2NU1I

Molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i and tyr18i
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTHEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Streptogrisin B
publication title Molecular structures of the complexes of SGPB with OMTKY3 aromatic P1 variants Trp18I, His18I, Phe18I and Tyr18I
rcsb
source organism Meleagris gallopavo
total genus 14
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2nu1I00
2B0UC 3OVOA 1Y1CA 2NU4I 3QTLD 2QQCA 1LR9A 1NUBA 1R0RI 1TGSI 1SGQI 1DS3I 1CGJI 2JYYA 2F3CI 2ARPF 1PCEA 4HGUA 1FYBA 1TURA 1H0ZA 1AN1I 2P6AC 3TJQA 2ERWA 1MT1A 1LR7A 1N13A 1OVOA 1IY6A 2KMRA 1UVGA 1HJAI 4GI3C 1M8CA 2NU2I 1SGRI 3SEKC 2N71A 2N52A 1UVFA 2BUSA 1OMTA 2KMOA 1DS2I 1YU6C 1YTPA 2KMPA 2LEOA 2SGPI 5DAEA 1HPTA 2KMQA 3SGQI 1UUCA 1SGEI 2GKVA 2NU1I 2WCYA 2SGQI 4OVOA 1KMAA 1TBRR 2QQDA 1Y1BA 2NU3I 1OMUA 1TIHA 1HDLA 2V53A 1PJUA 1BMOA 1CT0I 1CSOI 1CGII 4SGBI 1IY5A 1M8BA 2XRCA 1SGYI 2N17A 2GKTI 1PPFI 2M5XA 1SGDI 1CT2I 2SGEI 1TUSA 1BUSA 1LR8A 1CE3A 1Z7KB 1TBQR 1SGNI 2JZMA 1SGPI 3SGBI 1CHOI 1CT4I 1IW4A 1OYVI 5JHWC 2GKRI 2NU0I 2JXDA 3HH2C 3B4VC 2KCXA 2SGDI 2OVOA 2SGFI
chains in the Genus database with same CATH superfamily
3MEKA 1WKXA 1ULNA 2B0UC 2B8TA 3D00A 5FUXA 4B6DA 3OVOA 1Y1CA 5HQ8A 2NU4I 2W0TA 2QQCA 1LR9A 3QTLD 1NUBA 3KY9A 3OXFA 3PDNA 5E3PA 1R0RI 1FY7A 4L9MA 1TGSI 1SGQI 3R5BA 1DS3I 1CGJI 1U5KA 2DIPA 2F3CI 2ARPF 2JYYA 1PCEA 3FSXA 5FUVA 4HGUA 3VDUA 1FYBA 1TURA 1H0ZA 3TOAA 2JA1A 2ORWA 2ENZA 1HEVA 5FUWA 2N1AB 1AN1I 2JW6A 2P6AC 3BJIA 3TJQA 2ELIA 1K7UA 2DKVA 2ERWA 1MT1A 1RFHA 5EX0A 1LR7A 1N13A 1OVOA 3E59A 5J8CA 1IY6A 2V1CA 3R5CA 2KMRA 1UVGA 1HJAI 1W4RA 4GI3C 1TBNA 4FKDA 2OU2A 1M8CA 1XX6A 2NU2I 3CXLA 3RU0A 1SGRI 2ORVA 2PQ8A 2QQEA 3SEKC 3VE5A 1K7VA 2UVOA 4E1RA 2Y0MA 2N71A 2N52A 1Z2IA 1UVFA 2BUSA 1V1IA 4DNCA 1OMTA 2KMOA 1DS2I 3OXGA 1YU6C 1YTPA 2KMPA 2LEOA 2OD1A 2GVIA 2SGPI 5DAEA 1HPTA 2KMQA 2CWHA 2YQPA 1UUCA 5E3RA 3SGQI 1SGEI 2LUYA 2ROWA 2GKVA 2NU1I 3OL0A 1MJAA 2WCYA 2X3TA 2SGQI 4OVOA 3TO7A 3UEYA 3UGIA 1KMAA 1TBRR 5FUYA 2QQDA 2YUUA 3UOEA 1XBTA 1Y1BA 4JCVE 2NU3I 1OMUA 1TOTA 3UFFA 9WGAA 1TIHA 1FARA 3GOXA 1HDLA 2V53A 4WP4A 1V1HA 1PJUA 1R79A 1X74A 7WGAA 1BMOA 1CT0I 1Q9BA 1CSOI 1ULMA 1P9GA 2UZ3A 3E2IA 3QAHA 3UGLA 1CGII 3FSYA 2SGFI 1ULKA 4SGBI 1IY5A 1S20A 5J8FA 1M8BA 2RC4A 2XRCA 1WTJA 4AMLA 2QQ0A 1SGYI 5HI7A 2N17A 3TO6A 5CCMA 1MJ9A 1Y8FA 1K7TA 1XA6A 3R5AA 2GKTI 2DB6A 1MJBA 1PPFI 1SGDI 2M5XA 2QPOA 1CT2I 1KBEA 2E5RA 2WGCA 3R5DA 4UXJA 2ODDA 5CCLA 2SGEI 2FNFX 2L8EA 1UHAA 1TUSA 1BUSA 1W3SA 1LR8A 1CE3A 1Z7KB 2V1CC 3UGDA 2X52A 1NXUA 1TBQR 1TBOA 2CWGA 2J9RA 1SGNI 2JZMA 1SGPI 3TO9A 2CWFA 2E73A 1KBFA 3SGBI 3FC3A 2GIVA 1PTQA 1CHOI 2LB7A 2K9HA 4A24A 2CJSC 2WVJA 4UXIA 1CT4I 1IW4A 1OYVI 4UXHA 5JHWC 3OXLA 1PTRA 2L7XA 1VDDA 4MPIA 2GKRI 5E3QA 3TOBA 1P9ZA 2A20A 2NU0I 3QWPA 1WGTA 1WGCA 2ENNA 2RIJA 3VDPA 4E1PA 1FAQA 2JXDA 3HH2C 3B4VC 5EX3A 2VRWB 2KCXA 2SGDI 3UEJA 2OZUA 1X4SA 2OVOA 2J87A
chains in the Genus database with same CATH topology
3MEKA 2B0UC 2B8TA 3D00A 5FUXA 4B6DA 3OVOA 1Y1CA 5HQ8A 2NU4I 2W0TA 2QQCA 1LR9A 3QTLD 1NUBA 3KY9A 3OXFA 3PDNA 1R0RI 4L9MA 1TGSI 1SGQI 1DS3I 1CGJI 1U5KA 2DIPA 2F3CI 2ARPF 2JYYA 1PCEA 5FUVA 3VDUA 4HGUA 1FYBA 1TURA 1H0ZA 2JA1A 2ORWA 2ENZA 5FUWA 2N1AB 1AN1I 2JW6A 2P6AC 3BJIA 3TJQA 2ELIA 2ERWA 1MT1A 1RFHA 5EX0A 1LR7A 1N13A 1OVOA 3E59A 1IY6A 2V1CA 2KMRA 1UVGA 1HJAI 1W4RA 4GI3C 1TBNA 4FKDA 1M8CA 1XX6A 2NU2I 3CXLA 3RU0A 1SGRI 2ORVA 3SEKC 2QQEA 4E1RA 3VE5A 2N71A 2N52A 1UVFA 2BUSA 1V1IA 1OMTA 2KMOA 1DS2I 3OXGA 1YU6C 1YTPA 2KMPA 2LEOA 2OD1A 2GVIA 2SGPI 5DAEA 1HPTA 2KMQA 2YQPA 1UUCA 3SGQI 1SGEI 2LUYA 2ROWA 2GKVA 2NU1I 3OL0A 2WCYA 2SGQI 4OVOA 3UGIA 3UEYA 1KMAA 1TBRR 5FUYA 2QQDA 2YUUA 1XBTA 1Y1BA 4JCVE 2NU3I 1OMUA 1TOTA 3UFFA 1TIHA 1FARA 3GOXA 1HDLA 2V53A 1V1HA 1PJUA 1R79A 1X74A 1BMOA 1CT0I 1CSOI 3E2IA 2UZ3A 3UGLA 1CGII 4SGBI 2SGFI 1IY5A 1M8BA 2XRCA 2QQ0A 1SGYI 5HI7A 2N17A 5CCMA 1Y8FA 1XA6A 2GKTI 2DB6A 1PPFI 2M5XA 1SGDI 2QPOA 1CT2I 1KBEA 2E5RA 4UXJA 2ODDA 5CCLA 2SGEI 2FNFX 2L8EA 1TUSA 1BUSA 1W3SA 1LR8A 1CE3A 1Z7KB 2V1CC 3UGDA 1TBOA 1TBQR 2J9RA 1SGNI 2JZMA 1SGPI 2E73A 1KBFA 3SGBI 3FC3A 1PTQA 1CHOI 2K9HA 4A24A 2CJSC 2WVJA 4UXIA 1CT4I 1IW4A 1OYVI 4UXHA 5JHWC 3OXLA 1PTRA 2L7XA 1VDDA 2GKRI 2A20A 2NU0I 3QWPA 4E1PA 2ENNA 3VDPA 1FAQA 2JXDA 3HH2C 3B4VC 5EX3A 2VRWB 2KCXA 2SGDI 3UEJA 1X4SA 2OVOA 2J87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0U C;  3OVO A;  1Y1C A;  2NU4 I;  3QTL D;  2QQC A;  1LR9 A;  1NUB A;  1R0R I;  1TGS I;  1SGQ I;  1DS3 I;  1CGJ I;  2JYY A;  2F3C I;  2ARP F;  1PCE A;  4HGU A;  1FYB A;  1TUR A;  1H0Z A;  1AN1 I;  2P6A C;  3TJQ A;  2ERW A;  1MT1 A;  1LR7 A;  1N13 A;  1OVO A;  1IY6 A;  2KMR A;  1UVG A;  1HJA I;  4GI3 C;  1M8C A;  2NU2 I;  1SGR I;  3SEK C;  2N71 A;  2N52 A;  1UVF A;  2BUS A;  1OMT A;  2KMO A;  1DS2 I;  1YU6 C;  1YTP A;  2KMP A;  2LEO A;  2SGP I;  5DAE A;  1HPT A;  2KMQ A;  3SGQ I;  1UUC A;  1SGE I;  2GKV A;  2NU1 I;  2WCY A;  2SGQ I;  4OVO A;  1KMA A;  1TBR R;  2QQD A;  1Y1B A;  2NU3 I;  1OMU A;  1TIH A;  1HDL A;  2V53 A;  1PJU A;  1BMO A;  1CT0 I;  1CSO I;  1CGI I;  4SGB I;  1IY5 A;  1M8B A;  2XRC A;  1SGY I;  2N17 A;  2GKT I;  1PPF I;  2M5X A;  1SGD I;  1CT2 I;  2SGE I;  1TUS A;  1BUS A;  1LR8 A;  1CE3 A;  1Z7K B;  1TBQ R;  1SGN I;  2JZM A;  1SGP I;  3SGB I;  1CHO I;  1CT4 I;  1IW4 A;  1OYV I;  5JHW C;  2GKR I;  2NU0 I;  2JXD A;  3HH2 C;  3B4V C;  2KCX A;  2SGD I;  2OVO A;  2SGF I; 
#chains in the Genus database with same CATH topology
 3MEK A;  1WKX A;  1ULN A;  2B0U C;  2B8T A;  3D00 A;  5FUX A;  4B6D A;  3OVO A;  1Y1C A;  5HQ8 A;  2NU4 I;  2W0T A;  2QQC A;  1LR9 A;  3QTL D;  1NUB A;  3KY9 A;  3OXF A;  3PDN A;  5E3P A;  1R0R I;  1FY7 A;  4L9M A;  1TGS I;  1SGQ I;  3R5B A;  1DS3 I;  1CGJ I;  1U5K A;  2DIP A;  2F3C I;  2ARP F;  2JYY A;  1PCE A;  3FSX A;  5FUV A;  4HGU A;  3VDU A;  1FYB A;  1TUR A;  1H0Z A;  3TOA A;  2JA1 A;  2ORW A;  2ENZ A;  1HEV A;  5FUW A;  2N1A B;  1AN1 I;  2JW6 A;  2P6A C;  3BJI A;  3TJQ A;  2ELI A;  1K7U A;  2DKV A;  2ERW A;  1MT1 A;  1RFH A;  5EX0 A;  1LR7 A;  1N13 A;  1OVO A;  3E59 A;  5J8C A;  1IY6 A;  2V1C A;  3R5C A;  2KMR A;  1UVG A;  1HJA I;  1W4R A;  4GI3 C;  1TBN A;  4FKD A;  2OU2 A;  1M8C A;  1XX6 A;  2NU2 I;  3CXL A;  3RU0 A;  1SGR I;  2ORV A;  2PQ8 A;  2QQE A;  3SEK C;  3VE5 A;  1K7V A;  2UVO A;  4E1R A;  2Y0M A;  2N71 A;  2N52 A;  1Z2I A;  1UVF A;  2BUS A;  1V1I A;  4DNC A;  1OMT A;  2KMO A;  1DS2 I;  3OXG A;  1YU6 C;  1YTP A;  2KMP A;  2LEO A;  2OD1 A;  2GVI A;  2SGP I;  5DAE A;  1HPT A;  2KMQ A;  2CWH A;  2YQP A;  1UUC A;  5E3R A;  3SGQ I;  1SGE I;  2LUY A;  2ROW A;  2GKV A;  2NU1 I;  3OL0 A;  1MJA A;  2WCY A;  2X3T A;  2SGQ I;  4OVO A;  3TO7 A;  3UEY A;  3UGI A;  1KMA A;  1TBR R;  5FUY A;  2QQD A;  2YUU A;  3UOE A;  1XBT A;  1Y1B A;  4JCV E;  2NU3 I;  1OMU A;  1TOT A;  3UFF A;  9WGA A;  1TIH A;  1FAR A;  3GOX A;  1HDL A;  2V53 A;  4WP4 A;  1V1H A;  1PJU A;  1R79 A;  1X74 A;  7WGA A;  1BMO A;  1CT0 I;  1Q9B A;  1CSO I;  1ULM A;  1P9G A;  2UZ3 A;  3E2I A;  3QAH A;  3UGL A;  1CGI I;  3FSY A;  2SGF I;  1ULK A;  4SGB I;  1IY5 A;  1S20 A;  5J8F A;  1M8B A;  2RC4 A;  2XRC A;  1WTJ A;  4AML A;  2QQ0 A;  1SGY I;  5HI7 A;  2N17 A;  3TO6 A;  5CCM A;  1MJ9 A;  1Y8F A;  1K7T A;  1XA6 A;  3R5A A;  2GKT I;  2DB6 A;  1MJB A;  1PPF I;  1SGD I;  2M5X A;  2QPO A;  1CT2 I;  1KBE A;  2E5R A;  2WGC A;  3R5D A;  4UXJ A;  2ODD A;  5CCL A;  2SGE I;  2FNF X;  2L8E A;  1UHA A;  1TUS A;  1BUS A;  1W3S A;  1LR8 A;  1CE3 A;  1Z7K B;  2V1C C;  3UGD A;  2X52 A;  1NXU A;  1TBQ R;  1TBO A;  2CWG A;  2J9R A;  1SGN I;  2JZM A;  1SGP I;  3TO9 A;  2CWF A;  2E73 A;  1KBF A;  3SGB I;  3FC3 A;  2GIV A;  1PTQ A;  1CHO I;  2LB7 A;  2K9H A;  4A24 A;  2CJS C;  2WVJ A;  4UXI A;  1CT4 I;  1IW4 A;  1OYV I;  4UXH A;  5JHW C;  3OXL A;  1PTR A;  2L7X A;  1VDD A;  4MPI A;  2GKR I;  5E3Q A;  3TOB A;  1P9Z A;  2A20 A;  2NU0 I;  3QWP A;  1WGT A;  1WGC A;  2ENN A;  2RIJ A;  3VDP A;  4E1P A;  1FAQ A;  2JXD A;  3HH2 C;  3B4V C;  5EX3 A;  2VRW B;  2KCX A;  2SGD I;  3UEJ A;  2OZU A;  1X4S A;  2OVO A;  2J87 A; 
#chains in the Genus database with same CATH homology
 3MEK A;  2B0U C;  2B8T A;  3D00 A;  5FUX A;  4B6D A;  3OVO A;  1Y1C A;  5HQ8 A;  2NU4 I;  2W0T A;  2QQC A;  1LR9 A;  3QTL D;  1NUB A;  3KY9 A;  3OXF A;  3PDN A;  1R0R I;  4L9M A;  1TGS I;  1SGQ I;  1DS3 I;  1CGJ I;  1U5K A;  2DIP A;  2F3C I;  2ARP F;  2JYY A;  1PCE A;  5FUV A;  3VDU A;  4HGU A;  1FYB A;  1TUR A;  1H0Z A;  2JA1 A;  2ORW A;  2ENZ A;  5FUW A;  2N1A B;  1AN1 I;  2JW6 A;  2P6A C;  3BJI A;  3TJQ A;  2ELI A;  2ERW A;  1MT1 A;  1RFH A;  5EX0 A;  1LR7 A;  1N13 A;  1OVO A;  3E59 A;  1IY6 A;  2V1C A;  2KMR A;  1UVG A;  1HJA I;  1W4R A;  4GI3 C;  1TBN A;  4FKD A;  1M8C A;  1XX6 A;  2NU2 I;  3CXL A;  3RU0 A;  1SGR I;  2ORV A;  3SEK C;  2QQE A;  4E1R A;  3VE5 A;  2N71 A;  2N52 A;  1UVF A;  2BUS A;  1V1I A;  1OMT A;  2KMO A;  1DS2 I;  3OXG A;  1YU6 C;  1YTP A;  2KMP A;  2LEO A;  2OD1 A;  2GVI A;  2SGP I;  5DAE A;  1HPT A;  2KMQ A;  2YQP A;  1UUC A;  3SGQ I;  1SGE I;  2LUY A;  2ROW A;  2GKV A;  2NU1 I;  3OL0 A;  2WCY A;  2SGQ I;  4OVO A;  3UGI A;  3UEY A;  1KMA A;  1TBR R;  5FUY A;  2QQD A;  2YUU A;  1XBT A;  1Y1B A;  4JCV E;  2NU3 I;  1OMU A;  1TOT A;  3UFF A;  1TIH A;  1FAR A;  3GOX A;  1HDL A;  2V53 A;  1V1H A;  1PJU A;  1R79 A;  1X74 A;  1BMO A;  1CT0 I;  1CSO I;  3E2I A;  2UZ3 A;  3UGL A;  1CGI I;  4SGB I;  2SGF I;  1IY5 A;  1M8B A;  2XRC A;  2QQ0 A;  1SGY I;  5HI7 A;  2N17 A;  5CCM A;  1Y8F A;  1XA6 A;  2GKT I;  2DB6 A;  1PPF I;  2M5X A;  1SGD I;  2QPO A;  1CT2 I;  1KBE A;  2E5R A;  4UXJ A;  2ODD A;  5CCL A;  2SGE I;  2FNF X;  2L8E A;  1TUS A;  1BUS A;  1W3S A;  1LR8 A;  1CE3 A;  1Z7K B;  2V1C C;  3UGD A;  1TBO A;  1TBQ R;  2J9R A;  1SGN I;  2JZM A;  1SGP I;  2E73 A;  1KBF A;  3SGB I;  3FC3 A;  1PTQ A;  1CHO I;  2K9H A;  4A24 A;  2CJS C;  2WVJ A;  4UXI A;  1CT4 I;  1IW4 A;  1OYV I;  4UXH A;  5JHW C;  3OXL A;  1PTR A;  2L7X A;  1VDD A;  2GKR I;  2A20 A;  2NU0 I;  3QWP A;  4E1P A;  2ENN A;  3VDP A;  1FAQ A;  2JXD A;  3HH2 C;  3B4V C;  5EX3 A;  2VRW B;  2KCX A;  2SGD I;  3UEJ A;  1X4S A;  2OVO A;  2J87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...