4UXJA

Leishmania major thymidine kinase in complex with dttp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
167
Chain Sequence
b'RGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSDQLMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSKQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDINE KINASE
publication title Structural and Kinetic Characterization of Thymidine Kinase from Leishmania Major.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 47
structure length 167
sequence length 180
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4uxjA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4uxjA01
4ZCMA 4V0NA 1OH7A 4WXPA 1W2HA 2D2EA 5KDOA 1GL6A 5FTNA 1Z0IA 3WBKA 2NPIA 3R7WA 1NL3A 1CJUC 1P2VA 5FOVA 2REOA 3RYTC 4TZ0A 2X8AA 4HB0A 1HH4A 1KTVA 5FOSA 1NNEA 1XPOA 2X77A 3BORA 3LW7A 1Z06A 2GEVA 5FPHA 1GKUB 2W0MA 4CIDA 3U4QB 4LWZA 3KKNA 3NHAA 3RHFA 2YNMA 4Q9IA 1R0YA 5AK0A 1NVVR 2P5SA 2VSFA 3LX5A 4IDPA 4R7ZA 1R5BA 3B1VA 3FKQA 3KJIA 3B8HA 2J9RA 1MABA 3T1TA 2QSYA 1KAOA 4PC3A 3SYNA 3I5XA 2NG1A 4UNSA 5DE3A 3ZYCA 1MO3A 4FWTA 4ILEA 1A7JA 1OPXA 3RS0A 1ZUNB 4HYYA 1FQKA 2GZDA 4FN5A 1XCGB 3K70D 1C1YA 2E73A 4TMZA 3T12A 2JCSA 3Q3JB 2G6BA 3GLFB 3NC0C 4MKIA 5DI3B 4ASUD 2QTFA 1XD2B 2ZTSA 4JLJA 5EZ6B 5AUPB 1RE0A 1UBGA 1HTWA 2ZSDA 3BH6A 5SZIA 2BMJA 1TL7C 5GVSA 3I8SA 5J4YA 5FPKA 1ZBDA 2JIZD 4LV8B 5HE9A 1N6IA 4LV5B 4CT5A 3JVUA 1V43A 2ZYWX 3KJHA 1Q12A 2IS1A 1QHIA 3FFAA 3BBPA 4D4LA 5K8IA 1G18A 2ZRBA 4JLVA 1R10A 4M9XA 4KBFA 4IDNA 4ZKEA 1W1WA 1ZIOA 1YZLA 1HEIA 3ZS8A 2G1KA 2W6JA 2RMKA 1PLKA 2A3RA 3B1WA 2OXCA 3LWNA 2XGJA 2ODBA 3BFKA 3QENA 4JBYA 3W8NA 3I3SR 4B32A 4US0R 1O3YA 2QSZA 3AP2A 3CX8A 4BLOA 4F38A 3GLGE 3VR2A 4FMDF 5BN3A 2JASA 4CEHB 2J0QA 1KOFA 2CXXA 2IC5A 2J45A 2DB3A 5TVKA 4DXAA 3G82C 2BM0A 3Q9LA 1WB9A 4DLUA 1G9XA 1AKEA 3AKEA 4ESVA 2V7QA 4PPFA 1S4QA 2G83A 3EARA 2EFDB 4Z1MD 2DFKB 2QAGC 2Q3HA 3QUSA 5BYJA 2J59A 2P3SA 5E3HA 2O8EA 4PPGA 5JLJA 4CEIA 3VR5A 2KJQA 3X1DA 1S3GA 4YDHB 3JZMA 1FMLA 2XEXA 2IEYA 3LVRE 2ANBA 2R6FA 2CLCX 5IK2D 3EA0A 1QG4A 2NO6A 2HXYA 2JLYA 2RGNA 4D81A 1OFHA 2ZYTX 4R2IA 4BZXA 4F4IA 3FVQA 1TUEA 1SHKA 2B6HA 1ZD8A 2XSZD 3K09A 4R9UC 4PO8A 3W6OA 4ZDKA 2QTHA 1EXMA 2GBLC 1YZKA 1UKEA 2YC4C 1XU4A 1IXRC 2ASEA 4KHZA 2PEZA 1U0JA 2VF8A 1DADA 3GEIA 5E7MA 4KFSA 4LHWA 3OEHA 4HZUB 1N25A 1FW6A 3LBHA 3ZIAD 2JLUA 5EP1A 1Z07A 2RKOA 2WAYA 3LDAA 4YMTA 5JJIA 2X1VA 1I4DD 1R5NA 3B5JA 1NBME 3QBVA 4TMWA 2OFOA 2EFCB 3LY5A 4IVQA 3IIJA 1R7RA 5CDFA 4B76A 2IUSA 2WWYA 3L8YA 1Z63A 1T5IA 4YMSA 4AYTA 2ZE6A 2PMKA 1U9IA 2O52A 3ICEA 3CZPA 2DFTA 3OIVA 3RRNA 5JWOA 2PH1A 4TYPA 4PQFA 1ZM3A 3I32A 4BFSA 1Z3IX 4FMCF 1UKVY 5LB4A 4KU4A 3U5ZB 2QM7A 4LJYA 4CEJB 3ND9A 4EQ6A 3ECCA 3FE2A 2FNAA 3QPWA 4QRHA 1KO5A 1U0LA 4A4DA 1MRSA 4ZPXA 4DJTA 1DG1G 3SHWA 4UNNA 2NQ2C 2JJ1A 4AKHA 4GMXA 2YOHA 1H65A 4A2WA 1AZTA 4TSFA 4RD3A 1QHSA 4URXR 2ORWA 1VTKA 5FOXA 1X6VA 5AJVB 3ZVRA 4D0GA 2XXAB 2C04A 4OYHA 4Q4AB 5B30A 5F9HA 4PPQA 1Q20A 3QEOA 1UBFA 2VBCA 4MRPA 4URWR 3ZQ6A 3U7HB 1JJ7A 3B1ZA 1AS2A 4M21A 2XNSA 1P9WA 3W6NA 2Z5FA 3EZ6A 1BH2A 3Q7QA 4JLPA 3SQXA 1U8AA 2GVIA 1TBOA 5L3SB 2OBNA 4AKIA 1N0WA 3HR8A 2IEZA 4B74A 3PUXA 5B57C 2CCGA 2ZANA 4NYMQ 3KL4A 3K70B 2XZPA 3V4RA 4B2LA 5LBIA 3BJIC 1XB2A 3FOZA 2Z0MA 3VU9B 3ZJYA 1NRJB 3SEAA 5JCPA 1KI9A 4P4SB 1CJKC 3WHKA 2PCLA 1A4RA 4KYUA 3T1VA 4P3YA 5EUQB 3SQWA 1LV7A 4MKHA 4MRVA 2IYZA 3PEVA 3KKOA 1DOAA 4Q21A 4EPTA 3CR8A 1T8UA 2QGZA 3CXLA 4L16A 2F1RA 4KFUA 3THOA 2ZRJA 3AF1A 2D4HA 1YR8A 4OK6A 4MYHA 4LOAA 2P67A 4EPYA 3Q72A 3KX2A 2IT1A 2QAGA 2UZIR 2W6JD 2B7BA 2WOOA 3EWAA 1YZUA 4Q1BA 1P2UA 4AY2A 2DYKA 1UADA 5C2JB 1ZAKA 6Q21A 2GETA 2JJ2A 4UJ3A 1RZ3A 4ZIRA 2UKDA 2XJ4A 5AR1A 3RWMB 5CK5A 1RVDA 1D2MA 2A2ZA 4D4MA 4Q1DA 4ITRC 1AM4D 1QHXA 2HJVA 3LAWA 4F92B 3MSXA 3ADDA 1A82A 2BC9A 3NWJA 1NJFA 4RFSB 2V7QD 1UBEA 1L4YA 1SVLA 3WNBA 1YR6A 2WAXA 4E5UA 4LYFA 1SVOA 4JT4A 5DHFA 5AWFC 3IQWA 3TH5A 3QE0A 1NI3A 2HYIC 1FNNA 3KTAA 3WP1B 3SZRA 1AS0A 4A82A 1P72A 2XZLA 2O8DA 1KHTA 4NYJR 1GAJA 1D2EA 1ZMXA 1KI2A 1SVWA 2GESA 2AFHE 2R2AA 3B9PA 4PC6A 3A8TA 4Q00A 3BS4A 1DG3A 1ZIPA 5EXSA 2QN6A 3AUXA 1RFHA 4KVAA 4U7DA 2AN9A 3OZXA 1VHLA 1XXHA 4NCHA 1VCOA 2CHVA 2CLSA 1QBKC 2QY9A 3PJRA 1DTSA 2G0NA 1CR2A 1X8JA 2XZOA 4GOKA 4PAQA 1G1MA 2A9KA 2O8FB 4KO8A 3FMOB 2A5JA 3ZLJA 2GCOB 3PUZA 4QG7A 4LV6A 3HU1A 4CGZA 5F2EA 3D31A 4LCBA 4ON9A 4O2LA 3CONA 1PV4A 4D6PA 4V0LA 3OEHD 2RCNA 2ZU6A 4TQAA 2WMNB 3CNOA 5C18A 5J4KA 4JL6A 4GDFA 1Q3TA 3M1IA 4MUAA 4RZ2A 3PEYA 4GL2A 2YVUA 2QGNA 3BFVA 5EJEA 2ZUBA 2ZJYA 3GD7A 4P33A 3FKSA 1K6MA 3PIRA 4DBLC 3AVXA 4OK3A 5AUNB 1JECA 3FFBA 1CKEA 3OAAD 4QXAA 2G1JA 3EPHA 2ZETA 2F1JA 3PG5A 1Z6GA 1RIFA 2ZVPX 1R0XA 4NBSA 4LC0A 2CEAA 3DZ8A 3KJEA 4ABYA 1ZD1A 1NMZA 2BEKA 3KQLA 2D7CA 2NOAA 1FZQA 1RRPA 2HLDA 3NHBA 1E2HA 3SYLA 4LK2A 4C4PA 1JPJA 3RSLA 2ZE7A 1N6KA 1TQ4A 5L3RA 2FV8A 3AVPA 4QHYA 3R7WB 2JJ1D 5CYPA 3RS2A 4BEBA 4DRZA 4EKDA 4TSFD 4FMDB 3TKLA 2IHYA 1XJCA 2VHJA 2CNWA 3D6TB 2H5EA 5F98A 4DCUA 1NJGA 1VG1A 1JR3A 4JT2A 1RC8A 4FD2A 2YOGA 4DDWA 2BBTA 3T34A 3AF3A 1TQ6A 1EX7A 1XEXA 2YOFA 4OQFA 2R6CA 3C5CA 1TF7A 4OKSA 3VFDA 4BLRA 2F55A 1T0JB 4NE2A 4YMUA 3K0AA 1NLZA 1NVVQ 3ZZUA 4IDOA 4OHVA 1PUIA 4XVQA 4HDOB 2F9LA 4Q01A 5KSYA 3A37A 2W2XA 3HJNA 2W83A 2QBYA 2LWIA 721PA 2TMKA 3TQFA 4V02A 1OYWA 1VIAA 3NC1C 1N5JA 2GJKA 4A8JC 2ZJZA 1QHNA 4TLAA 2LCFA 4WZAE 4BZQA 2WWHA 1T6NA 3DMNA 2J3EA 1KK1A 1KZGB 2GCNA 3QPUA 4HAZA 4URZR 3UMRA 1G7RA 3KQNA 1DBSA 3QI2A 4G0NA 4V0ME 4LDJA 2NTYC 4NDZA 5P21A 4NONA 2P6RA 4NP6A 3TE6A 1X1RA 3GLHB 4JJZA 5G3YA 4U5XA 2IBMA 4EAQA 2FOLA 3MWKA 4Q4HA 1TEXA 2H16A 5JHHB 1XMJA 5JSZA 4NH0A 4RD6A 2QEQA 3QVUA 1ZM2A 4QBFA 1GRQA 3WXMA 1G6HA 2ZSFA 1N0UA 1E2FA 2JLZA 4OK5A 3I72A 1G3RA 2JJ2D 3NDPA 3VQTA 4ACBA 4QJ3A 2R6GA 1E98A 1G8YA 4TLDA 1KI6B 1CXZA 3EZ2A 4M9SA 3EPLA 3LX8A 4Q7KA 1SZPA 4OI2A 1WDTA 4FMCB 5GJVC 4B47A 621PA 1CRQA 2WIAA 4B3XA 3AKDA 1PZNA 3CIOA 4LRWA 1KI7A 2FSHA 3IO5A 4PHFA 3PFIA 5CJ2A 1CP2A 3X2SA 1E9CA 3CPEA 1G5PA 3WYAA 4NCKA 1P2TA 4B6EA 2NGRA 1U94A 4BPBA 1Z2AA 1A5TA 2GZAA 2ZRHA 2JLSA 3M6AA 2O8EB 3CNLA 4BRWA 4CEIB 2ZRKA 2ZRPA 1QDEA 5HZKA 1E2QA 5HKKA 4LPKA 5G40A 3ICQB 4EFLA 2CBZA 4E09A 1T91A 3MCAA 2BDTA 5JFGA 1C9KA 4PC7A 2AWOA 1II8A 1AGPA 4BLQA 3IBGA 1AQYA 1CIPA 1A1VA 4GI7A 2VTKA 2WOJA 4NKRA 3PR1A 1OFUX 3RWOA 2FDCA 3GLIA 3K9HA 2QRZA 5A5GA 3JZAA 1LVGA 2EU8A 3BAFA 2VF7A 1NVXQ 3FPAA 4IKEA 5LD2B 2QQEA 4TLEA 1M7HA 3RDPA 3PITA 3SBEA 1E69A 2ZE5A 4KLNA 1G6OA 2C98A 2OCBA 3C16C 4A6XA 4B3BA 2QL6A 4ZKDA 3K0CA 1OYYA 3FKSD 5LPNA 2G77B 2O8BA 4J0QA 3SI7A 3TVTA 1P4SA 3TVDA 2FWRA 3PENA 4TTPA 4TT3A 3TR5A 2GK6A 1E1RD 3GFTA 3OFND 4B6DA 1J90A 2AK2A 1RFLA 1G20E 4W5HA 1KMHA 4MRRA 2VL7A 2QPOA 2B8TA 1ZC3A 3ADKA 1OKKA 2HLDD 3GJ6A 3P20A 4O2RA 4WIAA 1F3OA 2EFEB 2ZI9A 3UEYA 3E5HA 3UG6A 4BGDA 1G3MA 1NSTA 2FSIA 1OE0A 5H1YA 1X1SA 3R20A 3CUEF 4KODA 3FMIA 4JL5A 4B48A 2GVZC 1AGRA 2C5LA 2CNWD 4BUJA 1E4VA 1NG9A 2FEOA 2VIIA 1H8HA 4LZZA 1II0A 1SGWA 4C2UA 1JR3D 4QNMA 2CJWA 3UK6A 1E2KA 3TGPA 4HLQB 1L7VC 3CO5A 4XH9B 1GDDA 4E03A 3WP0A 1JQJC 3F3YA 3AVYA 4F93B 3EIEA 4N3NA 3UMSA 4Q7MB 5TMPA 3UANA 1GM5A 1YZGA 2V6IA 1Q21A 2BMEA 1NMXA 2AD5A 5FTLA 1NVWQ 1P73A 2QM8A 1OFIA 4MRNA 4YMWA 1CRPA 2J0UA 1S1CA 5FPSA 2IS6A 3CRMA 4ARZB 4ERNA 3RC3A 4QGGA 1SXJE 2WKPA 1RRCA 1KNXA 2JLQA 1CULC 5FBQB 1WF3A 2BHRA 1Z08A 3U7FB 1IJEA 2QT0A 3PXGA 4URVR 3ZS9A 4A0GA 2ORVA 2PX0A 4LUCA 2V55B 4LJ4A 2QI9C 4OBEA 1KDRA 2VEDA 1NN3A 4WZ6A 3UATA 3VKWA 1D9ZA 2GEDA 1XD9A 1GSIA 1Z0DA 2C95A 4US1R 2PBRA 4ESHA 1EWQA 3CH5A 4MA4A 2RGAA 2JA1A 4IFEA 3DPUA 2BVNA 3KQKA 3TW8B 4DIEA 3THYA 2BBSA 2GA8A 1ANKA 1XJQA 1W36B 2W00A 1WRBA 2QQ0A 2WJYA 3V4FA 3RRZA 4URYR 3TUJC 4D80A 1IAQA 4I81A 2CDNA 2WIBA 1W46A 3B1XA 5JI2E 4DLSA 3WY9A 4ZIRB 5DH9A 1Z22A 3A4LA 3VAAA 3ZVNA 2PZGA 2PX3A 4Q48A 4Q4JA 4ZCLA 3DDCA 4DCVA 1W49A 4P31A 2JLXA 2VO1A 1P6XA 5EE5B 3A6PC 2P0EA 3DZDA 1Z2CA 5EZ5A 1KI4A 3MWLA 4UKDA 4B34A 5JEEA 2QU8A 1AIPA 3CM0A 3HU2A 3LXXA 4LSGA 2ZRFA 4DT1A 2N1BA 5DHAA 4YONB 4JKIA 2HT6A 4HAXA 5EUMA 3ASYA 3KTAB 4MRSA 2YC2C 2AD1A 4TQ9A 2JEOA 1OLOA 3CX6A 2W2TA 1FTNA 5HKKD 5BYKA 1OXXK 3GJ4A 3KUDA 2OM2A 4DDUA 4HLCA 2Z4SA 4X8OA 4B3DA 1MKYA 3THWB 1XXHB 1Y63A 3SJCA 3UPUA 4NYJQ 5FUXA 3SYKA 1IN7A 4JJKA 3ZD6A 3OIYA 3S1AB 4CT4B 2YWGA 5JJKA 2AWNA 1ZC4A 1VCMA 5JHGB 3QXSA 4EJSB 2BMDA 2ZQ5A 3ZVLA 2ZI6A 2ZSBA 2GDJA 2EWVA 5FOWA 1HY3A 2PCJA 2REXB 3QIAA 2VP4A 2WKQA 1WCV1 2LKCA 2RGXA 1RYFA 2X2EA 2QTVB 2ZR7A 3QG5A 4PQYA 4ZDIA 2DB6A 5HTKA 1HURA 3DEFA 1JXMA 1HQYE 1SXJC 2OCAA 1N5KA 2OILA 3CZQA 2NO1A 1S96A 2IYXA 4KJZA 4FW9A 2C99A 1KO1A 2GF0A 4TT3D 1I2MA 3HDTA 1XFAA 3QF4A 1EFRA 5CIQA 3LNCA 4IXNA 4GNKA 1R0ZA 1OKKD 3FB4A 3CPJB 1NMYA 3HYTA 4HUTA 3GLFE 1AJEA 2FFBA 4FWIB 4UXIA 4QKQA 1FX0B 2GXAA 1KKMA 3KDSE 4D82A 3GFOA 1Z83A 5KHOC 5AJWA 221PA 3BWDD 4JLNA 4HLDA 4A2QA 4TL9A 2ZAMA 1D2NA 1H8HD 4PZLA 1FQJA 4OI1A 4OL0A 1OW3B 4HSEA 4R98A 3TMKA 2H92A 2VYFA 3OIUA 1J70A 1W5TA 4IDHA 3LW8A 3TSOA 2BJVA 1E79A 1ZUIA 4A6PA 1XTIA 1F6BA 3KY9A 3BB4A 1G19A 2IF2A 1VECA 3BGWA 1VG8A 1IN8A 2JLWA 1PJRA 1GNRA 1IBRA 1R79A 1CBUA 1CLUA 1GTVA 3B6EA 4LY6A 3ZVMA 2HCBA 4OQLA 2PLRA 3P32A 3GJ0A 3W9YA 1IN4A 1UF9A 4DSNA 1CEEA 4Q1AA 1OIVA 1XWIA 4AKEA 2O0HA 1W36C 2QBYB 2RH5A 2KWIA 1E2DA 4B73A 1GIAA 1YR7A 1QHHA 1NP6A 4L9WA 4Z54A 1G8FA 4LJ5A 1XTRA 3CW2A 1ODFA 2C9YA 2FGKA 3REFA 5GJBA 3I73A 4B44A 1UDWA 4M1OA 5CK4A 3Q8XB 4GRAA 2ONKA 3A36A 1G3IA 4BE7B 1J2JA 4IW3B 4Q4HB 5K8UA 3NH9A 5JSZB 3AKCA 3OEED 3OESA 1WP9A 1MRNA 1U99A 4NU0A 2A5DA 1ZRHA 4UXJA 4GFDA 1DAMA 4XJXA 1TPZA 1WBBA 1S9HA 5CB8A 2NO9A 1EX6A 1U90A 1Z29A 3OAAA 3NBZC 2B7CA 3O8DA 4A1FA 3HR7A 4QNRA 2MSDB 2O0KA 1CF4A 1KSJA 1ZINA 2GRJA 4LBWA 1TBNA 4GPTA 4DDTA 1ZU4A 1FP7A 1P62B 4B35A 2DCUA 1TMKA 3NKVA 4D4KA 5UKDA 2ERYA 1NLYA 4DVGA 5JCZA 4OQXA 2WPDA 2ERXA 4DWJA 1YE8A 5AUOB 5CLLA 4LHYA 1MH1A 1OXTA 1LF0A 4JLMA 3SS8A 2GXSA 3KUCA 2XNDA 1EFCA 4X8HA 1OFTA 4TMTA 1JI0A 5AJYA 3TUIC 4MH0R 3E1SA 3NEYA 1OHHA 5K8TA 3H1TA 1HV8A 1NN0A 2KSQA 5E7IA 4KFTA 1Z0KA 3AH8A 2MSEB 1KNQA 1U8ZA 1M8PA 2OO7A 2WJGA 1KDOA 1EFUA 1II8B 2ZJ8A 2OV2A 4AYWA 4POAA 2GJAA 1ZNXA 3CRRA 4C0AC 3THXB 4HI0E 1M34E 1F2UA 1R8QA 3L0SA 4HEJA 1DEKA 2H8KA 5BN4A 4EPVA 2ZSEA 2RAPA 2RB4A 3AGQA 3SNHA 5LDDC 2CL0X 1VHTA 4FMBB 4WA7A 1M6NA 3HP1A 4Q47A 4RSGA 3VR4A 3ZZTA 4W5WA 5SZHB 5KSOA 1E4YA 3AF2A 1G7CA 1GOTA 2OCYC 3MLEA 4A36A 1NKTA 4JVSB 2C77A 2DWOA 4KFRA 5FTJA 2DFNA 1Y3AA 521PA 1JALA 2GTPA 2NPFA 3IBYA 2NO0A 3M0EA 3OHMA 4DLYA 4GP6A 4M1KA 1U98A 3X1WA 3I8XA 2O8BB 3B9QA 3SJBA 2NMVA 3BFXA 3WMGA 3PUWA 4LC1A 2ZS9A 3UFFA 1EFRD 1WQ1R 1ZCBA 2Z43A 1BO6A 3FHOA 2CVHA 2QP3A 4LJ8A 5CM9C 5JMTA 2GK7A 2ZE8A 4M2LA 1E9DA 3CF6R 3TW4A 4AG5A 1D6JA 1ZD9A 1KK2A 2IX3A 1KI1A 4HUQA 2PZEA 4AKGA 2QAJA 4OJKA 3SU8A 1T3LA 2AKYA 4M9QA 4M0LA 1GNQA 2F43A 2VP9A 2IW3A 3SHFA 1SVMA 1Q3HA 2QORA 3PCRB 3PUVA 4PHGA 4D4JA 1JR6A 1QRAA 3R9WA 2J87A 4HB2A 4QBIA 4TYYA 3T61A 1WA5A 2MMGA 3K9NA 3DL0A 2DWPA 4QHTA 1JB1A 4JLAA 4V0KA 2GBLA 2CJWB 4DCNA 1E79D 5H68A 4DHEA 2ELIA 4O3MA 4HB4A 5FTKA 4MITA 3SBDA 5G3ZA 2EW1A 4C0SA 1KBFA 3A1VA 2A5FA 5EXTA 3MWJA 2A5YB 4Q9JA 2G88A 5KTYA 3KB1A 3FMPB 2IK8A 4GOXA 4JVLA 3THYB 3F5FA 1AN0A 2C8VA 4IOKA 4XWAA 4ZV4A 1Z0FA 2GAOA 1YZNA 1TEVA 3LV8A 4RFVA 2J0UB 2G9NA 4KITB 2ORIA 3U4QA 1P5ZB 2J7KA 1JAHA 3MGCA 4MGYR 3LBIA 4RKFA 2XOKA 4CZ2A 4DLVA 1E2NA 3C41J 4TQUS 1KDPA 3L0IB 3BK7A 3X1YA 4BRUA 1IXZA 4HAWA 5J4VA 3A1TA 2QNRA 4PXAA 2OG2A 4TMXA 1QG2A 4M1MA 1VKJA 3EZFA 2VSXA 4FCWA 4IOJA 2BCJQ 4ZO4A 2NZJA 4M1WA 1OIXA 1FFHA 2MMCA 3RS5A 2VPPA 1KO8A 3BERA 4Y0AA 1FOEB 4A9AA 4RD2A 4G5SA 4IHQA 2FF7A 2IS2A 1IHUA 4Z8XA 3U6BA 1M7BA 3QKUA 2REBA 2WBLC 2ZEJA 4TMKA 3IDQA 4Q7LA 3K8YA 5DI3A 1PUJA 1GP2A 2R6AA 4ZCIA 3GLGA 2BKEA 1R4AA 1HUQA 4PC2A 5EXPA 1Q44A 1EESA 2OAQ1 1CR0A 4QJ4A 3RAPR 4BLPA 2OLJA 1E1RA 1HT1E 1XDBA 3OFNA 4ZI2A 4Q02A 3DOEA 2EQBA 3NVAA 4XD7A 3CPHA 3K0SA 4Q4JB 3KB2A 2H18A 4DCSA 1MT0A 3R8FA 3QKTA 5TDHA 3L0OA 3K0FA 5DN6A 2IF0A 5KDDA 3BRWD 2WPDD 3K70C 2AKAB 2VLIA 2IYUA 2CE7A 3BJIA 4DT1B 1YRBA 1JPNA 2XNDD 3EIQA 4Q9KA 2GHIA 3QXCA 4AD8A 3GJ7A 2QZ4A 4KYIB 3F0TA 4OI4A 3UWOA 2XX3A 4XTRA 4LJ7A 3H4MA 1MABB 1OHHD 3KQUA 4DB4A 5JS8A 4Q9LA 4JBXA 3H84A 4HZIA 2WWGA 3W90A 3CRW1 1AQUA 3LQRA 5JRJA 1Q1BA 5HPYB 3NH6A 4DLRA 2E9SA 4MDFA 2YUUA 1PTQA 5IT5A 1ZYUA 5KSPA 1SKQA 2FN4A 1VYVA 3EPJA 3V9PA 2OFWA 3HU3A 3AGPA 4AIIA 1SQ5A 3EASA 4JLOA 4LHZA 3QSYA 4JS0A 5EXXA 3RVBA 3CF0A 1FTSA 1P61B 2GNOA 3B1YA 2IYVA 4G5RA 2Q21A 5C4GB 4HB3A 3QJYA 1N6LA 1NBMA 2QE7A 4RD1A 2CCKA 1IM2A 2FNFX 1MO5A 2KI5A 1US8A 4MKFA 4TYQA 4A0FA 1KKLA 5BN5A 5A0FA 4BFYA 1BMFA 4NL4H 1UDXA 1ESNA 2ECKA 1P60A 4BWYA 2HYDA 3LFUA 4EFMA 1K5DA 1VMAA 3WYFA 2FZLA 2ZI5A 4Q9HA 2WJIA 4MYTA 2I1QA 3I62A 3W8RA 4BECA 1GNPA 2BV3A 2PT5A 4YXWA 4LHXA 3Q85A 1IN6A 5HCIA 3SDZA 3T5GA 2EFHB 4HDCA 4QL3A 3LXRA 1G3UA 1SULA 3QF4B 4QM7A 3CLVA 4OQMA 4AC9A 4OHWA 1JBKA 4HZUA 2J5XA 3RRMA 1J99A 4KCGA 3VKHA 3FHCB 4KAXA 4PZYA 1NSFA 2B21A 4V0OA 3VMFA 2GCPA 4AG6A 5EP3A 5KNDA 5FUVA 1N6HA 1NIPA 1ZUHA 1M1YE 3EIHA 4HDQB 4TL6A 5TARA 4QFMA 3RANA 2ZM5A 3GLHE 4M9ZA 4DCTA 1KI3A 1YQTA 3P26A 3MFYA 3QKSA 4NMMA 2BIFA 1WMSA 2V9PA 2FPLA 3TLXA 2XITA 4EPXA 3A4MA 3C15C 5JRZA 2QT1A 4TYWA 4CEJA 4F7WA 3FMFA 2WHXA 1ZNZA 4R71A 1QZXA 2CMKA 5B64A 2FMXA 2A5GA 2X2FA 1GZSA 2ZIAA 3RABA 1QF9A 4IVPA 3W6PA 2GVDC 1FARA 3QBTA 1IJFA 3HYRA 3GFPA 1XTSA 4C7OA 1XBTA 4LJAA 4DSTA 1UKZA 3NXSA 4OI0A 1RYHA 2XOKD 3RS4A 4JLBA 3U3OA 5C46F 3ZQJA 2XXAA 1XTQA 2DPXA 2OEPA 4Q4AA 5GVRA 1EG7A 4IFBA 4BLSA 1DAHA 2IYRA 3NBXX 4RCZA 4JMPA 2ZI3A 5FBRB 5FBVB 2IL1A 1RKBA 3RS7A 2HT1A 1I4LD 1W4RA 4WBSA 4NYMR 1EGAA 2QRNA 4QBGB 4H1VA 3BH0A 5IHPA 3ZZ0A 4BFUA 5L3SA 2MSCB 2PT7A 1XZPA 1OH6A 2FGJA 3WNCA 3LA6A 3PEWA 4TN1A 2N46A 1OT3A 1T8TA 2ZU0C 3AM1A 1TX4B 4JBWA 1S8FA 2EFGA 1NF3A 3GJXC 4LPSA 3BOSA 3KKMA 4G5OA 3AVQA 2IYLD 3A1UA 4Q18A 4IOLA 1F2TA 1B0UA 2D2FA 1X3SA 2F1HA 2BOVA 1Z5ZA 2O8CA 3L0PA 2B8WA 2ZYUX 5H70A 1E9RA 4M8NE 2VA8A 3VR1A 1F60A 4XD7D 2R65A 1MV5A 2FH5B 3CF2A 4YLGA 3SC3A 1BS1A 2WJJA 1XF9A 3EW9A 5HE8A 2ATVA 4EQ6B 1GKYA 3IO3A 1DAIA 1Q1QA 1ZNYA 4QOSA 5DN6D 4KV9A 4FXPA 8OHMA 1YU9A 4H1UA 4LYJA 121PA 5M04A 1SKYB 2ZJBA 3HPRA 1VG9B 2HDNB 4A8JA 421PA 4DUGA 5JEDA 1L4UA 1TUIA 2XTNA 5GJCA 1XA6A 2D62A 2I4IA 1N6NA 3NIBA 3IGFA 4OQNA 5CDFE 4G3XA 3U6KA 1I2DA 1U8YA 2IA5A 4FKDA 1CTQA 2WKRA 5FL7A 1GL9B 1G4AE 1DELA 3GEEA 1AZSC 3L82B 4HAYA 1E2EA 3GCGA 5CM8B 1P3JA 3TUZC 2JLVA 1S3SA 3NBFA 2HUPA 4LJ9A 2PEYA 4NCNA 2V1XA 1AA9A 3Q5EA 1LY1A 2XAUA 2XTZA 1F5NA 1EFHA 1K5GA 4TTQA 2K5UA 5HR5A 2WICA 4NHOA 1N6PA 3LQQA 4LHVA 4BZPA 1DO0A 2Q9CA 2JDIA 4FCVA 1GWNA 1NBMD 2QE7D 3F8TA 4RZ3A 4PSAA 3TJZA 2FX3A 2ZROA 3MJHA 3BXZA 4A0RA 5FFMA 4HAUA 1XP8A 5IRCD 1BMFD 1G21E 2V3CC 2IYYA 2RGDA 2WWWA 4KI0A 1MOZA 2D06A 2YKGA 4C0HA 2HJGA 5L3QA 1FUKA 4DEYA 4RZUA 3N2EA 1Z47A 2YWHA 4F4CA 2YHSA 3OEEA 1G8GA 2QROA 4YXWD 4AWXA 1P2SA 3AB3A 3EC2A 4XOIA 3VX4A 3AVUA 3SJAA 2YWFA 4TWZA 4CF7A 1KZ7B 1W0JA 3UGLA 2QAGB 4IJMA 1D5CA 3QG1A 3IIMA 2DWQA 2IUTA 1E0KA 1ELOA 1Q57A 3AVWA 4HUQB 1KO4A 4NCJA 1NG1A 5FBLB 2BCGY 4B3GA 3RSOA 2FFAA 1KYIA 5JI3E 1SVIA 1TQDA 1U2RA 5SZJA 1Z6AA 1Z6TA 3BB1A 3UKDA 4CDGA 3ZGXA 4PFSA 1GRRA 1KIMA 2IXFA 3FDIA 4HATA 4M1SA 2DR3A 2ZRGA 4QGAA 2RGNC 3L43A 3LH5A 4LI0A 3RC8A 2GWHA 2IWRA 2W0SA 1KAGA 2RGCA 5DSZA 4OHYA 4BASA 3K09C 1PLLA 2IXEA 3BD9A 2ZUCA 3Q7PA 5AJXA 1OXUA 3EPKA 4KVGA 4W9MC 1KJYA 2D74A 2HXSA 4XVRA 2O8DB 5LD2C 1OJLA 1XD8A 1XMVA 3CX7A 1N6OA 1YRAA 3U3JA 4EDHA 2OLKA 2FFQA 1E2IA 2GEUA 3ADBA 3IIKA 1NN1A 1QHYA 2WWIA 5F3WB 3KKQA 1VPLA 1NY6A 4XSHA 4B3FX 4CYMA 3RRYA 1IQPA 1XEWY 3EA5A 3QEJA 2GJ9A 3ZD7A 2OCPA 1RW4A 2P5TB 4XSGA 5TV2A 1N5LA 1XTJA 1R0WA 5FOTA 1QHGA 1RJ9A 4V0MA 5HZHA 2ZVQX 3EX7C 2X19A 1GG2A 2W2VA 2ZRDA 2PJRA 3OF5A 1OXSC 5FUYA 1PTRA 4JVMA 4ACAA 4B75A 2DHRA 1U9IC 4G01B 2Q3FA 4GBMA 3JVVA 5CJPA 3SN6A 5K8LA 3TSZA 3ZH9B 1O87A 2C03A 1X8LA 2VRWA 4N0DA 2ZRLA 1WXQA 5GADl 1G5RA 4U02A 3ADCA 3U2QA 4WVFA 4BFVA 1LNZA 1ZW6A 4LBYA 5FPYA 5J4HA 4G1UC 3QY0A 3I4LA 2VHCA 1G17A 2CL6X 3T5DA 4PQRA 5BQ5A 2J46A 2Q0HA 2WJHA 1P9RA 3DKVA 4KSCA 4GZLA 2BKUA 1XJ0A 4Q4LA 1BIFA 3VNUA 3MAAC 4ZDWA 3GLGB 4B33A 4O25A 1XXHE 3UWKA 2JLRA 3TNFA 3IEUA 4I1SA 1TU3A 4XIGS 3PV0A 2XJ9A 3U60B 1XCMA 3DOFA 4RY2A 3T35A 3CRQA 4EUNA 2FA9A 1KO7A 3D8BA 1T3HA 3B82A 3GLHA 4DLWA 2CVFA 3UGDA 1VDZA 1DARA 1JXOA 3UXMA 2Z4RA 3REGA 5B58C 4M1TA 2ZREA 1G5TA 1G41A 4WXRA 1T3SA 1LW7A 3K0FB 4LGMA 1DO2A 2FJUA 4NYIR 1YZTA 2IYTA 3K0EA 2CLDX 4MGKR 4PX9A 4V03A 2FEMA 2VHUA 5D3MA 5FR1A 4DUGD 3AVTA 4W5JA 3SJZA 1M2OB 3TRFA 3IEVA 3CKLA 1E2PA 2IHBA 3MRSA 3K9GA 5EE0A 2F3RA 3E2IA 1KI6A 1AKYA 1D9XA 1XEXB 1T9HA 3P1JA 5FL7D 2GF9A 1TQ2A 2D7DA 2N42A 3NEJA 2A30A 1BKDR 3N70A 2I3BA 3T15A 2ZJOA 3UG7A 3P4YA 4MYCA 4Q5IA 2OESA 2QENA 3K0AB 2EWWA 2OUKA 2Q9AA 3BC1A 3TR0A 1ZU5A 2C78A 4P32A 4I1OA 4YMVA 1KSHA 1OB2A 2ZPTX 1CR4A 2P6UA 4XWOA 2JAQA 3ETLA 3L8ZA 4UNRA 4DLXA 2JDID 2IYQA 5J40A 1ZJ6A 4DKXA 1NN5A 2VHTA 4P4UA 4AYXA 1XPRA 3VKGA 4RKEA 1QVRA 1ZM9A 4QC2A 2JJ8A 2CK3A 3BIFA 3KJGA 3DO6A 2IS4A 1BYUA 2FFHA 1US8B 1GRNA 1E96A 2J1LA 3WRYC 4D0LB 5BWMA 2R8RA 4IEEA 1JR3E 4MGZR 4DLTA 4NCIA 1WBDA 3R9IA 1HE1C 5TY0A 1ZP6A 4TLBA 3C5HA 1BYIA 5TB5A 3GEHA 1L2TA 1YZQA 1GKIA 3A4NA 1OF1A 1RRGA 4UQOA 4MDEA 4OHZA 1XPUA 2NO7A 1II9A 1FUUA 5KSZA 2J0VA 1W0JD 5EE9A 2J41A 4Q19A 1DE0A 4AK9A 3VHLB 1VCNA 3N5CA 3K9LA 4WOPA 4DZZA 3GMTA 4DDVA 3FYHA 1UBCA 3PQCA 3B85A 2LKDA 2NIPA 2RGBA 1ZM7A 4JL8A 3FGNA 2KE5A 3H0KA 3FTQA 4MQBA 4C0BA 1IY2A 4HLUC 2XB4A 2QMEA 4CRWB 5JS7A 1NKSA 1M7GA 1PLJA 1XTKA 1R2QA 1KSFX 1KJWA 3AF4A 3A1SA 3W34A 2QA5A 1KDTA 1UJ2A 1YVDA 2HF9A 4UNPA 3U3RA 2WWFA 3QXJA 4Q7JB 4D0NA 1SVKA 3QKSB 4PAOA 4EJSC 1KSGA 2AFIE 3KKPA 3LBNA 1EWRA 4G5QA 2Y8EA 1OXVA 3A1WA 4JYBA 3U7EB 5DNYB 1E2JA 4AI6A 1W4BA 1E2LA 4UNQA 1TU4A 3TBKA 2ZJ5A 2ZRNA 1FPMA 2Q9BA 1SXJA 2GILA 1HE8B 2FG5A 3MWYW 1OH8A 3A58B 4C0QC 4L15A 1P75A 3B2EA 4IVRA 3PUYA 3W5IA 3QVVA 4C7OB 4PHTA 1EFTA 1K8RA 3CB4A 1RPZA 5KNBA 3NG1A 3TIFA 2BM1A 2IXGA 4FIDA 5DI9A 3SFVA 1P9NA 2O5VA 2FSGA 5BXQC 1G16A 4WW0A 4JLKA 3GLIB 1N5IA 2AX4A 3WMEA 1KY3A 4FI3C 1S0UA 2RGEA 2VP6A 2WZQA 4PANA 2VHQA 1E99A 1RRFA 2DBYA 1LF5A 2GAAA 3H2YA 4KLZA 3EWSA 1SHZA 4RZXA 1G64A 4QBHA 4Y0VA 2ENZA 2ZUDA 4IEIA 4P0TA 1ZNWA 1XCPA 4EPWA 4JVNA 2QG6A 1JJVA 1W7AA 2RHDA 3CH4B 3GQBA 2WJVA 4ARZA 2OXRA 3GJ3A 3UIEA 3KXIA 2H57A 1YHNA 4DSOA 2C9CA 2ZR0A 3NTUA 1F48A 2EVWX 4W7SA 5C1BA 2FE4A 2ZRIA 3U44A 2JGNA 2E87A 2YWEA 1F2TB 4QM6A 1LS6A 3LD9A 1E9BA 1E94E 4OJQA 3U3KA 1MO4A 2IYSA 5KUTA 4XTCS 4YQFA 2VH5R 3EC1A 4DEXA 1U0HC 2O8CB 5JJLA 4LJ6A 4LYAA 4PHHA 1KMHB 4X8MA 1NIJA 1PVOA 2FZ4A 1N2CE 4FCTA 4D25A 5C4MA 1ZCAA 2P6NA 4M4SA 3W5JA 2NZ8A 4JLDA 3GLIE 5CIWA 1R5OA 3IPYA 2ZJAA 1E1QA 2ZR9A 1DPFA 1UKYA 2GXQA 1E9FA 1JQLB 4X8LA 4DB2A 2C2HA 2BEJA 3DHWC 3EZ7A 4L8GA 1T0HB 1YKSA 2ZJ2A 3TK1A 3QKRA 4A8JB 2OSBA 3QQ5A 5FR2A 3WHLA 1G4UR 5CB6A 1IONA 4II7A 2PJZA 1S1MA 2VSOA 3NDBB 4OHXA 1KGDA 2YV5A 3DM5A 3O47A 2AHOA 5FTMA 4Z8YA 2OFXA 1G7TA 2YINC 1H8EA 1Z8FA 4Q1CA 1Z6YA 4C30A 4A2PA 5TXGA 2VP2A 2ZAOA 2PLFA 4PZZA 1KK0A 4C0KA 3U61B 1V5WA 1I4TD 1FNMA 3RLFA 3AUYA 4C0LA 4H9GA 4U00A 2O0JA 4IOMA 1C4OA 3C4JA 3OE7A 5FH9A 2UVQA 2ODWA 1IXSB 2J7PA 2C96A 4PR0A 1G3QA 3GJ8A 4TL8A 2H17A 1XZQA 5KDLA 3SR0A 2CK3D 2A7QA 1J7KA 3EAQA 4GP7A 5SZKB 1KBEA 3AQ4A 3GP8A 5FUWA 3THWA 4HLUA 4GZMA 4AURA 5G41A 5L3QB 1A2KC 2GJ8A 5KOYA 2F3TA 1IN5A 1XMSA 2HV8A 1YR9A 3S1AA 3MG9A 3WNDA 2W6IA 3DMDA 3K1JA 2GXUA 2WSMA 2V1UA 4TZ6A 2FU5C 5E4FA 3L2OB 3T1QA 3X1XA 5L8VA 4UJ5A 3O8RA 3GLFA 3M4YA 2D3WA 2W58A 5EQTA 3LLMA 4EFNA 4EJSA 1XD2A 1NY5A 4PAMA 2V6JA 5IF9A 5J47A 5EE1A 5JWRA 2H7VA 1SVSA 1W2GA 1AS3A 1T4GA 2L0XA 2Z83A 4QGFA 4D2IA 5KNCA 1TAGA 2PL3A 4KBGA 3G5UA 5JZVA 1TF2A 5FI0B 5JBQA 3GPLA 2ODNA 2QUZA 1KJZA 3I5YA 1ZVQA 5JECA 3SOPA 3P4XA 4MKGA 3D7MA 2FPMA 5B2ZA 1LS1A 1OV4A 4CW7A 1W5SA 2ZRCA 4XVUA 1DAFA 1W0KA 2Q3MA 3KFXA 1MR3F 4IRUB 3LLUA 1S9DA 2ATXA 4CVNA 1E9SA 2KBFA 1HQCA 1UPTA 3EZ9A 2WV9A 1W4CA 2PMDA 3CWQA 4IDQA 3W3ZB 4BFWA 2BBWA 4C2TA 1DS6A 3VR6A 3CNNA 1A2BA 4GSYA 1J8YF 3AVVA 4DLZA 3I1FA 1TTTA 3R9XA 4B43A 4P4TA 3WMFA 1FX0A 5LB2A 1FAQA 4M53A 1R6BX 1SXJD 4MUBA 4CEHA 3QOFA 3I92A 3KXLA 3SE0A 821PA 2BWJA 5DO9A 4YDSA 1E32A 1GL7A 2QP4A 3RS3A 4BFXA 1LB1B 3K0CC 1GFIA 5EP4A 4ZI3A 1GILA 1KI8A 1ESMA 1CJMA 1CU1A 2IWHA 4K46A 1QVAA 3R8CA 1RJ9B 2R9VA 3K53A 3QNUA 4O0MA 4PPNA 1Z28A 3TQCA 4RD4A 2F7SA 3IHLA 1N6RA 1G291 2WMOB 1VYUA 3IILA 1N0VC 5DLQC 1LFDB 1IOZA 1Q22A 1JAIA 2F9MA 1ZM4A 4TYNA 1NVUQ 3AP3A 2WSSA 2GZHA 1E2MA 3ASZA 5EE3A 2VRWB 2V4ZA 4N0EA 4N1AA 1W47A 5DYIA 2Z6VA 3HWSA 1FP6A 2IYWA 5E95A 4LYHA 1LTQA 3BE4A 2FSFA 4PSKA 5GJWC 1E6CA 2BJWA 1XRJA 2G3YA 5KO2A 2A78A 1HYQA 3IPXA 4NTZA 1E9AA 3KZ1E 5G53C 4JYCA 5EP2A 4PO1A 2QMUA 4L5BA 1DAGA 1Q1EA 2OHFA 3E70C 4F4JA 4B2PA 1WE2A 3W3AA 4QGHA 1VCIA 3IHWA 4JKYA 4BLTA 1T5LA 3C7KA 1ETUA 1S2MA 3CRVA 4RVCA 1UFQA 3MUFA 1DAKA 3EG5A 2OAP1 3B60A 2PZFA 4XWKA 5H8WA 1VIYA 1TADA 4IXMA 1E1QD 4QJ5A 4C3ZA 2OT3B 5KU1A 2ZI4A 1FL9A 1BOFA 3AP1A 5DIFA 1W36D 1G8PA 1E0SA 2QPAA 3MJRA 4I1UA 1IY1A 2ZRMA 1W44A 1CR1A 2YYZA 5D3MB 4A15A 4EIWA 3AVOA 2BMFA 1COWA 1OB5A 1DAEA 2JATA 1U81A 3B7GA 3FWYA 4K81B 4L9MA 3CR7A 4I4LA 2WM9B 5FOUA 5DISB 3GJ5A 1G8HA 1D8TA 2CHQA 4NYIQ 2QPTA 1VYTA 2SHKA 5D3QA 3NBYC 3TAUA 1H8ED 3QF7A 3FHTA 1UAAA 2OBLA 2ENNA 2R44A 2ONJA 4LBZA 1FMJA 3DKPA 4MYUA 2G0TA 3SFZA 1UEJA 2ZI7A 1CS4C 3I61A 3PVSA 4TTRA 2WWXA 4GMDA 3OE7D 2V54A 3QXXA 3TSWA 3BB3A 4GOJA 4TLCA 2J7PD 3LVQE 1E9EA 4MGIR 2ZSAA 1QHHB 2AXPA 2UZ3A 3U3MA 4E22A 1IY0A 4Q66C 3VTKA 2ZS8A 2H1LA 3KQHA 1Y8FA 1HT2E 5DYGA 1B23P 3J81k 2V8OA 2P2LA 2OE2A 2W6ID 4D26A 4M1YA 2QMHA 2VQSA 3V00A 3QXHA 1VG0B 4I1VA 2ROWA 4I99A 4DIDA 3THXA 5ELXA 5JWHA 2R6DA 4KSBA 4TMVA 4WZBE 3VHXA 1OH5A 3RNLA 1DVRA 3LRPA 3VU9A 3IUYA 1OSNA 1W48A 1Q1ZA 3D3QA 4KXFB 4ASUA 4PSVA 4P4SA 1TNDA 3ND8A 4JSTA 5CITA 4S2EA 4B3CA 2CL7X 4Q1FA 3MMPA 1XMIA 5CYOA 2XB2A 3DVLA 5DGXA 2JIZA 3C14C 4Q1EA 4HAVA 1AK2A 1ONBA 5AJZA 4RJLA 5BW8A 2QP9X 2ZS7A 3EXAA 1N3BA 1E3MA 3VNVA 4E07A 2F1IA 1XNJA 4BFZA 5J5CA 4DC9A 1UM8A 3AV0B 4YC7A 3O8CA 1L8QA 1W0KD 3KFVA 1TF5A 4L9SA 4EPRA 4A0HA 2ANCA 1JNYA 5FI1B 2AR7A 4LX0A 4B71A 1Q0UA 3UEJA 2BBOA 1GVNB 1YJ5A 3BH7A 3UMFA 3ONWA 4A92A 1JEEA 2ZRAA 4C0JA 3H86A 5KPDA 2DFLA 4M22A 2ZXUA 3WBJA 2CE2X 1MO6A 2AXNA 4B2IA 1NLFA 1SXJB 2DY1A 3AF0A 3VX3A 4S35A 5KYKA 2WTUA 1E2GA 4RFSA 4PO9A 2EYUA 3WRXC 1KY2A 2J0SA 2RGGA 1GITA 3IKJA 2AL7A 3KXKA 2KBEA 2XTMA 3N2IA 3OIWA 1F2UB 5KPJA 3AEZA 1XEWX 3P27A 4FINA 1CJTC 2CHGA 1EK0A 3PEUA 5FL3A 1XX6A 4Z1MA 3UGIA 3B78A 1SKYE 1Z0JA 2WSSD 5CLQA 1R8SA 4Q03A 3C8UA 4G5GA 3T1OA 2ZYVX 3TAHA 2QMOA 4NZYA 3AKYA 5FPTA 3G0HA 1W4AA 1UEIA 3X1ZA 2OZEA 4LBVA 4C9BA 1X8KA 2YZ2A 2R62A 3U7GA 2HF8A 3LO5A 5IK2A 2F6RA 3ZDQA 2AK3A 4F91B 3IQXA 4R2HA 4UXHA 1X86B 3CWZA 1G7SA 4ZDJA 2O8FA 1CJVC 2RHMA 4BEJA 2I1VB 2GCOA 5E7JA 3VR3A 1E0AA 4JIMA 2P65A 2XSZA 4JSYA 3U44B 2C9OA 2E1RA 4QHSA 5A4JA 3B13B 4TL7A 4PTLA 4B6FA 1Z6XA 4RCYA 2FPKA 4US2R 4NPHA 1GUAA 4GT1A 3T06B 5L3VA 4L4UA 3DM9B 1JEDA 4JZKA 4K8OA 4URUR 5J4LA 1KK3A 1M74A 3ZIAA 3HPQA 4DSUA 4Z51A 5IDVA 2B92A 3WYGA 5F9FA 2GJSA 2F43B 3CBQA 4WAUA 4RD0A 2KB0A 2GKSA 2CCJA 1P7CA 2ODEA 2WVJA 3MD0A 1KMQA 3QPVA 4BQSA 1HA3A 2HCJB 2VP5A 1OIWA 1COWD 2YJTD 4BFTA 2VP0A 2EYQA 3O8BA 4PC1A 3QKRB 3Q5DA 2Q6TA 2OBMA 1E0JA 1Z0AA 2IUUA 5ANRB 5FBWB 5HCNA 2ZITA 5AUQA 1J8MF 1XEFA 2HEIA
chains in the Genus database with same CATH superfamily
3C4VA 3ETCA 4DZRA 5AKEA 5I4KA 5I7HA 5CEEA 4R6WA 4GQAA 3RIHA 5LP6F 2NPIA 4AY6A 4OVOA 4R9NA 2V0GA 1NW7A 1H66A 5FOVA 3OPYA 2X8AA 1EJ2A 1XPOA 1UOOA 2D2VA 4W7HA 4E1BA 1JH9A 4OMFG 1LNQA 1PL8A 4YUVA 2W0MA 3EE6A 4OHKA 3KKNA 2H7XA 2ILVA 5KCMA 3JVIA 4G81A 1R0YA 5D85A 5EY5B 4ZAZA 5AK0A 1HZZA 1VSQA 1EGMB 4XR9A 4AM8A 5HYVA 4XGNA 4HQKA 3AERB 4CKEA 1GYPA 2NVBA 2ZW9A 3AHIA 4MKZA 4W1PA 1CY4A 1TDJA 4M0FA 2P9QA 5EVJA 3UXHA 4OMDA 3I04A 4BS9A 1H3EA 1QRSA 5DE3A 5C9ZA 2ADMA 3AT1A 4KR6A 4QUHA 4PGHA 1K8XB 3TE7A 1WJGA 2CZQA 5JNRA 4IX1A 2AEJA 4OPMA 1KHHA 4UVIA 4LMAA 2GZDA 4FN5A 3RS0A 1OMTA 2IHUA 3WYEA 3WO1A 1NJ1A 4PFJA 3DQZA 1W19A 2I62A 2E73A 3EG9B 3F4LA 3Q3JB 1UBHS 2Y6VA 2FEXA 3QJGA 4GZ5A 3ZK8A 2H2AA 3IOMA 5IDQA 1DNPA 3PFGA 4FYHA 4MKIA 3NHWA 3GLFB 4KR2A 1RC0A 2GN8A 3HA7A 2ZTSA 3B6MA 3L8GA 3P0JA 2AUNA 3ZNNA 4PLFA 5GVSA 1JTFA 4R81A 1AB5A 1PGPA 1NVFA 5FPKA 1U7HA 4LV8B 1LC3A 4WCDA 1VFPA 2I2FA 3FXAA 4I9FA 4N6OA 4K87A 1M2EA 3OQNA 1N6IA 1YFZA 1B2RA 1PCXA 1WO8A 4OL9A 1V43A 2ZYWX 4TOIA 5ALEA 1SCIA 2R6ZA 2ATEA 3GVHA 3IPAA 5K8IA 3E0XA 1W1IA 3QVGB 2IV3A 3KOWA 2OOKA 4RA9B 1QYXA 1JG2A 3HDHA 2N9UA 1TGYA 1B42A 4OB7A 4KXWA 1I3CA 1F38A 3DTNA 3WQRA 2A5LA 3B1WA 3SYTA 2J48A 1CY1A 3QENA 4M83A 1RZRA 3W2EA 1A8IA 5HEKA 3GRRA 4MARA 4R83A 3I3SR 5BOVA 3GNSA 4KKVA 4RIFA 3AEXA 3AP2A 2XBUA 3CX8A 5JATA 3WGYA 3PDIA 1R4MA 2I71A 2J5BA 2OQ2A 2J0QA 1LPBB 1SB9A 1H6CA 3FFWA 5JDCA 1G98A 1XZNA 2J45A 2NXEA 1PR1A 3FA2A 3MTAA 4N5IX 1V1RA 2RKBA 4IINA 1OBHA 1V8PA 3LOQA 3Q9LA 1B00A 2DBQA 3MWFA 4GWKA 3TL3A 1CGJI 3OICA 1D4FA 2IVZA 4TXNA 3PR2B 2V7QA 3AOEC 4LZJA 4PPFA 5EWLB 5KAMA 3X2FA 4EY5A 1HG0A 1P29A 3LRTA 4Z1MD 2PUHA 1VL1A 4PZCA 2QAGC 3HN7A 3QUSA 4FFLA 2WHPA 1C2TA 3URMA 5JLJA 4CEIA 4I4IA 1OBFO 3GDWA 3VR5A 3ZZNA 2DLDA 2I8CA 3EDQA 3QUCA 1OPRA 4K6FA 5H83A 3U17A 3X1DA 3TOAA 1QFMA 1S3GA 3H6HA 4F3KA 2JYYA 1ORDA 3IKLA 5JTTA 3KWJA 2YZGA 4LMBA 2GASA 3FZNA 3KVNA 2NADA 3B38A 1CUGA 2R6FA 2KYRA 1K7EB 4NU5A 2R47A 1Z5VA 3FNIA 4N18A 2PS1A 4RS4A 1Q91A 4TLMB 4B4UA 4X91A 2NO6A 2HXYA 4DUZB 3HDVA 2JLYA 1F5SA 1EB8A 4R1TA 1DINA 3HGQA 4FLFA 1ZVJA 3VR3D 4F4IA 1LDBA 5SYNA 5DGCA 1EBUA 2C1ZA 4J0CA 4O63O 3N74A 4Q37A 4RYDA 4ZDKA 2A9QA 4DR7B 2GBLC 3P2MA 3PGMA 3C7AA 1Y4ZA 1YZKA 2QLMA 4N0QA 4YAGA 4QOGA 4IY1A 5BWNA 5KB3A 1U0JA 5DHUA 3QBEA 3EQ6A 1F06A 3I9V6 2REQB 1YDGA 4KFSA 3EVFA 1JHMA 3JPWA 4LHWA 5E7MA 5KJ1A 2R11A 1NYTA 1SURA 1Y1TA 3ZIAD 4E33A 3DH0A 1KVUA 3E3OA 1Q83A 4CIWA 3ND6A 1XRQA 4EYSA 5JHWC 1J21A 3R5XA 5B3JC 2WINI 1O2DA 2EP5A 1O97C 1EBFA 2AA3A 3SM3A 5CCLA 3E8SA 1HORA 2EFCB 2OFOA 4IVQA 4RENA 4U5QA 1R7RA 2YJ6A 3WFIA 1DS3I 1BMDA 1LPPA 2ZAIA 3EQZA 5G4KB 3IUMA 5TQJA 1ZDMA 2ZJ4A 1U5BB 2HTEA 2LEOA 3L41A 3SZ3A 2ZE6A 1HR0B 2O52A 1WW2A 2QL5A 3NUZA 3CVVA 2LTAA 2YICA 3CZPA 1IQ0A 3O38A 3PIDA 1ZGGA 3UJ7A 4BFSA 2ATIA 1XHEA 5CA0B 3K2BA 2XDYA 3PNPA 5AKGA 3ZBTA 5LB4A 3NASA 2HU7A 1MJAA 3ECCA 2NZWA 3DHNA 4CLRB 4EQ6A 1O96B 1SD5A 3AVVA 3QPWA 4QRHA 2OCXA 1U0LA 1F7VA 3RQSA 1MRSA 1VSBA 4NBRA 4A4DA 1YVRA 1XUOA 4UNNA 1DT3A 1UJNA 4EB8A 1EA7A 1KYZA 1DMSA 3TFWA 1P80A 2YOHA 1H65A 4A2WA 4TSFA 4K2AA 2HPHA 3E9NA 4AJKA 3GMSA 1OLXA 1X6VA 5AJVB 1OZFA 4MPRA 1F4PA 5E9AA 2QRQA 3W7AA 4OYHA 3BSSA 5B30A 3LUFA 3SZOA 4RFLA 1FXUA 1GVHA 4F2HA 3QEOA 1N36B 4OB6A 3U7HB 4CFSA 3IVRA 2R68A 2XV1A 4AZ3B 1AS2A 4GH5A 1LK0A 2XNSA 1CFJA 4G1BA 1L6IA 4EF5A 4MW4A 4QYWA 5CRIA 3WMRA 1HFJA 4B4WA 2O2XA 2QMYA 3FDJA 3NDRA 4YROA 4DBZA 3SQXA 3A06A 4KN5A 2GVIA 1TBOA 1Y80A 2YWXA 2Y1CA 2YVQA 5JD3A 3ROXA 3WISA 4YRNA 4AKIA 1E20A 1GCOA 1N0WA 4MROA 3HR8A 2CVOA 2HV9A 4K1XA 4NJEB 5K51A 2ZANA 3K70B 3KL4A 4MQFB 2PQ0A 3AINA 2NU7B 3QYAA 4FWBA 1P31A 2QVLA 3SEAA 4E70A 4IIJF 3FFXA 2WM3A 3OA2A 1Z34A 3WNQA 4DBLE 1Q0SA 2A0FA 4LF5B 5DM1A 4P3YA 3MS7A 5EUQB 2AW3A 3BHNA 5T4FA 3NVDA 1A27A 5BW4A 3DV9A 3U62A 1PTKA 1UBUS 3LHDA 3GRKA 1Q0QA 3EUAA 5AXDA 5A1JA 3NWOA 3OM9A 4FFMA 5J8FA 3VJKA 2H5LA 4KFUA 3THOA 3TLBA 4BHTA 2JBWA 5AXAA 1LUAA 1IH8A 1YR8A 1Q15A 4OK6A 4AN0A 3CS3A 1YBHA 2C2OA 2P67A 2PQ2A 2R84A 3D64A 3KYJB 3Q72A 2IT1A 2QAGA 2WOOA 2AFHB 3EWAA 4Q05A 2FW0A 2I29A 1YZUA 3LUPA 4L5AA 1PN3A 3QQPA 3AESB 3E7WA 2UZ1B 1RZRD 4NS1A 1UADA 2AOUA 5C2JB 1ZAKA 5LIRA 3K9FC 2GETA 4ZIRA 3UAOA 4DJ5X 2V0CA 3BJZA 3H2ZA 4KO1S 3WLMA 3WLTA 1Y9DA 5DLDA 1JSCA 2QRHA 2XIJA 5K8VA 4AS1A 2WVGA 4QDZA 4CCWA 1X7ZA 2R8PA 3G8YA 3R8CA 4JI4B 1T5OA 1QHEA 1QHXA 2CLKB 2MIIA 2HJVA 4RKYA 4ER0A 4PZ9A 4RVNA 1A82A 1XJWA 1Z4OA 5CT5A 5CXSA 2CV2A 3NWJA 4RFSB 2V7QD 2E18A 3B52X 2J32A 5LP6B 3UH1A 1BXKA 3UA3A 1RHUA 4E4RA 4WJZA 2E1PA 4DGSA 3PSAA 4M8LA 1S2OA 4JT4A 3X1JA 1P5RA 5AWFC 4DLAA 4GBJA 2CWDA 1WUIS 1NI3A 5CFRA 1FNNA 4WJKB 2H9AA 3VR5D 1JG6A 5IARA 5KQSA 1MX9A 1XLUA 2OV4A 4WX2B 3FR7A 1GAJA 2X0RA 1KI2A 2C5BA 2I76A 3P9KA 4O4IF 1QPGA 1LR9A 2JNWA 3QA3E 2P62A 1U4NA 3IA2A 2COUA 4PYLA 4UATA 4C4YA 5EXSA 2PUJA 3MINB 1T5TA 2IXAA 5LCXA 4FM9A 2IEGA 2O1SA 2XMBA 3GU3A 1VHLA 1Y5LA 4KQCA 5E8JA 1VCOA 3W7VA 1NZJA 4ZQEA 4ZVSA 1WZCA 1Z5PA 2WUGA 4ZYTA 2MR5A 1P3Y1 3BDAA 1JP7A 3PDNA 3CEMA 4PYOA 1PNRA 2PO5A 2XZOA 1I1HA 5A5FA 1K7UA 1G1MA 2A9KA 3AFGA 1L4MA 3FMOB 2A5JA 4HHEA 4EO7A 3TLCA 1TC1A 1D2CA 3HU1A 3NI2A 5AIBA 4CGZA 4OOFA 3H3FA 2YDYA 2C4MA 3GJRA 5F7XA 2J3MA 1PV4A 4A23A 3H2HA 5JANA 1JDJA 3C0KA 4H4EA 2C3PA 4IIXA 1GPKA 4S12A 2C5HA 1YRYE 5I9TA 4Z2AA 2GPBA 1BX0A 9LDTA 1EVEA 1SQGA 2RGWA 4JL6A 4H3KB 4RZ2A 1QKJA 4MUAA 4AMVA 3PEYA 1POWA 2XKJE 2YVUA 2G80A 5F7ZA 1E3JA 1PGOA 2ZJYA 3FKSA 3PIRA 2X3YA 3DPSA 1FQWA 1SHUX 1F4LA 1JECA 1CKEA 2G1JA 1KRXA 7REQA 3HDJA 4JELA 1Q11A 2ZVPX 5JW6A 3SS7X 4ARSA 3ZQKA 3DZ8A 1NMZA 2C2KA 2QXYA 4XDZA 4D96A 1EVLA 3K8OE 1PWYE 4ZU6X 4BMDA 4IQGA 2HLDA 1AXEA 3N2YA 3AFNA 1GARA 3H05A 1P33A 4JQZA 4GKAA 1N6KA 4W1QA 1KH1A 1TQ4A 4Z9AA 1R8YA 1HRKA 3L6BA 1JE0A 3WOHA 1DC8A 4MV1A 4BEBA 1XN1A 4EKGA 2CT8A 3RVKA 1U7XA 3RU9A 4TSFD 2W2LA 3IVXA 4NS4A 3CUYA 3RKSA 2VHJA 4X65B 2CNWA 5BSUA 5F98A 3KT8A 3BJEA 3JPYA 1KBOA 5F5XA 4DCUA 5EZYF 1B26A 1NJGA 3OD1A 1AD2A 4G26A 1JLHA 4W5TA 3L7IA 2C7OA 4DDWA 2OB2A 4NH4A 4FFBB 3T34A 2EP7A 3GL9A 5BWLA 1TQ6A 1XEXA 2YOFA 4OQFA 2HU5A 2V4UA 3H5LA 3K3PA 1M0TA 3RVMA 2B5VA 1GAEO 2PLAA 3II6X 2GS9A 3M6UA 4LXTA 3FI0A 2IOFA 4YMUA 1NVVQ 2BFCB 4Q15A 1SC9A 4OHVA 1NKVA 1NV8A 4WD3A 3HXTA 3V5NA 2WFLB 1QGOA 3H4VA 5SYAA 2BMVA 1MFZA 3I9LA 3HJNA 2W83A 1PR0A 3DMFA 1Q84A 2LWIA 5JYDA 4U7FA 4V02A 2QZSA 3TI9A 1P4AA 4NCAA 2GJKA 1RCFA 3RVLA 4BVKA 4IDEA 2QYTA 2LCFA 2WWHA 1T6NA 3W3AH 4HAZA 3TLMA 4URZR 5CLHA 4WCFB 5DGTA 1HX7A 2G1AA 1KPIA 3LP6A 3QI2A 4G0NA 4OQEA 4LDJA 1EEHA 5EWMA 2BPOA 3N8GA 2C00A 2WRZA 3H0EA 4RZQA 1I80A 2CDAA 4NP6A 4DNFA 3IIEA 4QICA 4Q3LA 6NULA 5BRJA 2H16A 3NHZA 4O4LA 2YHUA 3BGIA 3CZ9A 3V4ZA 4D56A 3OLYA 4L8VA 5KBYA 1I3MA 1FK8A 3ZDYB 3LPDA 1WL8A 4UULA 1SUBA 1GZVA 2B25A 2B8EA 3FB1A 4HSGA 1T9ZA 4I4CA 4KR9A 3Q7RA 2B6NA 3DNMA 1E6WA 4FI3F 1GRQA 4IH1A 1L1QA 3WXMA 3EZYA 3EGOA 1T2AA 2J5QA 4D43A 1MA3A 3VYSB 2VTEA 3IT2A 1DBVO 2IIQA 2QRPA 4BEWA 1JEYB 3MOIA 1SKAA 3S7TA 1EUCA 2OBYA 1RHQA 1TUGA 4GP9A 1N8SA 2VK1A 3SYMA 2HH9A 1E98A 3C8MA 2QN3A 4FP9A 4EGFA 2HA6A 2HBQA 5HDQA 3ANYB 2CHUA 3NC4A 4J94A 3IC5A 2P9JA 1GFSA 3TAXA 3EPLA 4YIKA 4OLAA 4Q7KA 3SX4A 4CI9A 1LSJA 4OI2A 3B6JA 2BFPA 2MSKA 2VJOA 4NV1A 2JZOA 3WBBA 2WIAA 4X8OA 4B3XA 4ZHQA 1PZNA 3JQBA 2DKFA 1KI7A 2P9BA 2CD9A 3FBTA 3IO5A 1C9JA 2MSNA 2I6TA 3A32A 3ILYA 4MQEA 3ISTA 2ZYHA 1E8NA 3QTLA 4X60A 3MHPA 4IZHA 4DILA 2NGRA 1U94A 1MIOA 3GV0A 2N1MA 4CDRA 5EMLA 1A5TA 1LVUA 2GZAA 2ZRHA 3M6AA 4JI5B 3RVNA 3CNQS 1CNEA 4C87A 4BRWA 3OLVA 3E27A 5ARBA 1C1XB 4MB6A 3W9SA 2DVMA 3ICQB 4ZEVA 2RE8A 4YRDA 2CBZA 2PX6A 4FHGA 1LXCA 2JGKA 4BNDB 1XZAA 5ARCA 1Y0BA 4YDQA 3MCAA 2PWAA 5F51A 5IM4A 1TJPB 3NRJA 3I2HA 3C6KA 4MJ7A 5FI3A 3LXUX 1KP3A 4CM4B 2JF0A 4GI7A 4MXDA 4HMQA 2VCHA 2VTKA 4A26A 2J6BA 1N9ZA 1N2CA 2OYCA 3Q3IA 1NONA 2XXJA 3BULA 2HOQA 1TYEB 4FGZA 4IWYA 2FDCA 2I2WA 4WASA 5IF3A 2VATA 1WSAA 3BAFA 4OBBA 1NVXQ 3FPAA 1J0AA 2IVFA 4ZOQI 1I7DA 4IKEA 2XQKA 4NDNE 4ESEA 4F0JA 4TXLA 5FA8A 4IIJB 4Y2YA 3CLUC 3SBEA 1YK1A 4IJWA 1JEAA 2AF4C 1G6OA 1FSSA 4ZQFA 2OCBA 4L08A 1Z2EA 1JQDA 4ZKDA 3BWXA 3EXG2 1VLMA 2SCUA 2QJRA 4AN1A 3FKSD 5LPNA 1E5QA 2G77B 1DG9A 5F23A 4K6GA 5ALTA 1QU2A 2WG2A 3W2TA 3ZW9A 1E5VA 2B61A 1Y82A 3KB6A 4JI6B 2OV3A 3ORHA 4WQMA 3TVTA 1P91A 1KJJA 4TT3A 3TI7A 3LA8A 2YJ4A 3GFTA 2WMYA 5CFMA 2XF2A 3O4IA 3TM4A 3OFND 3MGGA 2Y1LA 4PBSA 1ARZA 3EVZA 5CLGA 3VKFA 5C32A 4PCUA 2RIJA 3P20A 2WTBA 3GJ6A 2HLDD 5DB4A 5DBGA 3KYDA 4IV0A 1F3OA 1WBJB 3EMKA 5I8WA 3UG6A 1EZ1A 1FRZA 3D2BA 1G3MA 3DCJA 2FJPA 1A9PA 2PWYA 1OE0A 5H1YA 1QVZA 3ESRA 2W2LD 3X2EA 3PNSA 2P3LA 5A3JA 4RTLA 4BUJA 2CNWD 4M0DA 1NG9A 3IMFA 2VIIA 1H8HA 5K4GA 1QE3A 8ABPA 1SGWA 5TIIA 2WJPA 1PYDA 1AK1A 4YLYA 3RS9A 2RBEA 1E2KA 3CVOA 1RWBA 3CO5A 3ED1A 4UVEA 5DBEX 1YBFA 1CE8B 5E4TA 3HABA 1WQ3A 1YTUA 1TM4E 1S3IA 1K1EA 1C50A 3PCTA 4Q7MB 4FR5A 4X44A 5LZ8A 5JZ9A 2YJGA 4KR0A 5G1PA 5EN4A 1CJSA 1TVMA 4BBZA 1PNQA 4E5NA 2XYQA 1LWOA 2W8BB 1XVUA 2BMEA 3VC2A 2B98A 2XYPA 3A04A 1P73A 3IUNA 3EXIA 1F0NA 2OWDA 2WZBA 2QM8A 1JEQA 3OD5A 4O4IB 1W1UA 4QDJA 1XWWA 1CRPA 4F5ZA 1ULNA 1S1CA 2CWFA 1WOMA 2VXCA 2YIMA 1IIBA 4GI3A 4H7PA 4CIXA 4DGQA 5B1EA 3CRMA 1EAYA 3HFGA 1C4WA 4ECAA 5IJ0B 4HVAA 4X66B 3CCBA 4LQDA 1Q9BA 5TRTA 1A72A 5FBQB 1WF3A 3I37X 3ENQA 1IJEA 3GRVA 4URVR 2ORVA 4ZYUA 4LUCA 4BP1A 4XWWA 1TPYA 4LJ4A 1KDRA 4PX3A 4JA2A 4LXIA 3V2IA 2VEDA 4MV7A 3UATA 3DD1A 3K8QA 3HYCA 3U5ZB 3QXGA 4D8UA 1QFSA 1GSIA 1Z0DA 2C95A 2XWBF 5H4GA 1SUCA 3F3MA 1EWQA 1BA2A 2JA1A 4JQSA 1AKTA 2CV1A 4DIEA 4CUJA 3THYA 1VDMA 5J59A 3JQAA 3GDGA 2EW2A 4QATA 4XGQA 1XJQA 1WRBA 2QQ0A 3MQFA 3OM1A 3TUJC 3WGMA 1I10A 3H97A 1IAQA 1X8XA 4I81A 2BFDB 2CDNA 3ZE2B 1W46A 4BMYA 2IP2A 1JDTA 1KMMA 3EPPA 2WE8A 1DX9A 5IW8A 3HDYA 1A04A 1RVV1 5TPWB 1G8MA 4W8HA 2RJNA 5KVSA 4ZCLA 5EKXA 3TO6A 1D2HA 2AUTA 1HZJA 5T4EA 5D51S 5E3PA 1DKMA 5KU7A 2VO1A 1P6XA 1ZMRA 2FR8A 1WOYA 2R4UA 4NG4A 5EE5B 3VYVA 1ADBA 4BB5A 1PYGA 4KWHA 3ELBA 1Z2CA 1IRIA 3QLTA 4U4AA 1PD0A 1PZXA 2IFTA 3DLCA 3HN2A 3MWLA 4S1TA 5JZMA 4AS2A 4DA9A 2B4RO 1PFWA 2QU8A 3LKZA 3NX4A 3VBCA 1P3DA 3HS3A 3HU2A 4UTNA 4JJEA 2GN2A 3QTLD 2N1BA 5AI0A 4XGRA 3T3DA 4JKIA 3FNEA 1Q0RA 3IMKA 2I22A 1S20A 3H99A 3GRCA 2HT6A 4LISA 1FFEA 2OXIA 4RIHA 2MSWA 4TS1A 2FP4A 2O3JA 2P2YA 4QOFA 5FEUA 2JEOA 5EZYB 4INPA 4RLHA 2XMSA 2WP8J 4IEFB 4PN3A 2H3EA 3TLKA 1NUUA 1VRWA 2WVHA 1ZH2A 2QD5A 3AM3A 7WGAA 2HD4A 2A84A 3DBVO 4UE2A 1CP3A 1S7GA 5AI4A 1QGUB 1XXHB 4QDKA 2ESRA 1IVNA 3OHSX 3UMGA 3N2ZB 2RAUA 3ZNPA 3HKCA 1L1RA 1GA6A 3T94A 5FUXA 2X2PA 3RJTA 2C2YA 1IN7A 3SYKA 4D9BA 4BKRA 3CTPA 3S1AB 3Q15C 3ZCVA 2Z95A 4G1VA 5E9WA 4OGLA 5JJKA 4INAA 1X2EA 3JWEA 4AAYA 1BEUB 1VCMA 1JU3A 2ZZKA 4KMOA 5JHGB 3WZMA 3G2MA 3ZVLA 4M1YA 2C7PA 2GDJA 3EVDA 2REXB 3TGWA 2VP4A 1U8FO 1TTQB 1WCV1 2RGXA 3IP1A 2X2EA 2ZR7A 5ED0A 3ENNA 2JLVA 2HBZA 3G79A 4HDAA 4ZDIA 5B1SA 4PF1A 2VJMA 3D4BA 2FHSA 1HURA 3G59A 3DEFA 4OP3A 1SXJC 2OCAA 2A0UA 4D9IA 1EH5A 4KLCA 1IC6A 2YCBA 3CNHA 4H7HA 4RSHA 1BDBA 4KP7A 2ZBDA 3LSYA 4CIYA 4ISCA 1J1IA 1C0PA 1HFKA 1C3LA 3CUUA 1JHRA 5AW7A 4AB1A 2VF5X 3QEAZ 4OMUA 4TZTA 4TT3D 1AHHA 3HDTA 1YJAA 4J1TC 3LNCA 3TL2A 1U3VA 4IXNA 4YJ3F 3ZUGA 3FB4A 1BJRE 4CMEC 1C7EA 3GLFE 1U2ZA 2CJXA 5IVIA 4QGBA 2PLNA 3NCHA 3DEIA 5CCDA 2GXAA 4Y7CA 4D82A 1LR7A 3GFOA 4XIJA 1TC2A 1Z83A 5KHOC 3VZBA 1ZUD1 2JIQA 1XU7A 1E7RA 1Z33A 3C70A 3JZIA 1ZBQA 3Q7TA 2VNSA 2YWCA 1NI4B 1H8HD 4PZLA 4OL0A 1S2IA 2MINA 2IU3A 3KAKA 4DR3B 1C7ZA 1MO2A 1ONOA 1YCDA 2H92A 2R2GA 5EKSA 4LOJA 1G8KA 3VJLA 4WOJA 2XADA 1RPJA 2Q7XA 3TB6A 2AE1A 4A6PA 2Y2UA 4GYWA 3UMCA 1YGYA 2H1HA 2IF2A 1VECA 4MWTA 1VG8A 1M54A 3CISA 2B8JA 3EIFA 1OBOA 3CNBA 3VYTB 5HK8A 4F1KA 3A3KA 3KHTA 1KQFA 5IAEA 2F67A 5LQMA 1T2FA 1I7SB 1B6TA 3O1LA 1OCEA 5H3CA 1XMXA 1CBUA 4CLOA 4EZBA 4B7CA 4OQLA 2BEWA 2PLRA 3IDAA 3GJ0A 2VBGA 2SKDA 3F9CA 3IYLW 3SC6A 1ZH6A 2BEUB 4R1MA 3DEJA 4G07A 4LZWA 4Y2SA 4IYJA 4AKEA 4L2IA 4R68A 4I5EA 2NP6A 2KWIA 3AKZA 1EIZA 1E2DA 4CM1A 5CBPA 2OK7A 4XOUA 3VNBA 5I48A 1FUYB 1T1GA 1QHHA 4FBGA 3WGKA 2QYSA 2V7UA 2H1FA 4K9MA 1FIUA 2HQBA 1G8FA 1O54A 1RHMA 1IHYA 2ZWVA 1ODFA 4U1RA 1E1DA 3RGGA 4ZEWA 4FNOA 5IYZA 4B3RB 1ACMA 1I6LA 3REFA 3E81A 3NIWA 5EJIA 3U3DA 4OJTA 3QYFA 5CK4A 3Q8XB 2LV8A 1J2JA 3UBTA 1V3VA 3FAKA 1UDAA 3NH9A 4MPTA 4P6VF 2P1RA 5U4QA 1RBZA 2AFIB 4CCYB 1DWOA 3WLHA 1X7WB 4LNHA 2ZLBA 3FCSB 4PIVA 1T3ZA 4UXJA 5LJLA 4DV7B 3F5DA 4U7JA 1ZJWA 1QPBA 2IYEA 1TPZA 4L50A 5K3FA 4HNVA 4CNBA 3W77A 3S5UA 3C2QA 2CF6A 2RBKA 1EX6A 3OAAA 3IODA 3KDAA 2JAXA 4JR1A 3PJDA 1NNI1 3OTIA 4KVZA 1EP9A 4X1YB 3WLFA 2IJGX 4IQ0A 3KETA 1OTYA 1AQIA 1SCKA 2R25B 3I5MA 2YX1A 5TT1A 4BQIA 5IAAA 3UC9A 1UMCA 3UCXA 1KSJA 4ND8B 1K3FA 1XE3A 3O1HB 4GPTA 3VSEA 4LGCA 1GRCA 3O75A 1R0RE 1L5KA 2ZT7A 2I5PO 3E4CA 3FPKA 1X7XB 2N17A 3A0UA 2M6RA 3NXKA 4GDMA 4F8EA 3NKVA 3J80A 1QU3A 4ZICA 1M75A 4Z0NA 5JCZA 2HA7A 2I66A 3V8EA 2XYRA 1N8NA 3BRWA 1YB6A 1Y9ZA 2HDOA 2LD4A 2WPDA 1YTPA 2ERXA 3FDXA 4C22A 2FR1A 5M34A 1XRRA 3CKKA 4HKTA 1MH1A 4LHYA 2JFYA 2EWMA 5GONA 3UK2A 2BDUA 2R8BA 6GPBA 2ORED 3ZOZA 1MC1A 4OHMA 4D57A 2VWPA 1K8YB 1N92A 3SLRA 3TUIC 1KH3A 3NEYA 3W5UA 1W96A 1PNTA 2ZSIA 5K8TA 3L46A 4ZMBA 4EY6A 4XDYA 3JQRA 3PC8A 4AY2A 1DHRA 2OO3A 4M1QA 1DTEA 1IPHA 3L7KA 2Y27A 4KFTA 5E7IA 1RXVA 2QYOA 3AH8A 4LRXA 4JR2A 3ZV6A 1ESEA 1M2NA 1Y1CA 1FXSA 1KDOA 4MI6A 4TS9A 5EJ5A 5HRCA 3H5TA 2CMGA 2OV2A 2C1EA 4LW8A 1ZNXA 2IP1A 1O8CA 1CW2B 1X14A 2PPVA 4HI0E 3M6FA 1F2UA 1R8QA 3G7NA 4YHBA 1LKZA 4IGEA 4YRBA 1HNXB 4RQAA 2D7JA 3Q11A 1MC8A 4X24A 3BRSA 5BN4A 4EPVA 5C3UA 1WM1A 2RB4A 2WYVA 3CSSA 3EGDB 3VMMA 4D8WA 5CG2A 4EHKA 3HXQA 2IY9A 1RKVA 1M6NA 2IY7A 1ZONA 2ICAA 3N2KB 5SZHB 1G7CA 1GOTA 1YRWA 1Z4IA 1KMCA 1NKTA 2J9GA 2XHEA 3EULA 3O4GA 4JVSB 2C77A 4FOPA 3WNZA 1WZEA 3L0YA 4KFRA 2WKSA 4CCAA 2PYIA 1VJGA 3CV3A 3EXFA 2NPFA 4AMYA 4OB8A 3DTTA 4ZP1A 4BP9A 1MTZA 4PLCA 4YUZA 1YWGO 5I7AA 1NQTA 3SJBA 1GSOA 1SGDI 1R27A 2HJWA 5K7SA 2BP7A 5IASA 2NYVA 3L4EA 2D59A 3PTAA 4BC0A 1OXKB 2C8KA 1BO6A 1A5ZA 4IDCA 2CVHA 5JARA 3AUSA 1B93A 3EUEA 1E9DA 3CF6R 4M2LA 4ZT6A 1D6JA 1MQSA 1KK2A 1QONA 2A1UA 2NNLD 2WFZA 1KI1A 3N86A 4OCZA 1EVYA 5GQSA 5HF8A 5I4CA 5FUMA 1FVFA 3CH6A 2RK6A 1MV8A 4MP6A 5KTTA 2PV0A 3D3JA 3IOBA 3EGCA 4TWIA 4DREA 2AVNA 3BGOS 5KCZA 3T3PB 2A58A 2NT3A 3IAHA 1J7JA 1GNQA 1L5NA 4HT3B 4YJ2A 3SHFA 3E1KA 5G02A 1SVMA 4PHGA 2QORA 4RY8A 1W2WB 4MWSA 3LUAA 4D4JA 3KSMA 3R9WA 3C6MA 4I5GA 2AE2A 3GR6A 3R3ZA 2P68A 2DWPA 3NVMB 3SQLA 1V8BA 3WGIA 1IDOA 1LBTA 1PS0A 2EJWA 3SGBI 4RZIA 2PT6A 3PDJA 1C3VA 4H6XA 4O3MA 3CQ9A 4KQJA 3GUVA 5G3ZA 1ZSNA 1B7GO 4G4SP 4G0QA 4HFRA 2BLLA 2BFOA 3OVOA 5HQTA 2A5YB 3EEIA 1TOTA 2X9NA 3GGDA 1GU0A 3KB1A 4OXQA 4HWPA 1QIDA 2WKWA 4GOXA 3TX6A 3F5FA 4C07A 2CNLA 4ZVTA 4IOKA 2BF7A 4KLRA 4QTUB 1TGVA 2GHRA 1SVNA 1E1NA 3V6MA 1H4SA 1NF9A 2G7MC 2OZVA 1UK6A 5T67A 3CB2A 1MT1A 2J0UB 1RYDA 3F47A 4Y2QA 3O93A 4DLPA 3U4QA 2YIJA 1XMOB 3ENZA 5ILOA 3GD5A 1V7QA 2XCRB 1R9JA 2Y05A 2XOKA 1CUHA 3PD1A 2C58A 4L4RA 3DMTC 2PXXA 3PFBA 3TFOA 3DB2A 3BZUA 5ECGC 1FTYA 4JI0B 4HAWA 3A1TA 2MTBA 4TN5A 1DTWA 2OG2A 1M5UA 3PA8A 1QG2A 3LC0A 4TMXA 3ZDAA 1VKJA 2C2XA 2VSXA 3EZFA 3N7TA 4FCWA 4X20B 2I6QA 3H1EA 4MS3B 4BNFA 1NRWA 2IIPA 4DM4A 5B1YA 3EDRA 3JQ9C 1GPNA 2ACKA 4S3MA 2PMWB 5J3JA 1EM8A 2K6GA 2INGX 2Y1XA 1I5EA 1UP7A 1XV5A 4IZ6A 4G5SA 4IHQA 4RD2A 4ZQHA 4PTYA 2HSZA 3AHJA 3L4SO 2AJCA 5TT0A 2ZG6A 3D3EA 1YZVA 1CGII 4AJJA 1ZH8A 3UWMA 4GU5A 1QZ3A 1XT6A 3PXUA 5DI3A 4ER7A 2PX5A 1U7OA 2R6AA 3DXZA 5F1PA 5I8PA 4JLSA 2BKEA 4PC2A 4RGVA 1Q44A 1EESA 1LR8A 5ALIA 2V4MA 4XEHA 1VJTA 3R8XA 1K89A 3FDFA 2CF5A 3CUVA 1CUCA 3PTLA 1DUSA 1K97A 2Q5OA 1JPUA 1WG8A 5E6RB 5I9BA 2PUTA 2C3OA 1ZR2A 2LXNA 3PFFA 4GR4A 3CPHA 3D6VA 4Q4JB 3KB2A 1SUFA 1PR3A 4XAQA 9ABPA 3EIUA 5FQNA 1TCAA 3PQ4A 4YJ3B 2IBTA 2OZKA 3N2GB 4IDAA 7MHTA 1F1BA 1SQSA 1QX3A 3L0OA 3HDGA 4J1QA 4LK3A 3W5CA 2IF0A 3R76A 5KDDA 3BRWD 4NX2A 3ZDFA 1GAWA 2W2PA 4H1WA 2WPDD 4L3WA 2AKAB 2IYUA 2IEAA 2DXIA 3BJIA 2YS6A 1R37A 4DT1B 5TQ0B 4HNTA 4XEUA 1N4DA 1F8UA 1E92A 3QXCA 3SGQI 1M2OA 3DE4X 3GJ7A 5DNAA 4AD8A 5CA1F 3RV3A 5L7YA 3F0TA 2CSUA 2LR0A 5L95A 1IVSA 5J9FA 4OI4A 1YULA 3CEJA 3VGPA 1BWRA 1IFXA 2I2DA 2VCEA 2TMDA 1I94B 1CSOI 1ZEMA 3TL6A 4NZNA 5DNWA 4KH1A 1Z7BA 4BNUA 4DQ0A 4M1EA 4QJIA 2HF7A 3GT0A 4Q9LA 1HNNA 3H84A 5AM5A 5CXUA 2VXYA 2VDVE 3Q0EA 3W90A 3T5TA 3K5PA 1RI5A 3EF0A 1Q1BA 1QORA 1ZS9A 3L7DA 2O1EA 3N0RA 4TVKA 3RREA 1NJ6A 1L4NA 3NH6A 3VO1A 2FWJA 4DLRA 5LQDA 4Y2VA 4R0MA 4Z49A 1X0VA 1VYVA 4RVGA 3EPJA 3HHEA 3LUJA 3HU3A 3EVEA 1EDDA 3AGPA 1EUDB 4JLOA 3EASA 4LHZA 2C8LA 1QH0A 3RFUA 3ZE9A 3AR7A 5E7QA 2HEGA 3RVBA 3F4BA 4M8KA 2Y9MB 3G0OA 2DBVO 1LD3A 4BWGA 4AULA 3QJYA 1XCLA 2QE7A 4M3NA 1CSEE 1I2AA 1MO5A 2KI5A 3LHFA 4MKFA 3RU0A 1US8A 4TYQA 5B4TA 5BN5A 3UCFA 2R7MA 4FGKA 4J43A 4J7XA 5GV7A 4BQFA 4NL4H 1ESNA 3TPFA 3BMQA 4BWYA 2VQEB 2HYDA 4HGQA 3DZBA 4EFMA 3BA6A 1K5DA 1VMAA 2A35A 2GYVA 3TXAA 4COKA 2UYCA 4MVWA 3STHA 4XQ9A 4CR8A 4O4JF 1T8RA 1GG8A 2HTFA 3W8RA 4JT8A 1JHUA 2PT5A 1T4DA 2HK8A 4LHXA 3ENKA 5DKFA 4Z7NB 5L6LB 1PDOA 2O5EA 3LY9A 2EFHB 4QL3A 2IDJA 3DDSA 3QF4B 2LZ0A 4HGPA 2G4CA 3L04A 1RD4A 4NEHB 4P81A 1T1SA 3DR5A 4Y8VA 5JAUA 2V65A 1JBKA 4JJ8A 4UFPA 3K0KA 3QX9A 1JDPA 1ML3A 4NWIA 5CT4A 3RRMA 4KCGA 3WB9A 2ENWA 4JHXA 5B6IA 1B0ZA 2Y4NA 3OY7A 4YJGB 4Y3UA 4K3UA 3FPCA 2GCPA 3T7JA 2XB8A 3FOCA 5L3SB 5C7IO 1XAIA 1U3CA 2YWJA 3JAKA 2ADOA 2V7PA 1X39A 1ZRSA 2R8EA 3CUSA 4ZVLA 4NVRA 2ZM5A 1SH7A 1KI3A 3ZIUA 5F3RA 2HMAA 3BG5A 1G60A 3MFYA 2AW5A 2BUAA 3HZZA 2DU8A 2YXEA 2BIFA 4NMMA 4WTOA 3TZCA 1CFZA 4KPUA 3U7RA 1A9XA 1V3TA 3O0TA 5AESA 1M2JA 5FJJA 4EPXA 1ONPA 4G65A 3C15C 4TYWA 1AQ6A 1L3BA 4F7WA 1F8GA 4GPBA 3GY0A 3RM3A 1ZNZA 1QZXA 2ST1A 1T13A 1PQUA 1ZLYA 4MVJF 1KOLA 3PKIA 4U2DA 5IS2A 3R6LA 3GOXA 1U3TA 1XQXA 2DJ5A 3G9ZA 1QF9A