2NU1I

Molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i and tyr18i
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTHEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Molecular structures of the complexes of SGPB with OMTKY3 aromatic P1 variants Trp18I, His18I, Phe18I and Tyr18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
total genus 14
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2nu1I00
2JXDA 1CGJI 2LEOA 2XRCA 1OMTA 5JHWC 1HJAI 1TGSI 2ERWA 4SGBI 2NU2I 1LR7A 2KMRA 1LR8A 2GKTI 1IY5A 3QTLD 1TUSA 1PPFI 2N17A 1NUBA 1CT2I 1TURA 1UVGA 1UVFA 1CSOI 2SGQI 2KMQA 2KMPA 1N13A 1TBQR 1SGRI 1SGEI 1CHOI 1IW4A 1Z7KB 1SGNI 1KMAA 1AN1I 2KCXA 2QQCA 2V53A 2B0UC 3B4VC 3SGBI 2OVOA 1DS3I 1YU6C 1SGDI 1UUCA 1M8BA 2GKVA 1Y1CA 1CE3A 1OMUA 2JZMA 2NU4I 2SGDI 2WCYA 1FYBA 1BMOA 1SGQI 3HH2C 2KMOA 3SEKC 1LR9A 1CGII 2SGFI 1HPTA 1HDLA 2NU1I 2P6AC 1TBRR 1SGYI 4OVOA 1H0ZA 1R0RI 1CT4I 2SGPI 1MT1A 2NU0I 3SGQI 2JYYA 2BUSA 1YTPA 1Y1BA 1SGPI 2N52A 2ARPF 2GKRI 1PJUA 1OVOA 1BUSA 5DAEA 1CT0I 1M8CA 2M5XA 2QQDA 4GI3C 1TIHA 2N71A 3TJQA 1DS2I 1PCEA 2F3CI 2SGEI 4HGUA 1IY6A 2NU3I 3OVOA 1OYVI
chains in the Genus database with same CATH superfamily
2K9HA 3RU0A 2ENNA 2JXDA 1V1IA 1CGJI 2LEOA 2XRCA 1OMTA 1XA6A 5JHWC 1HJAI 1TBOA 1UHAA 5E3QA 2ORWA 1HEVA 2JW6A 2PQ8A 3D00A 1TGSI 4DNCA 2UVOA 3FSYA 2ERWA 4E1PA 5EX0A 3UGIA 4SGBI 4UXJA 1W4RA 5FUWA 7WGAA 2WVJA 2NU2I 5CCLA 1LR7A 2KMRA 1LR8A 5E3PA 3UEYA 2GKTI 4FKDA 2LUYA 3QTLD 1FARA 1TUSA 2VRWB 3QWPA 1IY5A 5E3RA 3E2IA 2YUUA 1PPFI 2N17A 9WGAA 2DKVA 1NUBA 1CT2I 1K7TA 1TURA 1TBNA 1UVGA 2CWGA 1UVFA 2ORVA 4UXIA 5FUXA 3TOBA 3UGDA 1CSOI 2SGQI 2KMQA 4B6DA 2KMPA 1N13A 1ULKA 1RFHA 3GOXA 1KBEA 1TBQR 1WTJA 1SGRI 3R5AA 3UFFA 1SGEI 1CHOI 1IW4A 2E73A 1Z7KB 1R79A 2QPOA 1FY7A 5FUVA 1SGNI 2FNFX 3UEJA 1MJ9A 1Q9BA 2DB6A 3PDNA 3QAHA 2OU2A 3UGLA 1X4SA 3TOAA 2B8TA 2L7XA 4JCVE 1KMAA 1AN1I 2KCXA 2QQCA 4A24A 2V53A 2B0UC 3B4VC 3SGBI 2OVOA 1VDDA 3BJIA 4MPIA 1DS3I 5HI7A 1YU6C 1TOTA 1K7UA 1S20A 1SGDI 3R5CA 1UUCA 2ODDA 1M8BA 1K7VA 2GVIA 2W0TA 1Y1CA 2GKVA 1CE3A 1OMUA 3TO6A 1XX6A 2JZMA 1X74A 2NU4I 2RC4A 2SGDI 2WCYA 1FYBA 2RIJA 1BMOA 1Z2IA 1SGQI 3HH2C 2KMOA 3SEKC 5J8CA 2ENZA 5FUYA 2OD1A 3TO7A 2OZUA 2V1CA 1LR9A 1U5KA 1P9GA 2X52A 1CGII 2SGFI 2X3TA 4WP4A 3TO9A 1HPTA 2UZ3A 1NXUA 2NU1I 1HDLA 3R5DA 4UXHA 3CXLA 1Y8FA 2J9RA 1TBRR 1SGYI 2P6AC 2GIVA 2ROWA 4L9MA 2QQ0A 5HQ8A 1WKXA 1WGTA 4OVOA 1H0ZA 1KBFA 3OXGA 2QQEA 3KY9A 4E1RA 5J8FA 1R0RI 1CT4I 1XBTA 2SGPI 1MT1A 2NU0I 2YQPA 3VDUA 2V1CC 3SGQI 2JYYA 2BUSA 1YTPA 2CJSC 1MJAA 2Y0MA 1PTRA 3MEKA 1Y1BA 1SGPI 2CWHA 3VE5A 1W3SA 2DIPA 2ARPF 2L8EA 2N1AB 2N52A 3VDPA 2GKRI 5EX3A 1PJUA 3FSXA 3FC3A 3UOEA 1OVOA 1MJBA 1BUSA 1P9ZA 2J87A 3R5BA 5DAEA 1V1HA 2E5RA 2WGCA 2LB7A 1CT0I 1M8CA 2CWFA 2M5XA 2JA1A 1TIHA 2QQDA 3OXFA 4GI3C 4AMLA 1WGCA 2N71A 3TJQA 1FAQA 3OXLA 1DS2I 1PCEA 1ULNA 2ELIA 2F3CI 2SGEI 4HGUA 1ULMA 5CCMA 1IY6A 2NU3I 3OL0A 3OVOA 1PTQA 3E59A 2A20A 1OYVI
chains in the Genus database with same CATH topology
2K9HA 3RU0A 2ENNA 2JXDA 1V1IA 1CGJI 2LEOA 2XRCA 1OMTA 1XA6A 5JHWC 1HJAI 1TBOA 2ORWA 2JW6A 3D00A 1TGSI 2ERWA 4E1PA 5EX0A 3UGIA 4SGBI 4UXJA 1W4RA 5FUWA 2WVJA 2NU2I 5CCLA 1LR7A 2KMRA 1LR8A 3UEYA 2GKTI 4FKDA 2LUYA 3QTLD 1FARA 1TUSA 2VRWB 3QWPA 1IY5A 3E2IA 2YUUA 1PPFI 2N17A 1NUBA 1CT2I 1TURA 1TBNA 1UVGA 4UXIA 1UVFA 2ORVA 5FUXA 3UGDA 1CSOI 2SGQI 2KMQA 4B6DA 2KMPA 1N13A 1RFHA 3GOXA 1KBEA 1TBQR 1SGRI 3UFFA 1SGEI 1CHOI 1IW4A 2E73A 1Z7KB 1R79A 2QPOA 5FUVA 1SGNI 2FNFX 3UEJA 2DB6A 3PDNA 3UGLA 1X4SA 2B8TA 2L7XA 4JCVE 1KMAA 1AN1I 2KCXA 2QQCA 4A24A 2V53A 2B0UC 3B4VC 3SGBI 2OVOA 1VDDA 3BJIA 5HI7A 1DS3I 1YU6C 1TOTA 1SGDI 1UUCA 2ODDA 1M8BA 2W0TA 2GVIA 1Y1CA 2GKVA 1CE3A 1OMUA 1XX6A 2JZMA 1X74A 2NU4I 2SGDI 2WCYA 1FYBA 1BMOA 1SGQI 3HH2C 2KMOA 3SEKC 2ENZA 5FUYA 2OD1A 2V1CA 1LR9A 1U5KA 1CGII 2SGFI 1HPTA 2UZ3A 1HDLA 2NU1I 4UXHA 3CXLA 1Y8FA 2J9RA 1TBRR 1SGYI 2P6AC 2ROWA 4L9MA 2QQ0A 5HQ8A 4OVOA 1H0ZA 1KBFA 3OXGA 2QQEA 3KY9A 4E1RA 1R0RI 1CT4I 1XBTA 2SGPI 1MT1A 2NU0I 2YQPA 3VDUA 2V1CC 3SGQI 2JYYA 2BUSA 1YTPA 2CJSC 3MEKA 1PTRA 1Y1BA 1SGPI 3VE5A 1W3SA 2DIPA 2ARPF 2L8EA 2N1AB 2N52A 3VDPA 2GKRI 5EX3A 1PJUA 3FC3A 1OVOA 1BUSA 5DAEA 2J87A 1V1HA 2E5RA 1CT0I 1M8CA 2M5XA 2QQDA 2JA1A 1TIHA 3OXFA 4GI3C 2N71A 3TJQA 1FAQA 3OXLA 1DS2I 1PCEA 2F3CI 2ELIA 2SGEI 5CCMA 4HGUA 1IY6A 2NU3I 3OL0A 3OVOA 1PTQA 3E59A 2A20A 1OYVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXD A;  1CGJ I;  2LEO A;  2XRC A;  1OMT A;  5JHW C;  1HJA I;  1TGS I;  2ERW A;  4SGB I;  2NU2 I;  1LR7 A;  2KMR A;  1LR8 A;  2GKT I;  1IY5 A;  3QTL D;  1TUS A;  1PPF I;  2N17 A;  1NUB A;  1CT2 I;  1TUR A;  1UVG A;  1UVF A;  1CSO I;  2SGQ I;  2KMQ A;  2KMP A;  1N13 A;  1TBQ R;  1SGR I;  1SGE I;  1CHO I;  1IW4 A;  1Z7K B;  1SGN I;  1KMA A;  1AN1 I;  2KCX A;  2QQC A;  2V53 A;  2B0U C;  3B4V C;  3SGB I;  2OVO A;  1DS3 I;  1YU6 C;  1SGD I;  1UUC A;  1M8B A;  2GKV A;  1Y1C A;  1CE3 A;  1OMU A;  2JZM A;  2NU4 I;  2SGD I;  2WCY A;  1FYB A;  1BMO A;  1SGQ I;  3HH2 C;  2KMO A;  3SEK C;  1LR9 A;  1CGI I;  2SGF I;  1HPT A;  1HDL A;  2NU1 I;  2P6A C;  1TBR R;  1SGY I;  4OVO A;  1H0Z A;  1R0R I;  1CT4 I;  2SGP I;  1MT1 A;  2NU0 I;  3SGQ I;  2JYY A;  2BUS A;  1YTP A;  1Y1B A;  1SGP I;  2N52 A;  2ARP F;  2GKR I;  1PJU A;  1OVO A;  1BUS A;  5DAE A;  1CT0 I;  1M8C A;  2M5X A;  2QQD A;  4GI3 C;  1TIH A;  2N71 A;  3TJQ A;  1DS2 I;  1PCE A;  2F3C I;  2SGE I;  4HGU A;  1IY6 A;  2NU3 I;  3OVO A;  1OYV I; 
#chains in the Genus database with same CATH topology
 2K9H A;  3RU0 A;  2ENN A;  2JXD A;  1V1I A;  1CGJ I;  2LEO A;  2XRC A;  1OMT A;  1XA6 A;  5JHW C;  1HJA I;  1TBO A;  1UHA A;  5E3Q A;  2ORW A;  1HEV A;  2JW6 A;  2PQ8 A;  3D00 A;  1TGS I;  4DNC A;  2UVO A;  3FSY A;  2ERW A;  4E1P A;  5EX0 A;  3UGI A;  4SGB I;  4UXJ A;  1W4R A;  5FUW A;  7WGA A;  2WVJ A;  2NU2 I;  5CCL A;  1LR7 A;  2KMR A;  1LR8 A;  5E3P A;  3UEY A;  2GKT I;  4FKD A;  2LUY A;  3QTL D;  1FAR A;  1TUS A;  2VRW B;  3QWP A;  1IY5 A;  5E3R A;  3E2I A;  2YUU A;  1PPF I;  2N17 A;  9WGA A;  2DKV A;  1NUB A;  1CT2 I;  1K7T A;  1TUR A;  1TBN A;  1UVG A;  2CWG A;  1UVF A;  2ORV A;  4UXI A;  5FUX A;  3TOB A;  3UGD A;  1CSO I;  2SGQ I;  2KMQ A;  4B6D A;  2KMP A;  1N13 A;  1ULK A;  1RFH A;  3GOX A;  1KBE A;  1TBQ R;  1WTJ A;  1SGR I;  3R5A A;  3UFF A;  1SGE I;  1CHO I;  1IW4 A;  2E73 A;  1Z7K B;  1R79 A;  2QPO A;  1FY7 A;  5FUV A;  1SGN I;  2FNF X;  3UEJ A;  1MJ9 A;  1Q9B A;  2DB6 A;  3PDN A;  3QAH A;  2OU2 A;  3UGL A;  1X4S A;  3TOA A;  2B8T A;  2L7X A;  4JCV E;  1KMA A;  1AN1 I;  2KCX A;  2QQC A;  4A24 A;  2V53 A;  2B0U C;  3B4V C;  3SGB I;  2OVO A;  1VDD A;  3BJI A;  4MPI A;  1DS3 I;  5HI7 A;  1YU6 C;  1TOT A;  1K7U A;  1S20 A;  1SGD I;  3R5C A;  1UUC A;  2ODD A;  1M8B A;  1K7V A;  2GVI A;  2W0T A;  1Y1C A;  2GKV A;  1CE3 A;  1OMU A;  3TO6 A;  1XX6 A;  2JZM A;  1X74 A;  2NU4 I;  2RC4 A;  2SGD I;  2WCY A;  1FYB A;  2RIJ A;  1BMO A;  1Z2I A;  1SGQ I;  3HH2 C;  2KMO A;  3SEK C;  5J8C A;  2ENZ A;  5FUY A;  2OD1 A;  3TO7 A;  2OZU A;  2V1C A;  1LR9 A;  1U5K A;  1P9G A;  2X52 A;  1CGI I;  2SGF I;  2X3T A;  4WP4 A;  3TO9 A;  1HPT A;  2UZ3 A;  1NXU A;  2NU1 I;  1HDL A;  3R5D A;  4UXH A;  3CXL A;  1Y8F A;  2J9R A;  1TBR R;  1SGY I;  2P6A C;  2GIV A;  2ROW A;  4L9M A;  2QQ0 A;  5HQ8 A;  1WKX A;  1WGT A;  4OVO A;  1H0Z A;  1KBF A;  3OXG A;  2QQE A;  3KY9 A;  4E1R A;  5J8F A;  1R0R I;  1CT4 I;  1XBT A;  2SGP I;  1MT1 A;  2NU0 I;  2YQP A;  3VDU A;  2V1C C;  3SGQ I;  2JYY A;  2BUS A;  1YTP A;  2CJS C;  1MJA A;  2Y0M A;  1PTR A;  3MEK A;  1Y1B A;  1SGP I;  2CWH A;  3VE5 A;  1W3S A;  2DIP A;  2ARP F;  2L8E A;  2N1A B;  2N52 A;  3VDP A;  2GKR I;  5EX3 A;  1PJU A;  3FSX A;  3FC3 A;  3UOE A;  1OVO A;  1MJB A;  1BUS A;  1P9Z A;  2J87 A;  3R5B A;  5DAE A;  1V1H A;  2E5R A;  2WGC A;  2LB7 A;  1CT0 I;  1M8C A;  2CWF A;  2M5X A;  2JA1 A;  1TIH A;  2QQD A;  3OXF A;  4GI3 C;  4AML A;  1WGC A;  2N71 A;  3TJQ A;  1FAQ A;  3OXL A;  1DS2 I;  1PCE A;  1ULN A;  2ELI A;  2F3C I;  2SGE I;  4HGU A;  1ULM A;  5CCM A;  1IY6 A;  2NU3 I;  3OL0 A;  3OVO A;  1PTQ A;  3E59 A;  2A20 A;  1OYV I; 
#chains in the Genus database with same CATH homology
 2K9H A;  3RU0 A;  2ENN A;  2JXD A;  1V1I A;  1CGJ I;  2LEO A;  2XRC A;  1OMT A;  1XA6 A;  5JHW C;  1HJA I;  1TBO A;  2ORW A;  2JW6 A;  3D00 A;  1TGS I;  2ERW A;  4E1P A;  5EX0 A;  3UGI A;  4SGB I;  4UXJ A;  1W4R A;  5FUW A;  2WVJ A;  2NU2 I;  5CCL A;  1LR7 A;  2KMR A;  1LR8 A;  3UEY A;  2GKT I;  4FKD A;  2LUY A;  3QTL D;  1FAR A;  1TUS A;  2VRW B;  3QWP A;  1IY5 A;  3E2I A;  2YUU A;  1PPF I;  2N17 A;  1NUB A;  1CT2 I;  1TUR A;  1TBN A;  1UVG A;  4UXI A;  1UVF A;  2ORV A;  5FUX A;  3UGD A;  1CSO I;  2SGQ I;  2KMQ A;  4B6D A;  2KMP A;  1N13 A;  1RFH A;  3GOX A;  1KBE A;  1TBQ R;  1SGR I;  3UFF A;  1SGE I;  1CHO I;  1IW4 A;  2E73 A;  1Z7K B;  1R79 A;  2QPO A;  5FUV A;  1SGN I;  2FNF X;  3UEJ A;  2DB6 A;  3PDN A;  3UGL A;  1X4S A;  2B8T A;  2L7X A;  4JCV E;  1KMA A;  1AN1 I;  2KCX A;  2QQC A;  4A24 A;  2V53 A;  2B0U C;  3B4V C;  3SGB I;  2OVO A;  1VDD A;  3BJI A;  5HI7 A;  1DS3 I;  1YU6 C;  1TOT A;  1SGD I;  1UUC A;  2ODD A;  1M8B A;  2W0T A;  2GVI A;  1Y1C A;  2GKV A;  1CE3 A;  1OMU A;  1XX6 A;  2JZM A;  1X74 A;  2NU4 I;  2SGD I;  2WCY A;  1FYB A;  1BMO A;  1SGQ I;  3HH2 C;  2KMO A;  3SEK C;  2ENZ A;  5FUY A;  2OD1 A;  2V1C A;  1LR9 A;  1U5K A;  1CGI I;  2SGF I;  1HPT A;  2UZ3 A;  1HDL A;  2NU1 I;  4UXH A;  3CXL A;  1Y8F A;  2J9R A;  1TBR R;  1SGY I;  2P6A C;  2ROW A;  4L9M A;  2QQ0 A;  5HQ8 A;  4OVO A;  1H0Z A;  1KBF A;  3OXG A;  2QQE A;  3KY9 A;  4E1R A;  1R0R I;  1CT4 I;  1XBT A;  2SGP I;  1MT1 A;  2NU0 I;  2YQP A;  3VDU A;  2V1C C;  3SGQ I;  2JYY A;  2BUS A;  1YTP A;  2CJS C;  3MEK A;  1PTR A;  1Y1B A;  1SGP I;  3VE5 A;  1W3S A;  2DIP A;  2ARP F;  2L8E A;  2N1A B;  2N52 A;  3VDP A;  2GKR I;  5EX3 A;  1PJU A;  3FC3 A;  1OVO A;  1BUS A;  5DAE A;  2J87 A;  1V1H A;  2E5R A;  1CT0 I;  1M8C A;  2M5X A;  2QQD A;  2JA1 A;  1TIH A;  3OXF A;  4GI3 C;  2N71 A;  3TJQ A;  1FAQ A;  3OXL A;  1DS2 I;  1PCE A;  2F3C I;  2ELI A;  2SGE I;  5CCM A;  4HGU A;  1IY6 A;  2NU3 I;  3OL0 A;  3OVO A;  1PTQ A;  3E59 A;  2A20 A;  1OYV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...