AA9A 4TQAA 2CLDX 5ANRB 1NVUQ 4G0NA 4L8GA 3C7KA 4B3GA 1VCIA 4M4SA 1F3OA 3IGFA 4KVAA 4DCTA 2BBOA 1F2UA 3CW2A 4KVGA 4QGFA 1CEEA 1EESA 4C3ZA 3OEEA 5CITA 4IRUB 4V0MA 3U7HB 3SJBA 4A92A 5FUWA 1F2UB 3KJGA 4MH0R 2ZS9A 1J99A 4WBSA 1Z6YA 1Z0DA 3IHLA 2F9MA 1NMZA 2BOVA 2IWRA 5IT5A 2ONKA 3OIYA 3LA6A 2RGNA 4AWXA 3F3YA 5EP4A 2A9KA 3A8TA 3HU1A 3BAFA 1IN8A 1G16A 1P9NA 2PT7A 4DDWA 2H92A 4PAMA 1KI6A 3OAAA 4TYWA 4URUR 5G40A 4PTLA 1XEWX 1RZ3A 3ZD7A 2YC2C 2EW1A 4FINA 5H68A 2B7CA 1CR1A 2AR7A 4V03A 4RKFA 1SKYE 1UF9A 4I81A 3AEZA 4B6DA 3B5JA 3NBZC 3R8CA 3C16C 4AK9A 3W8RA 4L15A 4KAXA 2ZE7A 1NRJB 3EPHA 121PA 2Z6VA 5FBRB 5JWRA 3TSWA 3D6TB 4Q1CA 4Q9IA 1E2KA 3WY9A 4EAQA 1PTRA 1Q22A 2D74A 2ZAMA 3OF5A 1IN5A 3FVQA 1F5NA 1DG3A 2R62A 1VG1A 1ZD8A 2XITA 2YWGA 3C41J 3K0FA 3EIQA 1KI8A 2JLVA 4PPFA 1AKEA 2QRZA 2IS2A 5GJCA 2EWVA 1S3SA 2Q0HA 2GHIA 4C7OA 5B30A 2BEJA 2WPDD 3K0FB 3IEUA 2V6JA 5EE3A 2VQSA 1N5LA 1NLYA 2ZETA 3D3QA 3FWYA 3A37A 3CH5A 2PH1A 4NKRA 4C7OB 1W4BA 1ZM9A 4HATA 4HB2A 4XOIA 1Z5ZA 1SVOA 1CU1A 3E70C 2WKRA 3SFZA 2EFEB 2JDIA 1SKYB 1Z63A 4IFEA 3L8ZA 5DE3A 3K0SA 1Z0IA 4A36A 4NCKA 4FCVA 5G41A 4G5QA 4LHWA 5KYKA 1ZNXA 2XSZD 2VF7A 4AC9A 4C9BA 1Y8FA 1KTVA 1ANKA 1NP6A 3PUXA 3QPWA 3QNUA 2IUTA 4JS0A 3T61A 3THWA 1CRQA 2WJYA 3OESA 1KI3A 3L2OB 1TUIA 4HYYA 5AJXA 2W6JA 1NMYA 1G8PA 3U3MA 1DS6A 3NHBA 1XTQA 4NZYA 4KSCA 2WICA 5B64A 3THWB 3Q5DA 5FUVA 3QXSA 4RZUA 1SVIA 1XEXA 4HB4A 3GJ4A 4ABYA 4XTRA 4JZKA 5E7JA 2AHOA 3AP1A 2Z5FA 2QMUA 1XEXB 1G8FA 4OHXA 2ZI5A 4HI0E 2CJWA 3AUXA 3VAAA 5D3MA 4LPKA 1DPFA 3AF3A 2BBWA 1A1VA 4UJ3A 4AKGA 1P7CA 5SZHB 3TJZA 4JLNA 4WW0A 4Z1MA 3UMSA 4P4UA 4PHHA 4URYR 4R71A 2CJWB 5FUXA 4JBXA 5D3MB 1N6LA 1CBUA 2NPIA 3BS4A 1NG1A 2KWIA 2QTVB 2YVUA 3IQXA 1U81A 1E9FA 3L0PA 3LX8A 1YZUA 1V43A 2NOAA 1MKYA 1N0VC 2N42A 2B8TA 2VP6A 2REXB 1GZSA 1X8LA 4TLEA 2Q9CA 1N6OA 4A2WA 3ADBA 1T5IA 3U60B 3NBFA 1ZVQA 2ODEA 2BMFA 1I4LD 3I32A 2OCYC 3KL4A 2GTPA 3N5CA 1XMIA 4TYYA 5FOVA 3GJ7A 2QU8A 4OK3A 2OSBA 1R8QA 1CR4A 1UEIA 2F9LA 4MRVA 1NVVQ 4QBGB 1KK0A 2GCNA 2OILA 4BZPA 4BFUA 1CF4A 1XMSA 1WA5A 3GJ8A 1RFLA 4A82A 3FOZA 4PC7A 3OE7D 1SZPA 1R6BX 1XTKA 2XJ9A 3R20A 4KODA 4ZDKA 1XD9A 1WP9A 4ACBA 3LDAA 4BLOA 1BKDR 1GRRA 4HAYA 3REGA 2J59A 1D9XA 3PQCA 2RMKA 2ZJAA 1KYIA 1QRAA 3THYB 1E2NA 5EE9A 1LTQA 1Z29A 5KNCA 1N0WA 1FTSA 1MO5A 4NP6A 3A1UA 1R79A 2NZ8A 2G1KA 1YRBA 1GNQA 4RZ2A 2GEDA 2YHSA 4ESHA 3CF2A 1ZMXA 1ZBDA 1G5RA 3IIJA 3CPHA 4US1R 3IBGA 4QGAA 1JR6A 5M04A 4TZ0A 5GADl 2QY9A 4M2LA 3WRXC 2VHTA 5IRCD 1SXJD 3ZYCA 1PLKA 2C77A 4GFDA 3KQHA 4B3DA 3HYRA 1Q44A 2FF7A 2VRWA 2QRNA 2A2ZA 1W1WA 5LB4A 3VHXA 2FPLA 3B1VA 2FFAA 3MWYW 3K0AA 1PV4A 2VRWB 3EZFA 1CJVC 4MRNA 4ZDJA 3PR1A 4PHGA 1D9ZA 3TW4A 2JEOA 1NVXQ 2RGBA 4GMXA 3UEJA 1M74A 1OH8A 5FPHA 1NVWQ 4GI7A 1GM5A 2GKSA 4RFSA 1G5PA 3MCAA 2EYQA 4XSGA 3SJZA 4B71A 4CT4B 1EFRA 2C95A 3R9IA 3FKQA 1SXJC 3W5IA 1EFCA 1Y3AA 3FGNA 1TEXA 5FI0B 5IF9A 2JLYA 1PUJA 1YZGA 4RFSB 1T3HA 3CZQA 3RRNA 4J0QA 2QPAA 2Q9BA 3G82C 2AL7A 1Q1EA 2ZE6A 1ELOA 4FCTA 3SNHA 2WSSA 1NI3A 1A7JA 3Q9LA 2BJWA 3ASZA 1Z2CA 2GF9A 2ZYWX 4XVRA 2Q3FA 4NTZA 1A2BA 1TQ2A 1Y63A 2P65A 4BRWA
chains in the Genus database with same CATH superfamily
5DYWA 2WWFA 3LVRE 1J56A 3ZWYA 2GZ3A 2MSLA 5LXTB 3GGPA 3L7AA 3N5KA 1XZQA 3VPAA 4UTNA 1T2VA 1AS2A 1XSEA 2SICE 4OIFA 2AKYA 2IZ6A 2IU3A 3GP5A 3AVTA 5D5PA 2YL2A 5FWXA 3NHUA 5SZIA 3UWPA 2IW1A 1SGRI 3A0UA 3E5HA 4UDOA 3L7CA 5BYJA 4F4CA 5H02A 3MGCA 3LCMA 4JROA 1A9TA 3B89A 3H1BA 5K0NA 1E9RA 3OZDA 1P0PA 1NRWA 1QGYA 1XALA 2WHQA 1ADYA 4BVJA 1XZDA 1MJBA 4HYTA 2NO7A 3RK1A 2G1JA 3WLQA 4E1BA 2O19A 1RYMA 3F9RA 4FYKA 4NSNA 2WWIA 2LUOA 1J0CA 3IMGA 3M6LA 3RVLA 3LWZA 1K4KA 4D9KA 2JLZA 2V3CC 1VB5A 2QSJA 2POCA 3K5HA 2RB5A 3LBAA 5DTQA 4V0OA 1PD1A 3U19A 2YJNA 4RL4A 5DM1A 5CA0F 3NZEA 3ZHTA 1J1ZA 2GN4A 1M34A 3EZ6A 1VGVA 4QTUB 5ES4B 1E2MA 2H29A 4FYPA 2HGSA 2RGWA 4NBRA 4HAWA 4B3IA 4TVBA 4P4SB 5JLAA 1UMBB 1E3QA 2QL5A 1LUAA 1U99A 3NXKA 2BFBA 4M9XA 3G8AA 1WLYA 1PZEA 2W93A 3BKWA 3CRRA 1U8CB 3DV0B 5AVOA 3CEJA 1T15A 3CS3A 2H2IA 1JPUA 2C5SA 2XWSA 4CPDA 4MPJA 4ZMBA 5GM1A 3U81A 2WMNB 1ZU5A 2NO9A 4URWR 3CWZA 4DQXA 1LX7A 1Z62A 3BMQB 3E6AA 1ZIYA 2XJ4A 1I5OA 2ZT7A 3FGPA 1W0KD 2JXDA 3FWNA 1TUBB 3GLHA 4ALJA 4ZI7B 1SGQI 2J6CA 2ZR7A 2YW9A 5EGSA 3RHZA 1KAEA 1GTRA 1N0UA 4UFOA 3WGNA 1SA0B 2YJTD 4I46A 4N7JA 2HA2A 1HQYE 4CNQA 4WD3A 1R6AA 1C1HA 1JQ5A 1PEAA 2Z95A 2ZAGA 3GR6A 3LUDA 3O4HA 3RVOA 2JF0A 4AZSA 1MJ5A 1SBIA 3KM0A 4OKSA 1HPTA 2Z2JA 2A58A 4JJFA 4BE9A 5CEFA 2P77A 1Z2NX 5KTRA 2FY8A 4DWWA 1V3VA 3D7KA 1Y4AE 4B3MB 1GN9A 2V98A 2QE7A 4IWYA 5KSPA 4H9GA 3BMCA 4G8BA 4Q48A 1W44A 3CRNA 3ZGYA 3BEOA 4ADSG 1M7BA 4UULA 4KFTA 1KI1A 3QX9A 1EP9A 3TTUA 3WB1A 3MMZA 4FP9A 3HCRA 1VCNA 3BXEA 1H3FA 5EP3A 1BD3A 1GAXA 1PKEA 3OMLA 4CWAA 4E5YA 3OVOA 2WU3A 2YMPA 3PFKA 4XH9B 3MG9A 4S1NA 2ECFA 2NX2A 4U7GA 4ZHSA 2PKYX 3ZVKA 1SD5A 1QDLB 4QEZA 4P7FA 5IKOA 2GCOB 3CB2A 3AESA 3LSYA 1U8YA 4G4IA 3Q8WA 3IQIX 3PYMA 1PHRA 3AI2A 3AKDA 1RWWA 3GJ0A 5B1IA 4YRRA 2GAAA 1FMCA 1OH7A 4LRWA 4K87A 5FBWB 4E5MA 1OLXA 3NPMA 3ZBPA 4AP5A 1SWVA 2G9RA 3TM5A 1JLLB 2BCJQ 2DKFA 2JIBA 2QHXA 3ESYA 3RABA 2BFDA 2C2GA 2ZJBA 3TSAA 1P72A 4RCVA 3ANSA 4LDPA 2QN7A 3ORRA 4EX6A 1PFYA 2AFHB 3WGGA 1Y8RA 2HU7A 1CDOA 3F67A 2BKLA 1M1NB 1NVFA 1SOVA 2HQRA 2Q4DA 3PTAA 4WNYA 2QIPA 1K1EA 1DSSG 1AKYA 5F5LA 2J4FA 5HUJA 1WY5A 1WX1A 1C30A 1L2TA 2FWRA 2PIDA 3UK1A 2FN7A 3CLKA 3EBOA 4EMTA 1V1MA 3RC1A 3EODA 2ISSD 4MAMA 1RRKA 5CEEA 3T7TA 5AP9A 1WKXA 1BRMA 1QNLA 3A36A 3OBBA 3RT1A 3IP5A 4HNQA 2C82A 4L22A 3ZHZA 4P84A 2MMCA 2IEBA 4RVHA 3I23A 2DBZA 3HDVA 4BGIA 4KQGA 2YOHA 5LQCA 5I7UA 5JFOA 1SGWA 3ZDFA 4UVDA 1TFUA 4XVCA 1S2DA 3TOZA 4PF1A 1I6KA 3D0OA 4YI5A 1I80A 1ZNZA 4KHZA 4NHOA 3L8EA 4NPCA 9MHTA 5C52B 3U4MA 5IH3A 4MWDA 1XIVA 3U49A 1ECBA 2RC6A 2YUTA 2XNHA 1NY5A 3KXLA 3Q11A 4U7WA 2J1LA 5LDHA 2P75A 3D3NA 2ANCA 4EARA 5FTJA 1QYXA 5BWMA 1NKSA 2PUJA 1M2OA 3OJLA 1SU6A 3ZDBA 2PAAA 3FMGA 2ISQA 2QD1A 1TM5E 2ZOSA 3KKKA 3TE6A 3ZK8A 3ZZUA 5JEDA 3L0CA 1K8XB 4QU9A 1Z5NA 2AR9A 5E9WA 4BKOA 5DMXA 5HK9A 1RQ7A 1X7YA 3PICA 4EQ6A 2O2CA 5CDGA 2C92A 1GPUA 2QX4A 3P9PA 4S1WA 2IDMA 3FM9A 4PQGA 2WF5A 3IQHX 1U8XX 2XSZA 4ESOA 5B12A 2IX3A 4CJXA 3V55A 1NJ2A 1YJBA 4P2BA 3TLEA 821PA 2E6KA 2Y1KA 4CKBB 4D3YA 1CD5A 1KC3A 1AURA 1DBWA 4IOMA 3GEBA 5LUAA 3SWWA 3GVXA 4BMXA 2FOLA 1Z5UA 2LUYA 2ZT8A 3W9BA 1KZHA 3JV7A 1YVEI 5L9AA 1YZFA 1QBGA 1Z5WA 3BDIA 4OI4A 3SBXA 1AZTA 3UGDA 2X0JA 3U40A 2NU3I 1ISIA 2C9MA 5IKXA 1KIAA 4GI1A 3DP9A 2NACA 4PRLA 2H16A 4RTLA 5HQTA 1MQ9A 4MJ7A 2YXPX 2J5KA 1XMJA 1CUGA 2B4KA 3W8DA 3A27A 4BO2A 1JLKA 3UC5A 2R5NA 3KQVA 5JOQA 3H5VA 4IGEA 1Z08A 1VC2A 3OFND 4WDQA 4A5OA 5ALNA 2X8JA 1YJAA 1GRQA 1R50A 2JIDA 2MYNA 4I08A 1NDUA 4JB2A 4LG1A 1X1SA 3PEVA 2F1RA 4UDNA 5JZOA 4G0XA 3PEWA 2CFRA 1RJ9B 2DFKB 3OKAA 1HMYA 3O82A 4FE3A 4AQYB 1DT3A 2ZTVA 4B6OA 5FLYA 4BO0A 1VKNA 3WVNA 1NBME 3SYLA 1ISSA 1GGKA 5ALZA 1K97A 3EUWA 5FAXA 2C4KA 4R1SA 5KKCA 1Z4LA 2DHQA 3DB2A 2ZIVB 1N8KA 1VPEA 1J0EA 3IDFA 2P2NA 4JCVE 3E1GA 1IG0A 2R48A 4O1HA 4R2XA 1DCKA 3M7IA 1YRAA 3N3BC 3PWKA 1V7ZA 1BWPA 3CSDA 4CTOA 5C5DA 4LC1A 3HU3A 4KQFA 2ZI4A 3A6JA 3M6IA 4CMKA 4CR6A 1OC2A 4DUYB 1FTQA 3I30X 4Z7OB 1S96A 2CL0X 1IXZA 1ZISA 2OO7A 3FR7A 5LNK6 4ZO7A 2GN2A 4Q3NA 4TZKA 5TARA 2J9YB 1XQVA 3AGQA 1YZTA 2RDMA 1E6EA 3F3MA 2V7TA 3GDHA 4MSUA 5LBUA 4IHJF 1EAMA 2CE7A 2AG0A 2H31A 2PKEA 3GFFA 3HWWA 1ADBA 1XA0A 1NN0A 1QHGA 1WMFA 3G0IA 2J9FB 1A9YA 4ZVTA 1L5LA 4C21A 5HKBA 2EJBA 3WYGA 1LDMA 4G0ZA 3THOA 4F5ZA 4S05A 1NHGA 2WDZA 1G7RA 3GRZA 3PIIA 4IQFA 4M98A 4TWRA 2H4YA 3MEQA 4X97A 4YP7A 5EE1A 2BPOA 2RGXA 3PHGA 5FKJA 1VBNA 2Y1OA 1TYBE 2YS7A 1VI6A 3GMDA 3LVBA 2QJOA 4MV3A 4PEVA 1YOVB 3VZCA 2IYPA 2Y0CA 4BZZA 4RKRA 1IE3A 3GHYA 3C3PA 3LX6A 2JD0A 2W2MA 1YVPA 3HI4A 4BQNA 2VIIA 2P78A 4DVJA 3VNSA 4BKPA 3SR0A 3AJDA 1L9XA 2QUJA 3P9QA 1O8BA 2XNCA 2LCFA 4ZEMA 2R2AA 3IMEA 5E1MA 3RRJA 4HX2A 1LK7A 3SC4A 1N34B 3I42A 3HJBA 1CUEA 1DO8A 1QWSA 2IF2A 4Q4HA 2G25A 2PLWA 4IEFB 4ZO9A 3SQDA 2B2NA 3TAHA 5KTOA 2IDJA 5JU6A 1RI5A 3H1TA 4GBJA 2FN3A 2G8LA 2IOQA 4GZ3A 4HNVA 2XT9A 1UM8A 3IHTA 4L0MA 1JGTA 1D04A 5AYVA 5INTA 3AEKB 3RF6A 1GNLA 1H8ED 4CW7A 3M70A 1URPA 4IGKA 4R2MA 4DC9A 5LQMA 4NZOA 1OHHD 3FUVA 2Q9AA 1Y4ZA 1RAAA 3AIMA 3FFTA 2AQHA 3LBFA 1I9CA 2WUGA 2FTKE 3QHPA 5KNBH 4J1QA 1DI0A 5KKAA 2GF2A 1ZGHA 2AFVA 5LL6P 3S2FA 2B36A 3UH1A 2CWFA 7REQB 1PBTA 3UFXA 1KO5A 1QGDA 2OLEA 4S2UA 1MH1A 4KFCA 4DGSA 3DP7A 3W8EA 1KRXA 3GT0A 4YRSA 4N41A 1M2NA 2J0VA 3L1UA 3LIIA 3VQTA 1ZXXA 4ECAA 1KJNA 3GARA 1KQFA 1KAHA 3SOPA 1CFJA 4KRFA 4GQIA 4CF4A 1K4MA 1V6SA 2VDMB 1CKEA 3OSUA 3N2KA 4KE7A 2VHEA 2X7XA 3UB2A 5ALLA 2VJYA 4OHKA 4F92B 1JR4A 4LYDA 1TMGE 1CY1A 2JVKA 4L4SA 1BIFA 1GDDA 5TMEA 3I9V1 3MFQA 1MB3A 4AJ2A 4XDYA 3JWIA 3UKOA 1CE8B 2JIZD 5LQSA 2O8VA 1JFVA 2ZU0C 4I3FA 3RU2A 4B44A 3CISA 1AIPA 4DB4A 1UT5A 1J9EA 4TXHA 1IQ0A 4IHQA 4U9UA 3H11A 4QJ4A 5COAA 1FC0A 4Z9BA 2J4DA 4WDRA 1YHNA 2I2AA 3M3DA 2DR0A 4IOJA 2VLIA 1JP7A 3C8ZA 4D9EA 1AKWA 1YQWA 4J07A 2VN8A 4E5PA 3DEHA 1WDLA 1SMKA 3ZK7A 1VSTA 4RPJA 5E3PA 4W5QA 1UDRA 1XV5A 4YASA 1ONBA 4ZC1A 4ALMA 1GILA 2QZPA 1P5FA 2VCHA 3VDXA 5IC5A 2PUVA 1QGUA 2C0PA 3D6NB 4C0AC 4XJSA 4CF7A 3RVKA 1E3TA 3PPYA 4ZZ1A 1SUSA 2OHFA 3KUCA 2AI3A 3NH6A 3OQIA 4HRVA 3REQA 3DZFA 1E98A 2CJFA 3GMIA 3UW3A 3EGCA 1VSUA 2GQ0A 3GU3A 1LV8A 2HFKA 4HN9A 4H31A 5E3JA 4X7RA 1XAIA 3FI0A 4DCGA 2VP9A 2Y1DA 4FFLA 1KRHA 3IR6A 1QYIA 3HVUA 3IP1A 4KQ2A 4RKEA 2F1HA 2Q1YA 3VJKA 2JLWA 2CNDA 2ODBA 3OPYB 4JJGA 1P2FA 4JCCA 2XQVA 3Q15C 4UBIA 5HEKA 3WQBA 3EIXA 2HJGA 3WTCA 5LP1A 1KOFA 4JEMA 4Y7DA 1QHIA 2X1LA 5TXGA 1TM2A 4IL5A 3ER6A 4QPDA 2G9ZA 4HVCA 4TTRA 1HNNA 3PHCA 1FPMA 3P19A 3A6DA 4Q37A 4X8LA 5U4QA 1QVVA 3K6RA 3H16A 3L6CA 4I4TB 3ZGVA 3QIAA 2WNIA 1LQTA 1UC5B 3LXMA 3P2JA 4EI7A 1MTOA 1GPWB 1E8NA 2A1TS 5C4MA 1HDEA 3GHHA 5K3EA 5GINE 2OMKA 4G8JA 4PW0A 5LD2C 1ZR4A 3EZLA 5AHOA 2IZ1A 5AKEA 1P29A 2FPXA 3H2KA 1T1JA 3HVHA 3NEYA 1WUYA 4H7HA 1X7ZA 1WW3A 2YWCA 1T4GA 4JI6B 3GEMA 1YRHA 1FCJA 3OLYA 4J2HA 1ZCBA 4TTQA 2YTZA 4MPTA 3LFUA 3EARA 3LPNA 1CQWA 3T5PA 3QUTA 2EKQA 4WEOA 1DO0A 4OYRA 1Y8ZA 5EFOA 3RT7A 3D02A 1R0WA 4ES6A 1ENYA 1ADGA 2YR0A 1LPAB 1FLDA 3BDAA 4JJ8A 5A7GA 5BSEA 3K9FC 2V6MA 2X86A 3H5WA 4O2LA 1VXOA 1JEEA 2B1RA 1ZI8A 3EEQA 4NCBA 3OT4A 1KI6B 4Q7KA 2GA8A 3O21A 4CV1A 3PI6A 1NN1A 3JR7A 4KNVA 4ZT4A 2ERWA 4L76A 3HH2C 1P62B 4OH1A 5CA0A 2O0MA 1KI2A 2E18A 4BLSA 5B3JC 3O7MA 3OPYI 4I55B 4OLBA 4D1YA 1VL6A 3ESXA 3TFWA 3L5KA 2XTNA 1WAMA 2N9UA 1W6UA 4PONA 2FCRA 5HDQA 5BT9A 3ONEA 1DJMA 2RI0A 4CCYA 2PKRA 5ARCA 5GIPE 2BVNA 5TJHA 3IEMA 5KQSA 1RXWA 1BDMA 3QWFA 3LCUA 4KSBA 2VOEA 4BNDB 2PWPA 2V8BA 2ZBRA 2LP4Y 1VHJA 5B36A 4PX9A 3QWBA 2AZXA 3UBMA 5DSTA 3ZGZA 4GX0A 1VI2A 3QLEA 1L1FA 3INYA 3O47A 3OPXA 4GNRA 5GJWC 3ZCPA 4TX1A 4MUAA 5BNTA 1KEPA 1U5CA 5CTJA 1PTQA 1ODJA 4YJKA 2ZM5A 4X64B 5JYDA 3AC0A 1C5KA 3FRJA 1QPZA 2DB6A 3ADPA 2R8OA 3LHIA 3IIEA 2RKOA 1R8JA 4FQ5A 1PQWA 3FDFA 3PFFA 5AKJA 4N47A 1TADA 3LOPA 3NBKA 3VTKA 1UBUS 3WLSA 3K4PA 4E4YA 2HLDD 3LP8A 4X5OA 5BOSA 5CVTA 1OWMA 4KQHA 3CSSA 1CZOA 2BY4A 4PSKA 3GW8A 2XRFA 5AVTA 2XT6A 2XB4A 2ZIGA 1YS4A 4MS4B 4DS3A 1DIBA 1FRNA 4OGLA 1EFHA 2B8NA 1DFGA 1EDDA 3CT4A 4W8GA 4BBJA 1GAWA 4Y2RA 5CCEA 4W1QA 1MXFA 4LRSB 2J48A 4HNAB 4OXXA 4RDIA 5GVRA 2QYHA 3ZHYA 1C2YA 2BM1A 2R85A 2UUAB 3K8QA 1HLFA 3ROEA 4GKJB 4TT8A 5IVIA 1U7XA 3ZW8A 1B0AA 4J4TA 2I9KA 1O0BA 4BNHA 3NETA 2XA1A 3EUFA 1ESNA 3O93A 2YV3A 2WHRA 3VNUA 3RYHA 3T95A 4GMGA 1T13A 1D2HA 2YFKA 4MVJM 4UM8B 2JATA 4Y6QA 1Z5GA 4M8KA 3UXMA 2QAGC 3A4LA 3C45A 5FL7D 1WUKS 2XADA 3RROA 1RLOA 4YAUA 2IZ5A 2C88A 3IC5A 1WF3A 5GMOA 3MQFA 3LU1A 5CLGA 2GVZC 3MMXA 1XB2A 4O5AA 4OUDA 4X20B 4HZIA 2J32A 4PS1A 3D7SA 3OZWA 3V4ZA 4Y1GA 2D8AA 2WHPA 3R6GA 4D0SA 1CT0I 4HAXA 2KMLA 3WL7A 1WF6A 1U0TA 1ZD3A 2LKDA 3S5UA 2RC5A 4A6DA 3BCSA 3RU9A 2KJQA 4BNVA 5C3UA 3MS7A 1W6RA 3QI7A 5EN4A 2AD5A 5HGJA 1TYDE 5TY0A 3ISTA 1YC5A 1FUUA 1G17A 1VE7A 3P4YA 3N7UA 1XD8A 1YBHA 3DVAA 4QXOA 4NCAA 1WETA 4KOAA 1UWKA 2X1VA 2QX6A 5JASA 5LKAA 1ZK0A 1Q2UA 2A7QA 2BGUA 3AUAA 2Z04A 3DV9A 1TQ6A 4IKOA 4Q9HA 4M36A 4OXIA 3GWGA 1P9GA 5K5EA 1SHUX 4W1SA 1M0EA 1AD2A 2YY6A 3ZJ5A 1Y33E 3AF1A 4J3JA 1UBMS 3O7WA 4BX8A 5TQ0A 3I4LA 2PJRA 3E9MA 2QW1A 4D82A 4FFRA 4MICA 4F5YA 3D6MA 4ZIRB 3GH3A 4ALLA 5IULC 4P34A 1Z4QA 3DLPX 3Q7IA 5HUQA 4OHZA 1KJZA 3FNIA 1EPUA 1MO2A 3QMPA 2OC4A 4I9NA 4L6AA 2EAUA 4U2EA 3MQ4A 3U3JA 3VU3A 4EHFA 1JDTA 2H1OA 4Y9SA 1PYGA 2WUWE 4YT4A 4EELA 2XMZA 4GOKA 2XB9A 3EQ6A 1THMA 3USZA 2W2KB 1HEUA 3TTSA 3M89A 3LUHA 4X1YB 4KAAA 5HOQA 1MZVA 1TLLA 1EWQA 1ZGGA 4LE2A 2ZQYA 1A7AA 3DZIA 1NJFA 4AIRA 2W6CX 4A0FA 1C0IA 6NULA 2WAYA 5IBRA 2ECPA 3MB5A 3HB4X 4L73A 3BRWA 5KCMA 4EI9A 3HJRA 3EEFA 1FQKA 4RXTA 3MAAC 5ECGC 2ZR9A 3F6PA 2ODWA 3O8BA 3S81A 1ZN7A 1KYZA 3SEFA 2AEEA 2J7PD 4H60A 4TRNA 2R8XA 2CHGA 5I47A 1JALA 2VJPA 5F2KA 2JHGA 4MQBA 4R16A 1AUOA 2C4UA 3RV3A 2FPWA 1LY1A 3MLBA 2JGFA 2E4YA 3L8CA 2EWWA 1WB4A 3IAS1 4HB0A 2MDTA 2X76A 3G2IA 4YJ3F 4RQBA 2BFFB 3JY6A 3SEZA 1SG9A 2GZMA 3H1GA 3KAKA 4I5EA 1WXFA 4ZANA 3VR4D 4W1PA 3PIRA 2AQ8A 3GUYA 5DWVA 5JWOA 4M1KA 2KX7A 4BO5A 3D7MA 4B3HA 3M9WA 4JJ4A 1OMTA 2XQFA 3RF7A 3ZNQA 3D6FA 3K6KA 3PQEA 4QSHA 3SIRA 4ZHQF 2X19A 1W36B 1OY1A 3AU9A 4LJSA 2XB8A 3ANYB 3T5CA 3DPSA 3RK0A 2ZSKA 4TTIA 3RAEC 1XA6A 4Q1BA 4RESA 3C5WP 1ZP6A 1DLIA 3A6HA 3L06A 3PQ5A 2D3TA 5DN6D 3YASA 2UVPA 3TBHA 3T6KA 4H4DA 1QUFA 4RANA 5DNDA 2CD7A 2D2IA 2C3OA 3CHYA 1Q1BA 3HUDA 2OOSA 1KZ9A 3FNHA 6LDHA 2JBAB 1N6KA 2Z83A 4G1FA 4A03A 4UREA 1LBQA 1BH2A 1ESDA 1ZWLA 1JVBA 5A0FA 1C9EA 1EBUA 1BXKA 2AHRA 4ZVLA 1QRDA 2AC7A 4FX2A 3PK0A 3QPUA 5JWHA 3H2YA 1XXLA 2WD9A 3AUTA 3Q9UA 1CF9A 3DDOA 4DDKA 4HTFA 4Q9AA 1ID1A 4WBNF 2GBCA 4ZV7A 3CC8A 3NTRA 3ZGNA 2A4MA 5I8WA 1OTYA 3GEIA 4WKBA 4B7UA 1JKIA 4WOKA 2G0TA 2IYEA 2PD4A 3DJYA 2Q3DA 4R68A 1W4ZA 4ZT6A 3GPDG 4AJKA 1UAAA 2DTXA 3H0KA 5DGIA 1NOJA 4RZ3A 1KERA 4RSGA 4QIHA 3JWGA 1T8TA 3EASA 1RCUA 3L6UA 1G55A 2W58A 4KXFB 5CDHA 1UPFA 1CJKC 3CNQS 4I1VA 1OYVI 5E8RA 1XKQA 4KXXA 4AY4A 5FWXB 2O6HA 4XWYA 1WPRA 4NJEA 1JG3A 3D3JA 4CQNA 2I67A 5JVDF 3BFVA 1JEAA 2GM5A 4XWOA 2B4TO 3I9MA 4HYQA 3NYIA 4RVGA 3PUYA 3IX7A 3QU2A 3N39C 2H4FA 3FCEA 1E79A 1M2FA 3F74A 2C04A 1L6IA 2CXQA 4Q4DA 1H85A 2RONA 1QPBA 2WK1A 4DQUA 3AZQA 1P1JA 2GK6A 3F7MA 2GJKA 2WVAA 3Q7QA 1I1OA 4QOEA 3M2PA 5EXSA 5BW6B 4HGOA 4ED9A 3G0DA 5J4LA 3AYZB 1H5QA 4ZA2A 4C07A 5CP8A 3AYXB 3W1WA 4BMSA 1M34B 2PS1A 5ETJA 1MH9A 4PHCA 2ID8A 1JBEA 1KJJA 5DIFA 5HFJA 3FUTA 2JH9A 1UBCA 3NBXX 3AHFA 1HOTA 2QLJA 4O25A 4UEJA 3AKZA 3N58A 1H8HA 3ZVLA 2OGSA 1JJFA 1LNZA 3QXCA 4G0MA 3OM0A 1RLUA 4RD0A 4TMFA 5SYAA 2FPRA 4A6XA 5AVVA 5KOJB 1JEDA 4B7CA 3DAPA 3JRXA 4RJLA 5AM4A 3WLJA 3PNQA 2BZ0A 2GEBA 2PKCA 3ABQB 5L3RA 2A9OA 2Y66A 1TTPB 3CFYA 4KIUA 2DHEA 4MPIA 1J1IA 1WCWA 4YUWA 4D0LB 2H9YA 1UZMA 4PVDA 4G0WA 1JXOA 4C6RA 1ZJ4A 1M1ZA 3U3ZA 2HPVA 3ASVA 2XHZA 3EYWA 4FCWA 4LV5B 4RACA 3ZI0A 5JSYA 2XV1A 1G21B 2FVYA 3BAZA 3G59A 3PYLA 4YDSA 3RRFA 5HDBB 3UMRA 5LFAA 2ONCA 5F7JA 3IBFA 1Q6YA 3ESQA 1VTKA 4JBIA 5I9NA 3QSYA 2JAXA 2P2GA 4N82A 4NYMQ 4ZT5A 3IBYA 3A4YA 2CNNA 1J2YA 3AP2A 4I8DA 4D4MA 4HRYA 2BMWA 4DDMA 3QU4A 1JEQB 3W5UA 1V7CA 3CTMA 5BOVA 2ZGVA 2I29A 3RHSA 1OWLA 3LJKA 4NH0A 3BWVA 4YT2A 3DLHA 3ZYZA 4P3OA 3ZQJA 2EFCB 2QLMA 5E6RA 4GOMD 3H7AA 2GH1A 3J81A 3R5CA 4JEHA 4NBKA 4R6WA 4R5MA 1VKZA 4DR6B 1TZJA 4Q9KA 2EYUA 2MSEB 5JT1A 4UNRA 5ALFA 4Y6RA 3O75A 3FVTA 3PG5A 2V6IA 1XDDA 2BMDA 4JLSA 5EJ7A 4NZMA 3T9FA 4PCUA 2KMRA 5C31A 4LJ7A 4AU1A 4UPDA 3SHWA 2DFPA 4DCVA 4R7TA 3CLRC 4OFZA 4Q3KA 3DUWA 1VJCA 1XP8A 4JR1A 5SZKB 5E3QA 1ZI9A 4A8JA 4D8WA 1UOOA 1M5RA 3P71T 4OL9A 3C6MA 4OJNA 2V5AA 4RHTA 2G17A 2R1VB 4MTLA 2BP7A 2GAJA 1LGYA 1V3UA 2H5JA 3L6DA 4Z7JA 1D2NA 1GCAA 3BA6A 1XTPA 4AZ0B 3GA7A 3V48A 2V59A 4B8YA 1HDIA 4W5NA 4K9OA 1G0NA 3K4QA 4JUCA 1UAGA 5C35A 3IPLA 2ZJ3A 4XPIB 1V8PA 1XZFA 4JWKA 2IV2X 2R6FA 1IM8A 1IWBB 2E4AA 2IIPA 3GAMA 4M88A 1FYWA 2OHOA 5BPFA 2H08A 3VKVA 1JA0A 4PM4A 2JW6A 2QJTA 2HJ9A 3P9XA 1IB0A 1MB9A 2NZYA 3GG2A 4WZAA 3T5MA 3VFDA 3RS7A 3D5TA 3OF3A 4E51A 4F4JA 5KTTA 2EERA 2NUPA 1Z4KA 4YQFA 3JRWA 4EYEA 3EW7A 2IIVA 1QWOA 2SHKA 1YBVA 2WW8A 2ZYUX 3Q8KA 2W22A 4AY2A 5JNSA 4LI0A 4IR7A 5EUQB 1SXPA 5EIXA 4BU1A 4RTNA 3NT2A 1AO3A 4FYYA 1M2OB 2B8JA 1SZDA 2HZ7A 4X3OA 3IRUA 3UKJA 3GLIE 3VVBA 3BF8A 3DCNA 2F8SA 5FYDA 3UATA 3BCHA 3R74A 1H2XA 1PNQA 1QE0A 3T41A 3WLRA 1KIFA 3FSEA 1YO6A 3E22A 4DLSA 3MJEA 3K1YA 4ZZIA 1WGTA 3B1FA 4EQ6B 3QENA 4IH4A 1IBLB 5JMOA 3DL7A 2COUA 1A2KC 4P9NA 3WDSA 3QPBA 1T6BY 3PIDA 3NC0C 3HXPA 4L8YA 4RV9A 3KZMA 2GJSA 5BW5A 4MQFB 1T5SA 1KYXA 3N28A 4ZODA 3FLEA 4JEIA 1G9SA 1XQ1A 5CFQA 2B99A 2AG5A 4G8CA 3T1YB 4D2IA 2DX7A 1P9OA 1ZOSA 2WTXA 4XUCA 5CT4A 3OWHA 4G8DA 1P7ZA 3R9WA 3QM1A 1G8YA 2G0NA 4RGVA 5P21A 5KWSA 1X38A 4H35A 1PL8A 4RBNA 3UXYA 2ZSDA 5C1OA 4OKIA 3I3SR 3EVTA 2ZQ5A 4R2LA 3CUSA 3DMYA 3P9IA 2C9YA 1BC5A 2MIIA 1GL9B 4XWGA 3LLCA 2VHYA 3N2IA 3C1TA 1QK4A 3TTXA 4UAUA 3VKGA 4YBRA 1P6QA 1XCGB 2C8LA 5DTRA 4LDZA 1VMAA 4IQ0A 5EL0A 4Q4JB 3KQSA 4EPYA 2BELA 4J1TA 1I32A 1MQSA 5G0WA 2ZI7A 5BXQC 3WMEA 1RYEA 1NN5A 1J2UA 2J3EA 3OX1A 3QFFA 3WLFA 1PJAA 2V4UA 3AVWA 1GLVA 1O77A 1U3DA 1BCRB 2C7GA 1GFZA 2WG1A 3NIGB 4MR7A 1W3SA 1IEXA 4UAGA 4M8LA 1X80A 3UUFA 1VE6A 3D54D 1QP7A 5DEIA 2EFHB 3VU9A 1OV4A 1X3SA 2Y0MA 1TK2A 4FFPA 1V1RB 2EIHA 5BO5A 4EVQA 1VRCA 1MAUA 1FY7A 4HDMB 2VJNA 3IAHA 1DC6A 1ICEA 3JQ8A 3V7UA 3L4BA 3RVMA 2VSXA 2P0YA 3CR7A 4MO9A 4H1WA 5AI8A 5J4KA 1GG9A 1NTOA 4G1CA 3C5VA 5JAOA 1NTRA 2GK7A 4N7RA 5G4LA 1IWOA 1NUPA 2RIPA 3A6LA 3WBJA 2R3SA 3D3KA 4BN0A 1NU8A 3MUEA 1S2OA 1Z8NA 5IKMA 2C58A 2D62A 2VG8A 3LQ2A 3RSOA 4JKIA 1QLHA 3KPWA 2XDQA 1IIRA 4REQA 5EJMA 3T4PA 1GAQA 4H7DA 5BN4B 3FSRA 3G9UA 3V33A 3SQXA 1Q9BA 3CF0A 4Q3DA 5BR8B 1OJ7A 4OA5A 2H7XA 3STYA 1SGDI 4CV0A 5A3RA 3PT5A 2H1SA 2XLCA 3EJ6A 4K6HA 1GL7A 4TVOA 1EQAA 3RUPA 3OCYA 4HKTA 1DQZA 2I2CA 3EB9A 3KQYA 3TZ6A 4FC7A 5ELXA 3F1LA 3K5IA 4TUYA 1J0AA 4P0QB 4G2NA 1OXXK 1MJHA 3OU2A 2HMYB 1QIHA 4HHEA 4NPAA 4DLKA 5KSZA 2AN1A 3E9RA 4N03A 1NNEA 1TUEA 2FEWB 3NEJA 4QXQA 4URHA 1N33B 2ERYA 1V8OA 1HLGA 3HMKA 3HLKA 4RKWA 3EWAA 1AGYA 2PPVA 4BN5A 5J40A 2IKQA 1N8SA 3JD0A 1TO2E 3PDCA 2LV8A 2WGCA 1YE5A 2CMFA 2Z4SA 5HM6A 5J43A 1HYGA 3CVYA 2OXIA 5AW7A 1DKRA 5BR4A 3SBOA 4EG8A 1EFTA 3UK0A 4LBZA 3W1EA 3OTHA 4ZYYA 1TZMA 1CE3A 3A3YA 4JMLA 3RVNA 2CLFB 4F3TA 3RFTA 1T3LA 2O0JA 3BWBA 5E6SA 4IMJB 1E9AA 4GLLA 2BL4A 4LV8B 5DHSA 3M1YA 2V6FA 2PWZA 1PL0A 3P9RA 5ALMA 2NGRA 5F73A 5KTYA 1YZNA 2CVQA 3B13B 1ZAYA 1QGED 4JBGA 1FFXA 3AH8A 3KQOA 2A5LA 1RM0A 2GK4A 5GVSA 1FDSA 4CL0A 4LBVA 4NC9A 3V8MA 1KY3A 1PX2A 1ZGZA 1DBSA 3AI3A 4MP6A 3BFPA 3PQDA 3IP8A 4TMKA 3C3EA 3T9AA 4NY1A 3I9LA 4HX9A 5AKIA 2R6CA 1TEHA 2AXNA 4RZSA 3UFXB 3LGAA 2HSDA 1JU9A 1PYOA 2WZQA 4KLAA 3KV3O 3PCRB 4B2LA 4DUPA 1VECA 1Q19A 2QX8A 2WT9A 1Z38A 4KL8S 5CYGA 1LR7A 3L93A 1KBZA 2WUEA 2IXDA 4PLFA 4AZ3A 4HBGA 2QMEA 2BGGA 2BSAA 3HCDA 1C9NA 4ZU3A 4UCFA 4JNCA 3W7VA 3OKFA 4DABA 2GOYA 5BSWA 3FLBA 5DASA 3KWFA 4M99A 3DBRB 3ZE2B 1AXGA 4KI0A 5HIKA 3ZJUA 4FDAA 1H6AA 3UT5B 4CLDA 4JLMA 3G9ZA 3NC1C 4HWKA 1DCMA 3CUEF 5H1YA 3QVOA 4K6FA 4P80A 3QVWA 2GXQA 3HO8A 3FUUA 3OCXA 4Q18A 1AMUA 1L7VC 4AN1A 3NHSA 5CDTA 2VO1A 4WK0B 5L3VA 4U00A 1KAOA 1FQWA 1CCWA 1HKHA 1W0CA 3PDJA 4PRKA 3VR6A 1KQPA 5A1JA 1KQGA 3RYCA 3AF6A 4E46A 2ARKA 1QRRA 2ZUCA 1LNQA 4AS3A 3ZWCA 4M0UA 3FCSB 4PLPA 3K9HA 3H11B 5ERXA 2WFLA 3M3PA 2R7LA 4YJ3A 4WKNA 5CT8A 1OVMA 1PS8A 2PX5A 3W5VA 1XAGA 2J3HA 3NTOA 2HCFA 3QBEA 3PXCX 1LEHA 2DP4E 2JGMA 3DXZA 2R65A 2YN2A 3K2QA 1VKOA 1TAGA 2OVFA 1T1EA 1O94D 2J3KA 5LKRA 4HLQB 4ZHQA 1BEZA 3EEBA 1XYYA 2DFLA 5DTEA 4MLZA 5JBIA 5H8WA 2QYOA 4G2TA 4CGZA 1ZOIA 4PG6A 1NW7A 1UOQA 3OQIB 4MINA 1DIRA 5TSDA 3REQB 3ULKA 2YJZA 1L8QA 4ZYXA 2R97A 2YIVX 4WBXC 1DBPA 1JQKA 2ERXA 2RIRA 2NU1I 1OQAA 1CS0A 1J49A 3AG6A 4JVSB 3CVUA 4IEEA 1U6JA 1ZK4A 1VRWA 1SD2A 4PC6A 2BUAA 4QT4A 3WLIA 2H0RA 1IY1A 9ATCA 2ETXA 5FNZA 1VHQA 3AT1A 3K9BA 3Q7SA 4RAOA 3WHIA 4DC0A 4RK5A 5BUQA 4KVZA 4PFKA 4FI3F 1GPBA 3H1PA 3HMQA 1JEYA 4EI8A 3PDHA 4FR0A 4BUZA 2ZWIA 1JDPA 4DLWA 4FWTA 4WBNA 2GR9A 3SZOA 4U2DA 2GI4A 3FMPB 5C5EA 3TEMA 1KZGB 1LX6A 4YX9A 5JD5A 1MO3A 1W29A 1XRJA 1LDNA 2Q1WA 4R1QA 3ZY5A 4BV2A 4Z99A 2AGVA 1R4ZA 3WIBA 5A5DA 4J2OA 3F3SA 2GD0A 2K4MA 4AULA 5JMWA 3NRBA 4EGFA 1BJTA 1LRKA 4H1TA 5LB2A 1JQAA 1MD9A 2Q21A 1Z7WA 2YWXA 3QBVA 2MR5A 1K06A 5HUHA 3HCBA 5IXSA 2VAMA 4ID9A 3V7WA 4MIEA 1ULMA 4OJKA 5T8KC 5JVDA 1RYYA 2PH5A 2R5FA 4K3VA 5DYNA 3WLLA 4LIPD 5JROA 5KZMB 4MUBA 4YQZA 5C46F 2A0FA 2QL9A 4JY7A 5KKNB 2VXOA 4FFMA 4NABA 1SKUA 2GBLC 2CDNA 3IUEA 1JNYA 3LDFA 1GGMA 3MN1A 1XTRA 2ZBEA 4DR5B 2UZIR 5TT0A 4KH1A 1X1TA 4DIEA 1OLSA 1QS0A 4WXYB 1BHJA 3M4NA 2DU8A 2GWRA 1Y1KE 3A4NA 5BURA 3GJQA 2J85A 2YBDA 2WZBA 1C7IA 3JZFA 1WKVA 3DBVO 1B1CA 4S35A 2XOXA 5CA0B 4OXQA 5K9ZA 2PNFA 3HJFA 2O8NA 3KUXA 4GC5A 3VO9A 5IM4F 3WWYA 1QFMA 4MAAA 4EPWA 2Z3ZA 3NASA 1UBTS 3A4VA 2AN5A