2ORWA

Thermotoga maritima thymidine kinase 1 like enzyme in complex with tp4a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
171
Chain Sequence
SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKHSTMIVSGVEAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEIDVGGQEKYIAVCRDCYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidine kinase
publication title Binding of ATP to TK1-like Enzymes Is Associated with a Conformational Change in the Quaternary Structure.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 55
structure length 171
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2orwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2orwA01
1D5CA 5TVKA 2J1LA 2G9NA 1JB1A 3PVSA 4XWKA 3MMPA 3QXJA 2UKDA 1GZSA 1PTQA 3VNVA 3A37A 4EPWA 1P3JA 4RKEA 4NCJA 2WSMA 221PA 2CE7A 1QDEA 3MG9A 3TQCA 3B8HA 4NBSA 3KFXA 4HDCA 4TL9A 2FN4A 4OHVA 3LBIA 4TN1A 2MSCB 4DT1B 2IBMA 3NBXX 4F4JA 4LK2A 4MQBA 4TLAA 1S0UA 5KYKA 3LLMA 4PZLA 1OXTA 2QP3A 1R2QA 1TMKA 1JNYA 3ZD7A 1J8MF 2RH5A 2Q6TA 4GDFA 3CF0A 1KI7A 2HEIA 3FKQA 2DFKB 5CM8B 3OE7A 4Q7MB 3CH5A 5TV2A 1EFCA 5IF9A 1OF1A 2GVIA 4Q4JA 1EWRA 5JI2E 1JEDA 1F6BA 2C9OA 3BB1A 4OKSA 4TQUS 4TMXA 1W0KD 3KDSE 1US8B 1HTWA 1E9BA 1Z6TA 2OILA 3EZFA 4MYHA 3UG7A 1JALA 1P7CA 1FFHA 2V6JA 4D80A 2NTYC 1PTRA 2DWPA 2H18A 4B75A 1L4UA 2YINC 1W4RA 4L9SA 2O8BB 5K8TA 3BRWD 3VNUA 2QZ4A 1FW6A 4QL3A 3THYA 1P61B 1XTSA 4B47A 1MRNA 1D8TA 2VHUA 1N25A 1SXJE 4RVCA 3AVUA 4OK5A 2YNMA 3I72A 2JLUA 2CNWA 3QPWA 2VSOA 2HF9A 1ESNA 1ZYUA 2XXAA 3SQXA 1W44A 3B1WA 3JZMA 1NBME 1NLFA 1QBKC 2ZSEA 2ZYVX 1UDWA 3HU1A 3KUCA 4XVQA 1H8ED 5EXTA 2JLSA 3FB4A 1RJ9A 1E9RA 2ERXA 3EIHA 3KJIA 3PV0A 1NIJA 2LKDA 4MYUA 1W2HA 1GKIA 4QBFA 2CVHA 3ZLJA 2QAGA 1F5NA 2J0SA 4CEHA 1P9NA 3MJHA 4FKDA 3AF1A 1X8LA 2GAAA 1W4BA 3U61B 4RD2A 2O8CA 2H17A 1VMAA 3E2IA 2ZETA 3QIAA 4RY2A 2JASA 4HLUC 5DI3A 3NHBA 5EP2A 1G5RA 5DN6A 5KUTA 4OHXA 2IWRA 2VP0A 4EUNA 3VR6A 3U3MA 2J7KA 1CR2A 1COWA 1DS6A 1FX0B 4WXPA 1J99A 2HV8A 2IYZA 3Q7PA 2AXPA 5L3QB 5FTNA 3MAAC 1OXXK 2WJGA 3CW2A 3NKVA 5EE9A 1Z6XA 3WBKA 3O8CA 2IS1A 2A5JA 1XTIA 3B78A 1G3IA 2C5LA 1TADA 3OF5A 3W6OA 3G0HA 4DXAA 3Q3JB 1D2EA 2JJ8A 1C4OA 1QZXA 3BIFA 2KJQA 5FTMA 2WWGA 1AKEA 3A4NA 1CJTC 3O8RA 3HU3A 1CU1A 2QQEA 2VP6A 4JVMA 3WP0A 4AKIA 4H1UA 2KBEA 2L0XA 4C30A 3RANA 3QBTA 3MSXA 4A0FA 4ZI3A 4KI0A 2YV5A 5FUVA 2VTKA 3PUYA 4M1YA 2CCJA 1YHNA 2QROA 5DSZA 3PJRA 2DB3A 1T0JB 2N46A 5AUNB 1KY2A 5KHOC 2VLIA 1KI6B 2V55B 3I4LA 3NH6A 1E32A 5AUOB 3OFND 1KMHA 4M1TA 4XJXA 2GNOA 4QHYA 1IXZA 2V54A 1OIVA 2BKEA 4ARZB 4TYYA 4IEIA 1XEWY 1XXHB 4OK6A 5FI0B 3K0CC 4JLKA 2QN6A 5SZIA 3CR7A 2VHQA 2W2VA 3WYGA 2GCPA 2QY9A 3A6PC 3LWNA 2REOA 4JLDA 5FR1A 1U8YA 1E2KA 4TYWA 3FMOB 2V3CC 2P5TB 4ZDKA 2OO7A 1HYQA 3I62A 4BFZA 2QUZA 1RYFA 5JS8A 3T34A 4WXRA 3GLIB 3RWOA 4ZCLA 3KXKA 4A8JC 4W9MC 3B7GA 1G6OA 2CJWB 3SHWA 4PSVA 1T5IA 3VX3A 3ASZA 2PMDA 3CR8A 3OZXA 1W49A 2RGCA 1A4RA 4LV6A 4QGHA 4Q9JA 4N0DA 4TMVA 2P2LA 1DAIA 2Q0HA 5L3SA 3VKHA 1ZINA 2WWXA 1R5BA 4YMTA 3UANA 2IXGA 1DE0A 4BZXA 1Q3TA 5AUQA 2F3TA 2XJ9A 4N1AA 3JVUA 2Z4SA 3RLFA 1W36C 4C7OA 2ENNA 2ODNA 3CX6A 4G3XA 2QI9C 2UZ3A 3AVVA 2HXSA 3EXAA 3AVYA 3NIBA 4X8HA 1KI4A 3AF2A 1J8YF 1P2UA 3FKSD 5G3YA 2X77A 2HJGA 1GNQA 5HKKA 2P67A 5GADl 3ADDA 3AB3A 5H1YA 4QC2A 1U90A 4Z51A 5JSZA 4NU0A 3P4XA 1UBGA 3UMRA 3W3ZB 1DVRA 1HQYE 1H65A 2ZRGA 3PG5A 3UIEA 3CNLA 4BFTA 4B6EA 1E9CA 4CEIA 2O8EA 4PAOA 1Z22A 2H57A 1K6MA 4PPFA 1G8FA 5B30A 1N6PA 2ZRBA 3K09C 3IEVA 1TF2A 3U3OA 1FARA 4HLQB 2ZUDA 1UJ2A 1Q22A 1KZ7B 3GEHA 3HWSA 5TMPA 1SVMA 3K0AB 2ODWA 3ETLA 1II9A 1KNQA 5HZHA 1OHHD 4ESVA 2GZAA 3VFDA 2ZR9A 2JEOA 1TEXA 2ZRDA 4CEJA 2X2FA 4JJKA 1VCNA 1JJVA 1ZBDA 2GEVA 4XVRA 2AD1A 5EE5B 1G8HA 2Y8EA 4ESHA 2WWHA 5HTKA 1N0UA 5KTYA 2XTNA 4BFSA 4LJ4A 5BN4A 3TAHA 2GVZC 3OE7D 4YC7A 2ZRNA 2PH1A 1HY3A 2AR7A 5CJPA 1Q21A 3ZZTA 1P6XA 1VHTA 2WKRA 3F3YA 4Q01A 2J0UA 1KO4A 2FGKA 2GXSA 3EIEA 1QHHA 3FGNA 1Q44A 1E2LA 1QHIA 2GTPA 3KFVA 1AZTA 1WCV1 1M7BA 4DEXA 4M22A 1IN4A 1XZQA 1M34E 2AK2A 2WVJA 5FR2A 2DFLA 2C95A 4BWYA 4JT2A 3BB3A 2GEUA 4GPTA 4Q4AB 3WNCA 4RD6A 1G41A 4URYR 2QAGC 3THWB 2ELIA 2A78A 2W6JA 2OT3B 4B73A 1JR3A 2QSZA 1ODFA 3KB2A 4FD2A 4LOAA 3A8TA 3HR8A 5FOUA 1KDOA 1I2DA 3HU2A 3KZ1E 2F9LA 3HJNA 1S9HA 1U98A 3B82A 5EE0A 5GVSA 4V0ME 5JBQA 1N5IA 1KSFX 2GJ9A 3AP1A 3K9GA 4QOSA 2A5FA 3GJ7A 3U2QA 2FSIA 2IUUA 2O8FA 3RSLA 3Q5EA 1E2PA 1FMJA 1X8JA 4E03A 4XOIA 4Q5IA 521PA 3MWJA 3OEED 2G6BA 2ORVA 2A7QA 3I73A 2EWVA 3THXB 4TMKA 4A0HA 4YXWD 1WA5A 3MJRA 2GJKA 2CHGA 4XVUA 3UKDA 3NXSA 4PHHA 1UBCA 2ZI3A 4DLYA 1Z0FA 1U9IC 3B1VA 1KJYA 4DSTA 5B2ZA 5FPYA 1F60A 4LC1A 2QBYA 2BEKA 4HDQB 4M1OA 1OPXA 2C99A 2XX3A 3DL0A 2QEQA 1LFDB 1IN8A 2C03A 3K1JA 1KI6A 4KU4A 1Z6GA 4RFSB 5DN6D 3IHWA 1H8HA 4MKGA 1COWD 1U8ZA 3MWLA 3GLHA 2QE7A 1NLYA 3T1OA 5JHHB 3EC1A 5J47A 1P72A 4I1VA 1CR4A 2BC9A 4UNQA 2QG6A 3D8BA 4G5SA 4LCBA 3ZVNA 4HLCA 3LH5A 2QTVB 2B92A 3LVRE 4U5XA 2WTUA 1BKDR 5LD2C 2J3EA 3DM9B 2RGXA 4CRWB 4NPHA 2HJVA 4B3DA 1W7AA 4R2HA 3P1JA 1VG8A 4ITRC 4OQMA 1R7RA 4DCVA 4EQ6A 2QPOA 2EFHB 4Q1DA 4WOPA 1Q1ZA 2RGAA 1CRPA 1NI3A 1C9KA 3RRNA 5LBIA 1EFUA 2E9SA 4HAVA 4NYJQ 1TU4A 4MRRA 3U3JA 3SR0A 1RC8A 4U00A 4JL6A 1JPJA 2HXYA 1ZUHA 1L2TA 2R6FA 3K53A 4B76A 2JIZA 3EPKA 1WBBA 2IS6A 2NIPA 1DPFA 4JBWA 1ZUNB 4O25A 121PA 1AM4D 1GITA 2OCYC 3A1UA 3M4YA 4MRPA 3SQWA 3CX8A 1RFHA 1S9DA 4YMVA 1II0A 4Q00A 2P65A 3AV0B 5AR1A 2WMOB 3JVVA 4DIEA 2ZTSA 1G3QA 2IYRA 2YVUA 3X1XA 1AN0A 2G0NA 4FINA 1E9SA 2AKAB 2ANBA 5AJZA 4KLNA 4WZAE 3HYRA 2JDID 4WIAA 4PAMA 3K70D 1LB1B 1OB5A 3AVWA 2RMKA 3Q85A 1KNXA 4UXIA 4LI0A 4W7SA 1NY5A 5CB8A 2GCOB 1GG2A 1AS2A 3K8YA 3HP1A 2F43A 3N2EA 4XSHA 3KTAA 5ANRB 1VG0B 4Q19A 2FU5C 4LGMA 1KI8A 4V03A 1EFRD 4V0LA 3ZH9B 1G1MA 3BD9A 2D2FA 3SHFA 3FWYA 4W5HA 1PZNA 4FIDA 3ZYCA 5BW8A 4B6FA 3KXLA 3T06B 1N2CE 3ZQ6A 4D6PA 3U44A 3GLFA 3AM1A 3QKSB 3VAAA 4RCZA 3BFKA 4KVGA 1KOFA 5D3MA 1BIFA 3TUJC 2CEAA 5CDFA 3B2EA 1SHKA 4LYHA 4PANA 4WW0A 4EPYA 3L0IB 4RD3A 4GMXA 2V4ZA 1XNJA 4DHEA 3UGIA 4RSGA 1YKSA 1XD2A 2XTZA 4NYMR 3ZVRA 3EC2A 1F2UA 1NRJB 1SXJA 1W46A 3KX2A 3VU9A 1OFUX 1V43A 1E2QA 1FTSA 4GL2A 4YDHB 1N5JA 3ZZ0A 1KDPA 4NP6A 4F38A 4D25A 4S35A 4O0MA 1NVVQ 4F92B 4IFEA 3K9HA 3C5HA 5IHPA 4JLNA 4QBGB 4PPGA 5LPNA 3A1SA 2PX0A 2H5EA 4LX0A 1DO2A 1ZNZA 2Q9BA 3QPUA 4C3ZA 2OEPA 3FE2A 3LW8A 4EPVA 4B6DA 1AS3A 4Q7KA 5HE9A 4A2QA 4AK9A 5E7MA 2R44A 1YZNA 1U94A 2ZSDA 2IYLD 2WWWA 3M6AA 1GRNA 1Q12A 2IA5A 3CRW1 3KKOA 5F9FA 3K9LA 1C1YA 2QMOA 3CUEF 2PLRA 4DLUA 4FXPA 4IDHA 3KKMA 2J46A 4JYBA 4PO8A 4Q4HA 1K8RA 1E1RA 1N6NA 5HZKA 1IY2A 3OEHA 3THWA 1N0WA 2KB0A 5F9HA 1ZJ6A 2I4IA 1MABB 4NMMA 2ZJYA 5JEDA 4LJ5A 2XEXA 2B7BA 3P20A 2NG1A 3GP8A 1YR8A 3QF4B 3FMIA 1NIPA 3PEUA 4IFBA 4P4SA 4A4DA 4R7ZA 3T1QA 2D62A 2REBA 3FHOA 4JZKA 3W8NA 4HLUA 3TSOA 2BDTA 1G17A 2IXFA 2KSQA 3OIUA 2J7PD 1SVSA 2BV3A 2J41A 4L9MA 1JECA 1E2NA 1KBFA 1GOTA 1NMYA 4KFUA 4KBGA 1G8PA 1SVLA 2ZJAA 2R9VA 3QXSA 4KYIB 4TTQA 1PJRA 5FBVB 2OAQ1 2IYYA 2QMUA 4II7A 4S2EA 3DKVA 1Z0KA 2PMKA 3TW8B 1QHXA 2GBLC 1IM2A 2Q9CA 3ZJYA 3BOSA 3KY9A 3X1WA 3ZIAD 3I32A 2E87A 3IIMA 4A82A 3AVQA 4Q1BA 2W6JD 4QHSA 4HZIA 1G20E 2ENZA 2C9YA 3GJ0A 4Q7LA 5B57C 4FMDB 4OJKA 1AGPA 5L3VA 4ZI2A 4QJ5A 4H1VA 2FZ4A 4TSFD 4OQNA 4JL5A 1G4UR 1ZW6A 1Z5ZA 2OFWA 5L3RA 1NMXA 3K0FA 3CO5A 4G5OA 3C7KA 4JKYA 4LBYA 3RAPR 4HUTA 3WMGA 1NVUQ 3IQXA 1A1VA 1N6IA 2D4HA 1UFQA 2VSFA 1QVRA 1YU9A 3C41J 2WPDA 4D4KA 5J4YA 1XTRA 1GNPA 3BS4A 3SDZA 2ERYA 4K81B 3ND9A 3TAUA 1E2EA 1Q3HA 1XP8A 3BK7A 3OIWA 3I61A 4UXJA 4AC9A 1X8KA 2ATXA 2BCGY 3DMNA 1NN3A 1M7GA 4DLTA 2Z43A 5J40A 1E0JA 2A5GA 4MRVA 2DY1A 3K0CA 4IHQA 2PZGA 4RD1A 3KJEA 3TLXA 4RD4A 4Z1MD 2QAJA 2CCKA 4PC2A 4CIDA 2CK3D 5FPKA 1GUAA 1Y3AA 1WRBA 2IYUA 3GLGA 5E7JA 1P2TA 3LXXA 3S1AA 4D0LB 4URXR 3AP2A 2VHCA 1DAKA 1H8HD 5EXPA 3WRYC 2FA9A 2QE7D 3FHCB 4MA4A 4RZ2A 3SN6A 2CDNA 1G291 1XDBA 2GJSA 2RHMA 3X1DA 3NH9A 2B8TA 3QVUA 3SBEA 4RD0A 4V0KA 3Q9LA 1E94E 4TMWA 3RDPA 4OI2A 1LVGA 4E22A 4UNSA 4ZKDA 3LDAA 4D4LA 5EE3A 5IK2D 2IW3A 4YMWA 4B2IA 4DVGA 5GJCA 2AXNA 2FPLA 3M0EA 4QM6A 2AD5A 4E09A 3K70B 1NMZA 5AK0A 3WP1B 1IQPA 3KQKA 2NO7A 1YQTA 4MGYR 1Z2CA 5EUMA 3LA6A 4LJAA 1UF9A 2HF8A 4QGGA 1XTKA 1A82A 4TLDA 3LX5A 3AF3A 5J4KA 2WIAA 4DUGA 3BXZA 3GEIA 1G19A 2ZRLA 2DB6A 1E9AA 1Z28A 5AJXA 3RC8A 2R62A 1ZIOA 2FGJA 4A6PA 5KO2A 5J5CA 4Q1CA 3CRRA 3W6PA 1Z08A 2D7CA 4URVR 3TQFA 3U60B 1IN5A 1SGWA 1KO5A 1V5WA 3AH8A 3K0EA 4B2PA 4OJQA 4EAQA 4WZBE 1XBTA 3D3QA 5DO9A 1E0KA 1E4VA 3QI2A 1AS0A 1ZNWA 4B3GA 4GI7A 3T5DA 1XPRA 3K09A 5JFGA 1KDRA 1KI3A 3ASYA 2ZJ5A 3I3SR 5H68A 3NBZC 3TBKA 4BEJA 3L43A 2ZXUA 2EYUA 2QENA 3TE6A 5KPDA 1GM5A 3RS4A 1W2GA 2WAXA 3SOPA 3KKNA 5C46F 4W5JA 4TWZA 2GJAA 1KGDA 3FMPB 3TGPA 1Z83A 4C9BA 1Q0UA 4HI0E 5TXGA 3CNNA 3RS0A 1SXJC 4A92A 4POAA 1F2TA 5KU1A 5E7IA 1CEEA 1WF3A 4NONA 1EXMA 2ZE8A 2IWHA 1TQDA 1W0JD 1XEWX 2VP2A 4FMDF 2QNRA 1EGAA 2GEDA 2DR3A 4IVQA 3N70A 2CHQA 2O52A 3NBYC 1LF0A 2RCNA 1CIPA 4IXMA 4D26A 1IJFA 5KOYA 1W4CA 2H92A 4LJYA 3QUSA 5G53C 2PBRA 3ZZUA 4WAUA 1XMIA 1TPZA 1ZCAA 3EG5A 3EASA 3Q8XB 1N6HA 1IXRC 3EZ7A 3TRFA 3SJZA 3CF2A 3DO6A 1R10A 2ZVPX 4FN5A 1SVWA 1SVKA 4M1SA 3IO5A 4TT3A 4HUQB 3BFXA 1IAQA 4BEBA 3CPEA 5E3HA 1FAQA 2G88A 3BC1A 1MO3A 1TQ4A 4AY2A 2YUUA 2FWRA 3RRZA 3L2OB 2VQSA 3FTQA 2GA8A 4A6XA 1S3GA 3UK6A 1Z6AA 5AWFC 1G64A 4CGZA 4ZO4A 2ZAOA 2W6IA 2HCJB 3R20A 3LAWA 2ZJBA 5TDHA 3GEEA 5BXQC 3V9PA 1OH5A 3B60A 5GJBA 3RRMA 1XEFA 1JEEA 2WV9A 3U7EB 5CLLA 4V02A 2O8DB 3PEYA 4NDZA 4ZDJA 1JJ7A 5DISB 1LV7A 1UM8A 5EP1A 1EWQA 4OYHA 1LTQA 4NCIA 3T61A 3UFFA 4H9GA 3BFVA 4MYCA 3C15C 2F1IA 2IS4A 4QGFA 3KXIA 1G7RA 4P0TA 2OUKA 3R9XA 2OCAA 4L9WA 2ZS8A 2GK7A 4JLPA 4M9QA 1XJCA 3UPUA 4AKHA 1P2VA 1VIYA 1NP6A 2AWNA 3KJGA 4D82A 3SEAA 1U9IA 4M9XA 4TYPA 5DE3A 3Q7QA 2ROWA 2NO9A 3DM5A 2AFHE 4KAXA 1N5LA 1OT3A 4JSYA 4D2IA 2Q9AA 2REXB 4GOKA 3PIRA 2F3RA 1FNMA 3F8TA 1EK0A 1SZPA 2D2EA 2JJ2D 5G3ZA 1KHTA 3BJIA 4MUAA 4B32A 3AKDA 3CPJB 2WJIA 4Q9LA 2QPTA 4ASUA 4M9ZA 4ON9A 3EIQA 2G77B 4HB2A 4BLOA 2W00A 2C04A 3DHWC 4DCNA 3CM0A 2QORA 4JT4A 4LPSA 2NMVA 3U7FB 2IHYA 4N3NA 3L82B 3BH0A 2JJ1D 2VF8A 3PUXA 3GJ6A 5KNDA 1N0VC 2R2AA 3SZRA 3AVXA 1XMSA 4Q1AA 4HAWA 2ZI4A 1KBEA 4L16A 2XNDA 2QRZA 3TMKA 3VX4A 4LJ9A 2R8RA 1JQJC 2FE4A 2VA8A 2PT7A 5JJKA 1XU4A 1MOZA 2BJVA 4Q02A 4Z8XA 4NHOA 4PO9A 1F48A 2HUPA 1T3HA 3ICQB 2JLRA 1YR7A 4PR0A 1FQJA 4EPTA 3EPLA 1TF5A 4BLSA 5FOTA 4US2R 4PC3A 4HAYA 2GDJA 4G5RA 2WSSA 2HCBA 3V4RA 3L0SA 4JLOA 2AFIE 2CE2X 3A36A 4F91B 1CF4A 4TMTA 1YZGA 4B33A 1OSNA 1ZIPA 4I81A 3CRQA 1FMLA 1WQ1R 2JATA 2NPIA 3CB4A 5KNCA 2OLKA 4TTPA 3RYTC 5BN3A 1LF5A 4XD7D 3UWOA 1KO1A 3GMTA 2YHSA 3QKRB 2BBSA 1D2NA 3QSYA 4F4CA 3PENA 1E1QA 1OH8A 4PSAA 3UMFA 5JWHA 4GNKA 2DYKA 3IPYA 2IYTA 4Q9HA 4EIWA 3CNOA 2ZRJA 4TYNA 5CM9C 1MV5A 4DT1A 3QENA 5GJVC 1EX6A 1AGRA 1D2MA 1P4SA 2VO1A 4JS0A 5KSPA 3AP3A 1JAIA 1QVAA 1EG7A 3EWSA 4JVLA 1BS1A 1N3BA 2CLSA 2WM9B 1NSTA 3L8ZA 1KZGB 4PC7A 4C0HA 4F4IA 4YMUA 3RC3A 4DRZA 5JS7A 3ZVMA 1QHSA 4JJZA 3TSWA 2FJUA 2XSZA 4MDEA 1JPNA 1OXSC 4N0EA 4PSKA 1VECA 1I4LD 4EDHA 1TUEA 5CK5A 2EU8A 5IRCD 3FDIA 2P6NA 3B1XA 4C2TA 4ZCMA 1DAHA 3LBNA 2FNAA 4QKQA 4O2LA 4GZLA 2BHRA 2ZI9A 3U4QB 2VRWB 1CJVC 1WP9A 4DDUA 1ZU4A 2NGRA 1US8A 4LHXA 1HE1C 3OAAA 1G7TA 2JLYA 1GKYA 3C4JA 1NY6A 1KK2A 1T5LA 1W5SA 2B8WA 2ZJ8A 4FW9A 3QG5A 4L5BA 3PUWA 5FTLA 1A2KC 2AL7A 1GWNA 2O8BA 2ZSFA 4JLJA 4TTRA 4AKEA 1RIFA 1EFHA 4B34A 4DLZA 2V7QA 5F3WB 1TL7C 3IGFA 4OHYA 1CJKC 4EJSB 3ADKA 1AQUA 1BO6A 4AWXA 4ILEA 3B85A 3VTKA 4ZV4A 4BGDA 4F93B 4IDNA 2YC4C 1IXSB 3ZDQA 2QT0A 4TLCA 1OLOA 1IN6A 1B0UA 3UEJA 4Z8YA 3AKCA 5JMTA 1E2GA 4TMZA 5EP4A 1XD8A 3HPQA 4B43A 5FUXA 4HEJA 4B2LA 1W1WA 3GCGA 4G5QA 2PEYA 1YR9A 2IF2A 2JLZA 2PX3A 3KL4A 1AK2A 1MO6A 2N42A 5FPHA 2ZRKA 3G82C 2G1JA 1R0WA 4CVNA 1CR0A 2GXQA 3KKQA 2F55A 1CRQA 4QBIA 1R0XA 3CRVA 1BMFA 4KO8A 3UG6A 2P0EA 3E1SA 1JAHA 2G3YA 2XJ4A 3ZD6A 1BH2A 3MRSA 2CNWD 3P27A 1OIXA 2CHVA 4L8GA 2MMGA 1FX0A 3C5CA 5E4FA 3NWJA 4P4TA 3PQCA 2ZRIA 3P26A 4KLZA 5L3QA 1CR1A 4JVNA 2HT6A 5HPYB 2CL6X 4PHGA 2DBYA 1S3SA 3EWAA 3R9WA 1P75A 1G5TA 2GBLA 2ZS7A 4M8NE 4US1R 5FUWA 3R7WA 3QVVA 4M21A 3WXMA 3CPHA 1VYTA 1HV8A 4LC0A 3I5XA 2ZI5A 1RW4A 4E07A 2GZDA 2DFNA 1PLKA 4OQFA 1FNNA 1U0JA 2XZPA 2D74A 5EP3A 3TVDA 3NTUA 1J7KA 2AHOA 2XGJA 3C16C 2O0HA 2YKGA 2ZS9A 4D0GA 1KJZA 1W5TA 1E9FA 2XZLA 1AA9A 1Z29A 2Z4RA 1U0HC 4JL8A 2XITA 3T1VA 6Q21A 3BJIC 2JLWA 1ZMXA 1UKVY 2FV8A 5JECA 1E2DA 3QXXA 4ARZA 3RWMB 2ZSBA 1OKKA 1YZKA 1XXHA 1CLUA 1G4AE 1GL7A 4HZUB 2ODBA 4NYIQ 3N5CA 2RAPA 1X3SA 4Q1FA 5LDDC 4W5WA 4PPQA 2FEOA 4EFMA 1VHLA 4DEYA 4GOXA 2ZQ5A 5FTKA 1AQYA 2HLDA 2QMHA 2QTHA 4YONB 3TUIC 5JZVA 2PL3A 4MGKR 5H8WA 4BQSA 4FWTA 4P4UA 1PLJA 1XEXB 2B7CA 1G21E 1Z47A 2Q3HA 3MD0A 4Q9IA 3GLIA 5KNBA 3QXCA 3I8SA 3FMFA 1XF9A 2CJWA 1ZP6A 5FBQB 2ZU6A 4IEEA 4LBVA 2YOFA 1LY1A 3NC1C 2IYWA 1U8AA 4JLBA 2ECKA 4HAUA 3D7MA 4CT4B 4XWAA 3REFA 1GKUB 3DZDA 1XTQA 2OBMA 1IN7A 1G7CA 1UKEA 1R6BX 2EYQA 4IW3B 5FBRB 4AURA 4NCHA 1E98A 1I4DD 4ZIRB 3N2IA 3HYTA 4P32A 5BQ5A 1DBSA 2CVFA 2WJHA 3CF6R 4CDGA 2JLXA 1KSGA 1FL9A 2FH5B 4A8JB 1NKTA 2XNDD 4ERNA 4UJ3A 3SFZA 1ZM4A 4DSNA 2CLCX 3WNBA 3FOZA 4PHFA 3MFYA 4CYMA 4I4LA 4PX9A 3R8FA 4KFSA 2GAOA 4UXHA 4Q1EA 4LV8B 1OFTA 5FBWB 1NN0A 2QMEA 4HAZA 5A5GA 4LDJA 1P60A 1T0HB 1OB2A 1OXVA 2IEZA 4C0AC 1XPUA 4DB2A 3CH4B 2NZJA 2QPAA 4PC6A 4DZZA 3R8CA 1XTJA 2BWJA 4WA7A 4B3XA 2IC5A 2ZITA 1DOAA 2R6CA 2ZM5A 1ZAKA 1QG4A 1ZM9A 1TBNA 1QHYA 3ZVLA 1NJGA 5TY0A 2ZRMA 2HYDA 2Q3MA 4IVRA 2KBFA 4UNRA 1S96A 1Q1BA 1ZCBA 1KK3A 2GETA 2ZROA 3MGCA 3FHTA 1MKYA 3UGDA 4DLRA 4Q03A 1UEJA 4LRWA 1W0KA 3K0AA 3U3KA 5HKKD 1OH6A 4AYWA 4JKIA 3AQ4A 4HAXA 4Y0VA 5KDDA 2FSGA 3PCRB 5SZHB 1NNEA 2QM7A 4IDPA 4LY6A 2BIFA 2BM0A 3IUYA 2EWWA 2J5XA 4GT1A 3WYFA 5J4LA 1W47A 2XB4A 3U7HB 3E5HA 2V6IA 1NBMA 2RGEA 1NVWQ 1CBUA 2VIIA 4IOLA 2C77A 1DO0A 3PITA 4QGAA 2BBWA 1VCIA 4LHWA 2IX3A 4TYQA 4PC1A 3BWDD 1EESA 2IUSA 2H16A 2AKYA 5FL7A 5M04A 4C0JA 1U99A 2ORIA 2OZEA 3QE0A 1DG3A 4X8MA 4TQAA 4Q4JB 2GCNA 2I1VB 3LQRA 1WMSA 4UQOA 4QFMA 3W34A 4KSBA 3BERA 3I8XA 3IIKA 1D9XA 1H8EA 4C0BA 2ZE6A 4PO1A 2GXUA 3W90A 1L4YA 3OAAD 2OV2A 4Q7JB 4TZ6A 5SZKB 4NKRA 1XA6A 1Z0DA 2D3WA 5DHAA 4AYTA 1E2MA 4ACAA 2ZJZA 2E73A 2VH5R 4Q4AA 2IHBA 3FYHA 3B5JA 4GFDA 3LD9A 4MKHA 4YQFA 1OJLA 1TF7A 2VP5A 3NEYA 5AJWA 1M8PA 4Z54A 3THYB 4DBLC 3SYKA 1OV4A 4KSCA 1YZTA 3GFOA 2XXAB 4MRNA 1SKYE 4DIDA 2ZRPA 1N6OA 4P31A 4QNMA 1KMQA 2OHFA 3B1YA 4HB0A 2BJWA 3PUZA 5EZ6B 1RJ9B 1KI1A 4BZPA 1YZQA 5K8IA 5C4MA 1R0YA 3THXA 1G18A 3PR1A 3TJZA 4URZR 2BMJA 3VQTA 4DB4A 4UNNA 4AKGA 2QAGB 2RGNC 1RYHA 4CEHB 3WNDA 1JXMA 4LJ6A 2Q21A 4M4SA 2WWIA 1JQLB 2O8CB 1KSJA 3R9IA 2A5YB 5H70A 3B1ZA 1S4QA 4DLWA 4LYJA 1JR3D 2CL0X 4QXAA 4BECA 3RS3A 4OI0A 1O3YA 5DI3B 1E69A 3T5GA 1GDDA 4RFSA 2YWFA 1ZVQA 1KIMA 2UVQA 4LUCA 2OXRA 3IKJA 3WBJA 2D7DA 1KSHA 2W2TA 1QRAA 3GJ8A 1FP6A 4JLAA 4DDWA 1XMVA 3TVTA 5HE8A 3U3RA 3H0KA 1E3MA 3VHLB 4GP7A 3CRMA 2YC2C 1VIAA 3AF0A 2ZPTX 2PT5A 5K8LA 2H1LA 1G16A 2VP4A 2ORWA 3BH7A 8OHMA 4GOJA 4FCWA 1SVIA 2YJTD 4LZZA 4LWZA 4RZXA 4B44A 3TNFA 5FI1B 2ZU0C 1GP2A 4B3FX 3CIOA 3I92A 5FOSA 4E5UA 1T3LA 3SJCA 2YWHA 1TEVA 2ZREA 4IRUB 3KUDA 4O2RA 1Z8FA 3ADBA 2ZRAA 4X8OA 2ZRFA 4ZKEA 4DKXA 2FSHA 3QBVA 2AWOA 4I99A 3WHKA 1RVDA 3DMDA 1M1YE 1UDXA 3D6TB 3RSOA 4NYJR 1KMHB 4RJLA 3CZQA 1ZM2A 4OI1A 4ZDIA 1DG1G 4BLTA 5F98A 3KKPA 3X1YA 4D81A 2FNFX 2C78A 1MR3F 2X2EA 3LY5A 2NO0A 4IOKA 3VMFA 2YOHA 1TQ6A 3NHAA 4YLGA 2QA5A 5FPTA 2AX4A 2WJYA 1IY0A 3JZAA 2K5UA 4BE7B 1T6NA 4F7WA 1YE8A 3X1ZA 4AYXA 3QY0A 2WIBA 3V4FA 2GZHA 3GLHE 2PZEA 421PA 1Z2AA 1UEIA 2ZUCA 4IXNA 2IXEA 4QNRA 2P6RA 4IOJA 2GCOA 5CK4A 3PFIA 4DCTA 2AK3A 1P2SA 1E6CA 1F3OA 1JR6A 3TR5A 3T1TA 4IDOA 4CT5A 2Z6VA 2JIZD 1XJQA 4OHWA 3H2YA 1KKMA 1E99A 3VKGA 2G0TA 4I1SA 3CWZA 5F2EA 3IIJA 3TH5A 5CITA 2J9RA 5FH9A 3A4MA 1HE8B 4BLPA 5J4VA 3C8UA 1ZUIA 4C2UA 3RS2A 5L3SB 2R6DA 4BRWA 5JJLA 1T4GA 5J4HA 1Q1QA 4YMSA 2EFDB 1CJUC 3QKSA 1WBDA 3AF4A 2RGDA 4R71A 1E2FA 1FUKA 2F1HA 3A4LA 4DSOA 2FFHA 2NZ8A 2WJJA 3DEFA 4C7OB 2JAQA 2RGBA 4KV9A 2J59A 4NTZA 2WWYA 2RHDA 1U0LA 3O8DA 1PV4A 3AGPA 3BAFA 2RB4A 4QBHA 2C98A 2LCFA 3MUFA 1RRPA 1B23P 3OIVA 2FSFA 4P3YA 4BFUA 5TB5A 2OBLA 4JBYA 1ESMA 1ONBA 2KWIA 1IBRA 2OG2A 3BE4A 3THOA 2QL6A 1A5TA 3GD7A 4NZYA 2LWIA 1OHHA 5JSZB 2BEJA 1R5OA 2ZR0A 3Q5DA 2OSBA 4HYYA 2YWEA 4PHTA 3KQNA 4C0SA 4CEIB 2O8EB 1RE0A 5EZ5A 1HUQA 1T8TA 2BBOA 4R98A 5AJVB 4TL8A 3BH6A 5EXXA 5HCIA 2KE5A 3RS5A 1NVVR 2PCJA 3TR0A 1CS4C 4NH0A 1Q57A 3KQLA 3SC3A 1QHGA 4PQFA 3NVAA 2J0VA 4EJSC 5L8VA 4M9SA 1Q20A 2V1UA 4C4PA 4LPKA 3ND8A 1E9EA 5B58C 3GLFE 4QHTA 5EXSA 2FZLA 2IT1A 2QSYA 4KYUA 2IF0A 4BLRA 1GAJA 4Q9KA 1SXJD 5CDFE 5FFMA 1I4TD 3W3AA 4V0MA 4CEJB 3ONWA 1SKYB 1T8UA 1MABA 1NBMD 4PXAA 1VPLA 2ZI6A 4EKDA 1L8QA 1HURA 1VTKA 3QF7A 1NLZA 1W4AA 3EPHA 1TU3A 3QF4A 3IPXA 4DWJA 2YOGA 2FDCA 2GRJA 4MYTA 2QP4A 5DH9A 5FL7D 3T15A 2F6RA 2XTMA 1OH7A 1TBOA 3FVQA 4K8OA 4OBEA 3IO3A 1XB2A 1P9WA 1TUIA 1OE0A 2J0UB 2MMCA 4HATA 2ATVA 1QHHB 1VG1A 5FBLB 1N5KA 1XPOA 4BLQA 1QF9A 4LJ7A 1SULA 2OE2A 3OEEA 2FMXA 2FEMA 4PZYA 3WMEA 4YXWA 1E1RD 2H7VA 5DLQC 3QG1A 3LXRA 3OEHD 4ZCIA 2XNSA 1L7VC 3UMSA 3IHLA 4PTLA 3SE0A 1CKEA 3SJBA 1P73A 3V00A 4LYAA 2B6HA 5EQTA 3MWYW 1XCMA 4FCVA 3K0SA 5G41A 4AG6A 1DAFA 3P32A 4B3BA 3RRYA 1IOZA 4LHVA 5KSZA 5EUQB 1DADA 1PLLA 5FL3A 5CB6A 1KAOA 1GTVA 2W83A 3DDCA 4GP6A 3SNHA 4ABYA 4OI4A 3E70C 4B74A 2XB2A 2ZYUX 2QRNA 2Z0MA 3EZ2A 2J0QA 4TLEA 5HCNA 2GVDC 2O8FB 3L8YA 2WOJA 3LW7A 2WKQA 1GNRA 2V8OA 1RZ3A 1KJWA 4AG5A 5CYOA 4OQLA 2VBCA 2P5SA 4MGZR 4Q66C 2P3SA 2ONKA 4LHZA 3VKWA 5SZJA 2VEDA 4AD8A 4LHYA 2QGNA 4R2IA 821PA 4JLMA 1GRQA 2QGZA 2QBYB 2BVNA 2A5DA 4X8LA 3B9QA 4Y0AA 5FPSA 2WKPA 2IS2A 2PZFA 5GJWC 3LV8A 2DWOA 2UZIR 1N6KA 2BBTA 4ZPXA 3SBDA 4OL0A 3O8BA 3GLHB 1OFIA 4DLVA 2RGGA 1RPZA 4KJZA 1Z07A 4PQYA 2DFTA 2EFEB 2WPDD 4C0KA 1X86B 3QEOA 5C1BA 3SYNA 3GFPA 3BBPA 2BM1A 1A2BA 2ZRHA 4MUBA 4GRAA 2ONJA 1YZLA 3I1FA 3FPAA 1M6NA 4AI6A 5ELXA 2IK8A 2OLJA 2WOOA 1NF3A 2JDIA 1CTQA 3RVBA 4EFNA 5DI9A 3U6KA 3TKLA 2I1QA 2F1RA 4EQ6B 1MRSA 2IYVA 1LS1A 1NL3A 2VHTA 3AUYA 3VHXA 1Z3IX 2JLQA 3WMFA 3A58B 5JLJA 1HT1E 3RHFA 4DDVA 1J90A 3KB1A 2OESA 3L0OA 4FMBB 4XTRA 2PJZA 4Q21A 1EFRA 4GMDA 1T3SA 1YZUA 1NG9A 4TZ0A 4HB4A 4R9UC 4WVFA 3A1TA 4BFVA 3NDPA 1BYUA 1ZD1A 1G3RA 1DELA 2BMDA 1CXZA 1E79A 2F9MA 4L4UA 5AJYA 3GLGE 3GPLA 4J0QA 5JCZA 2AN9A 4NL4H 1LW7A 1RRFA 3PEWA 3SYLA 2W58A 2E1RA 1J2JA 2NO6A 4OQXA 4U02A 1XRJA 5C4GB 2QP9X 5K8UA 4FMCB 4A2WA 2C2HA 3T35A 5LB2A 5P21A 4CZ2A 2EW1A 2EFCB 4O3MA 3VR1A 1W36D 2YZ2A 3G5UA 1R8QA 1ZNYA 2CCGA 2F43B 2W2XA 2GKSA 4A36A 2OXCA 1S8FA 3KTAB 1KYIA 1KTVA 1JI0A 4BASA 1NN5A 3GQBA 1OIWA 4DUGD 1WB9A 4PPNA 3FFBA 621PA 1DTSA 1E0SA 1KK0A 5JRZA 4B35A 4DJTA 4IKEA 5JWRA 1WE2A 2IUTA 721PA 3AKEA 2GXAA 2CL7X 1PUJA 3SJAA 4NCKA 3NEJA 3U44B 4B71A 1ETUA 3SU8A 2XOKA 4EPXA 3GLFB 1GVNB 2NPFA 4A2PA 4G5GA 4Q48A 5D3MB 1ZC3A 5FUYA 3CXLA 5JCPA 1XCPA 5LB4A 4NYMQ 4BPBA 3ZS8A 1IY1A 1RRGA 1E2HA 5GVRA 1XD2B 2QM8A 4M53A 1F2UB 2FFAA 4ACBA 1ZD8A 3GFTA 3KQUA 1IJEA 4URUR 5UKDA 1SXJB 3VU9B 4PZZA 4I1UA 2ZANA 2OAP1 2X19A 1MO4A 1VCOA 3OHMA 4Q18A 3RS7A 4XIGS 3TK1A 4HUQA 1YRAA 1EFTA 2NOAA 1PUIA 5B64A 3I5YA 3GJXC 1GILA 4IVPA 1HEIA 4D4MA 1Z6YA 2RKOA 1VDZA 4M2LA 1FZQA 1ZC4A 4M1MA 5CLQA 1FOEB 3ICEA 1KAGA 4I1OA 1HQCA 2OCBA 3CLVA 1AZSC 3H1TA 2O0KA 1XX6A 1VCMA 4DLSA 1II8B 5CJ2A 1NG1A 3H4MA 2O8DA 1G3UA 2J7PA 4URWR 1MH1A 5DYGA 1R79A 1RFLA 4BZQA 1NSFA 4CF7A 1Y63A 2F7SA 2O0JA 2WBLC 3EA5A 4QG7A 1G8YA 2EVWX 1TQ2A 4G01B 4LV5B 4UNPA 4B48A 1WXQA 2CBZA 3R7WB 4Q4HB 1WDTA 4OK3A 1TTTA 1CJMA 1ZM3A 1LNZA 3DOFA 4TT3D 1FQKA 2TMKA 3ZIAA 3TSZA 3EA0A 5BWMA 3SI7A 2RGNA 4BFWA 2CXXA 1MO5A 4PAQA 4DCUA 3O47A 1S2MA 2ZYWX 2P6UA 5TARA 4P4SB 2W6ID 1NN1A 4TSFA 3WRXC 5KSOA 1YRBA 2NQ2C 5KSYA 4MDFA 1KO8A 2OBNA 2VP9A 1EX7A 1O87A 3IBGA 3WHLA 1OYYA 4LBWA 2ZSAA 4KITB 2ZUBA 2VF7A 4M0LA 1GL6A 1S1CA 1ZNXA 3EX7C 1G6HA 5E95A 1KDTA 2OFOA 1DEKA 1XCGB 2G1KA 1I2MA 1ZM7A 2J87A 3IBYA 1TAGA 2B21A 3IQWA 5JRJA 5A0FA 1IHUA 1YJ5A 2XZOA 4WBSA 1MT0A 2W0SA 5IT5A 1KK1A 4FMCF 4WZ6A 3LVQE 4Z1MA 3EZ6A 2C9CA 2CK3A 2LKCA 1BYIA 3B13B 5JEEA 3VR2A 1SQ5A 5EE1A 3W5IA 3K0FB 4OHZA 1UBEA 3D31A 3HPRA 2DHRA 1UKYA 1XMJA 3F5FA 1R8SA 3P4YA 4IDQA 1OFHA 3QKUA 2GF0A 2GESA 1DAMA 2GJ8A 3F0TA 4UJ5A 4BUJA 5JHGB 4LJ8A 1JXOA 3K9NA 2WICA 4CW7A 3DVLA 1FUUA 1N6RA 1NKSA 1VG9B 2CMKA 2ZE7A 3FFAA 4HLDA 3ZS9A 4BFYA 5A4JA 4QM7A 3W9YA 2WWFA 2WMNB 2SHKA 3RNLA 1NVXQ 3U5ZB 1G8GA 1OW3B 2C96A 4ASUD 1J70A 5IK2A 3SFVA 3HDTA 3DOEA 1UAAA 2FX3A 2YWGA 3OIYA 5D3QA 2QTFA 1UADA 2F1JA 5DHFA 1GFIA 3K70C 1VKJA 2W0MA 2WJVA 1BOFA 1Z06A 2X1VA 1QHNA 2ODEA 2H8KA 1X1SA 5CYPA 3W6NA 3GLGB 1KI9A 1IONA 4PFSA 3S1AB 4TL6A 2ZVQX 3B6EA 3VR4A 4KVAA 2OM2A 2ZI7A 4GSYA 3KQHA 3CX7A 5JJIA 3GJ4A 3UATA 3QKRA 5C18A 2IL1A 3LBHA 1TNDA 1X6VA 2V1XA 3M1IA 3W5JA 4GZMA 2GWHA 2R6GA 2WAYA 3EAQA 3VR5A 3IILA 1E2JA 1M74A 2QT1A 2MSDB 4JMPA 2VPPA 3EZ9A 2IYXA 4RKFA 4IOMA 4A9AA 2J45A 3CBQA 3SS8A 3ZQJA 1Y8FA 2BMEA 3GJ3A 3WY9A 1Q1EA 4KCGA 1W36B 4TL7A 2WSSD 4LSGA 1E0AA 4HB3A 2KI5A 1G9XA 2O5VA 2WZQA 4KFRA 3ZGXA 3LQQA 1M7HA 2FFBA 1YR6A 2XAUA 3QXHA 2ZJOA 3QJYA 3QQ5A 4C0QC 5C2JB 3HR7A 3U4QA 1DAEA 2VRWA 2VYFA 2A2ZA 1E1QD 1DAGA 3AEZA 4FWIB 2IEYA 1E79D 4KHZA 2GHIA 3PUVA 3VR3A 4BRUA 2GILA 5FTJA 2GK6A 1CULC 4L15A 1HH4A 1W0JA 2VL7A 2ZYTX 3AVOA 4PQRA 5FOXA 3CZPA 2PJRA 1FP7A 1T91A 1U81A 4A0GA 1P62B 3CONA 3H86A 4NE2A 4TQ9A 4HSEA 3EPJA 1UKZA 1E4YA 2XSZD 2FG5A 5FOVA 2QQ0A 4EJSA 5CIWA 2X8AA 2JCSA 2I3BA 1UPTA 4FI3C 2MSEB 4QJ4A 4XTCS 2ZEJA 3QOFA 4LBZA 4YDSA 3QPVA 5G40A 3AVPA 2ZAMA 2JA1A 3A1VA 4B3CA 3BORA 1F2TB 1Z0AA 2PLFA 3KJHA 1R4AA 1G3MA 2DWQA 3AKYA 1AKYA 1ZU5A 5HR5A 5CIQA 1E96A 2XOKD 4DDTA 3NC0C 2CLDX 1Z0IA 3REGA 3U6BA 4M1WA 4MRSA 4QRHA 2C8VA 1NJFA 3C14C 4DLXA 1XD9A 4RZ3A 5FOWA 1K5GA 1KKLA 1T9HA 2FPKA 2R6AA 3DZ8A 4LYFA 2FPMA 1AJEA 1II8A 1HT2E 4MKFA 2V7QD 5KDLA 3W8RA 2DPXA 3QKTA 3QNUA 1XJ0A 4KXFB 2BOVA 1VYUA 1PVOA 4JSTA 3RABA 2N1BA 1OXUA 5JI3E 1GRRA 1P9RA 4JYCA 4V0OA 2WHXA 4MGIR 5DYIA 4RCYA 1N6LA 1ELOA 4JIMA 1SHZA 4JBXA 1E9DA 2ASEA 1E2IA 1LS6A 5DNYB 5BYJA 2R65A 1GIAA 4C0LA 3MWKA 3NDBB 4JLVA 4A0RA 4AIIA 3UEYA 3UWKA 3TIFA 4D0NA 2BMFA 2FF7A 1Z0JA 2D06A 3CKLA 5KDOA 2GF9A 3UGLA 2PEZA 1UBFA 3PXGA 3QEJA 1BMFD 1FTNA 2HT1A 4K46A 2A9KA 1KO7A 3MCAA 1OYWA 5DIFA 1ANKA 3LNCA 2JJ2A 3L0PA 4HDOB 4XSGA 3DPUA 1CP2A 3LLUA 5BN5A 3OFNA 1P5ZB 5KPJA 4GBMA 3Q72A 2ZR7A 4JVSB 3UXMA 1ZD9A 1U2RA 1JR3E 5IDVA 5AUPB 4RFVA 2G83A 2IYSA 4HZUA 4D4JA 1Z63A 4M1KA 2BCJQ 1W48A 3CWQA 1S1MA 2JGNA 1ZRHA 3GJ5A 4DSUA 2Z83A 4NYIR 2FOLA 2NO1A 4RZUA 4KODA 1DARA 1D9ZA 2JJ1A 3BB4A 4A15A 1X1RA 2VHJA 3MLEA 4FCTA 5EJEA 1GSIA 4XH9B 3BGWA 4BFXA 4Q47A 1FPMA 1XEXA 2A30A 1A7JA 3X2SA 3AGQA 2PCLA 1R0ZA 3J81k 3IEUA 1KI2A 4MITA 3WYAA 3ADCA 3OESA 2BKUA 1M2OB 1G5PA 3EW9A 3NBFA 1AIPA 3TUZC 3DKPA 4KBFA 1G7SA 2EFGA 2ZJ2A 2ZIAA 3AUXA 4G1UC 1XFAA 1OKKD 4XWOA 2EQBA 3ECCA 2IYQA 5LD2B 1GL9B 2VSXA 1VYVA 1K5DA 3LFUA 2YYZA 4MH0R 5DGXA 3NG1A 4DCSA 3LX8A 1RKBA 4DC9A 1YVDA 3AVTA 3LO5A 2HLDD 1KY3A 4ZIRA 4V0NA 4P33A 4MKIA 4TLBA 1XZPA 1JBKA 5BYKA 1XXHE 2Q3FA 4XD7A 3PEVA 2ZE5A 2Z5FA 4A8JA 3U7GA 2OFXA 3B9PA 3TW4A 4U7DA 3FKSA 4Q4LA 1XWIA 2HYIC 4KFTA 2V9PA 1TX4B 1SKQA 2ANCA 2QU8A 2ZRCA 4NCNA 4US0R 1RRCA 2DCUA 3T12A 2HDNB 2FFQA 3LRPA 1QG2A 2A3RA 1SVOA 4G0NA 3GLIE 1R5NA 4A1FA 3EARA 3H84A 4IJMA 2OCPA 4ZDWA 4UKDA 1D6JA 3A1WA 4QJ3A 1HA3A 4EFLA 5JWOA 2JLVA 4EPRA 3IDQA
chains in the Genus database with same CATH superfamily
1V35A 4DMUB 3FDXA 3VPDA 2J1LA 4GKAA 5EHZA 1JX6A 4OU5A 1J42A 3TF5A 3QXJA 3VNVA 3A37A 4PW0A 4YRGA 2NAPA 3C8HA 1T3ZA 4EHIA 4RULA 1PL6A 1PSZA 1O95D 4XWGA 221PA 1FUIA 2RCYA 2JGMA 1PJUA 4MGHA 1YH3A 2ID8A 1QDEA 2Z1DA 2RDMA 3AR6A 3DD1A 3MG9A 4ND4A 4WNYA 3DO8A 3P19A 3MHTA 3LBIA 3DS8A 1M6EX 3GBPA 3QWIA 3T38A 4F4JA 5EZYA 4HS4A 5JZOA 5GAJA 4P4GA 4FCCA 2QP3A 2Q45A 2C9MA 7MHTA 2Q7DA 3ZD7A 1J8MF 1EIZA 2RH5A 2Q6TA 3MT7A 4YMIA 4C01A 3CF0A 3PFFA 2HEIA 1E6EA 3AF5A 5F1PA 4QOIA 3A1CA 1SUWA 3WSTA 4E94A 1ONNA 4MRMA 3STVA 4N3BA 4PIPA 3KE9A 3OU2A 5TV2A 2NU7A 4F8EA 2YWCA 5ERXA 1OF1A 2GVIA 1Z4JA 1EWRA 2VLBA 2XWJI 3E7XA 4JENA 1PNVA 1JEDA 1F6BA 3VC7A 2C9OA 3IDSA 3BB1A 1O58A 3H8JA 4L75A 4OKSA 2OY0A 2C92A 1ZH8A 3ROEA 2P9HA 1SPXA 2HMAA 4WOKA 2AVDA 5AVWA 3ZXUB 1P1KA 3CIFA 3QXGA 3GRFA 2NTYC 4LRUA 4REMA 1UKCA 4D80A 4AJ1A 1PTRA 3SXUA 5JJ5A 4JELA 4ZK2A 2O8BB 2HNKA 1XFDA 1GZHB 2C84A 4P84A 4DA9A 4MW0A 4LFAB 3P9CA 4QL3A 3THYA 5ADVA 4QLOA 3LC7O 3C1AA 4B47A 1Z5WA 1J33A 2BFFA 5KJFA 3GLUA 1MB4A 1TMYA 1N25A 1SA0A 1T5TA 2YHAA 3A2NA 3C6ZA 4IZHA 1FJHA 2R7MA 4OK5A 3OXGA 1T9AA 1VRVA 2YNMA 5AESA 2VHVA 2CNWA 3QPWA 2HF9A 1V96A 1ESNA 2XUGA 4K7JA 1SUPA 1XRRA 1U0RA 3JZMA 1ZFNA 1FUEA 3JQQA 4P7FA 1NLFA 1QBKC 5EXTA 1YDWA 5FBZA 1WZCA 3FB4A 1PBTA 2JAOA 1KMAA 2ZKLA 1OXMA 1OYOA 1NQAO 5AMXA 3LK6A 3W7VA 3TIGA 2RBEA 2CVHA 2R2GA 3ROGA 1XL0A 3IERA 4II2A 3VH4A 4CI0B 4G0ZA 3ZLJA 4HQLA 4LMRA 4XJSA 5L4LA 1SBTA 3D8SA 4KUHA 4R9NA 4UPVA 4ZT3A 1YA8A 5K0EA 5C80A 1W4BA 3HN7A 3IPLA 3NJRA 4KOEC 3WGVA 4ZO9A 2H17A 1NRWA 1VMAA 5BP7A 3BGOS 3NOXA 3QIAA 3CLHA 3BD8A 4F71A 3EDOA 4RLHA 2V3VA 1NAHA 1B3RA 2PSFA 5FA5A 3NHBA 1XCJA 3FA2A 3VSDA 5A5FA 5KUTA 4DA6A 5LM3A 1HNZB 4TSRA 4UOZA 4D4HA 2CHUA 3O1IC 4FSHA 3VR6A 4EUNA 2J7KA 2POCA 4NENA 3JWGA 1CR2A 3NHSA 4L4XA 5L40A 1J99A 1GLNA 3H9CA 2VDLB 2RIPA 3Q7PA 4AZWA 3QYPA 5KS2A 1WMEA 5FTNA 3MAAC 5GY7A 2WJGA 5EE9A 4TXLA 2IS1A 1V4VA 4RU1A 3B78A 2JBHA 1G3IA 3B7PA 3FHLA 2CWHA 1TADA 3ONVA 4H35A 3AEUB 2ZBEA 3RV4A 3OY7A 3W6OA 4DXAA 4YHHB 2HA4A 2RAUA 4GE3A 4AIRA 1A04A 1DBWA 4GG1A 4AQDA 3BIFA 4HSGA 8GPBA 1ML4A 2GPJA 5FTMA 4ENWA 1DO8A 3VGPA 3OEWA 1I1NA 3UUWA 2QQEA 4KNVA 4JVMA 4AKIA 5L6LB 4H1UA 1LH0A 1VJ1A 4F0JA 1JHPA 1XHLA 3MSXA 3PXUA 4WOBA 2X0NA 1V3UA 3GL9A 3PUYA 4GO1A 1MEOA 5C5EA 4M1YA 3VH2A 4F45A 5EMNA 4LFBB 3GEPA 3E8SA 1T0JB 2ID4A 4CM6A 1HLFA 3HBAA 2NUBA 2DUUA 4MS1B 3SZLA 2Q5OA 4E4YA 1M6WA 2V55B 1ZRNA 3I4LA 4FGSA 5AUOB 3EEQA 2Z2XA 1XZEA 4RJIA 4G9GA 4F4UA 2GB4A 1NDHA 3BREA 1EGMB 1Y1KE 2BPOA 2AH5A 3FYSA 3L9WA 2GNOA 4QHYA 2QRUA 3TLZA 5KYWB 3TDMA 4IEIA 4MUXA 2BUBA 2WU0A 4FX5A 1FDOA 1NQXA 1N7JA 1X7WB 1XXHB 4QUHA 1JI3A 1Q95A 2GN1A 3DF7A 5DX1A 5I9LA 4PYMA 1ISIA 3H13A 2HPHA 4JJGA 1I6MA 3K0CC 3LS2A 3MJFA 5L53A 1XDSA 3K9FC 1MMFB 2VXOA 4ZHQA 3QWHA 5LOVA 3N75A 2REOA 5FR1A 3URKA 3N39C 1U8YA 4KO4S 4H60A 5IHXA 3LSYA 4PLZA 1GU1A 2VZ9A 2OO7A 4HT3B 4KWEA 2YV4A 1FTQA 3T3DA 3I62A 3ELDA 5GOTA 2QUZA 1RYFA 4C7KA 5JS1A 4MMYB 3QUAA 1CUFA 4WXRA 2J6CA 3T34A 3IOMA 3TLCA 3D7RA 1FTWA 4QFCA 3E03A 1HBJA 4UDNA 1Q7RA 2QRKA 4PSVA 4TXJA 2WHRA 3HCAA 2XA9A 3KG2A 2QZPA 2G04A 3OQJA 2FB9A 2UZAA 1OAAA 3KJQA 3O5AA 3ASZA 2PMDA 4JI4B 4D92A 3TOBA 4UATA 4Q9JA 2H4ZA 1M66A 4TMVA 2P2LA 1DAIA 4LE1A 3JD0A 3NETA 2Y0PA 2WWXA 3QVOA 4EZEA 1C9EA 3KD2A 4F2WA 1DE0A 1DC6A 2V5UA 3AUAA 1CNFA 5B2EA 1GT91 2F3TA 4KWTA 4N1AA 3ZHRA 1W85B 4TS4A 1YVUA 4FHGA 2ENNA 3WL4A 1OROA 4A16A 4G3XA 5DK6A 3C2QA 3OTWA 3DAHA 2MR6A 4CG1A 3TGWA 3TZHA 1TIKA 2QUJA 4NFHA 5ILGA 2G72A 4NVRA 3NAZA 4X8HA 3GYGA 2A0KA 3AF2A 1J8YF 3MUEA 3FKSD 4ZT6A 4D43A 2C8JA 4HDNA 4LOJA 5HKKA 2P67A 3ADDA 1GN9A 4EWLA 3K1AA 3IAM1 3LT0A 3RK4A 4F1WA 2XRCA 3ORQA 3AL0C 4MAMA 4NU0A 3RUAA 3X3HA 3UMRA 1KVRA 1UBGA 2ADFA 3WIUA 4QQNA 1BJTA 1H65A 4HFNA 3VYTB 1SBIA 1P7YA 1IPFA 2Q8PA 5FD8A 2PFSA 4PTZA 2GASA 1E9CA 2G80A 2WFLB 4CEIA 1PVDA 1Z22A 1K6MA 2Q4TA 3RADC 2O8EA 2CXUA 3EZYA 4OAPA 3SR3A 1N32B 3W77A 1N6PA 3K09C 3KJXA 2DT5A 2BMWA 1KVTA 3DR3A 3OC0A 3RNOA 1UQUA 5CIYA 5KKAA 5JMWA 1XQ1A 3A7DA 4OO3A 4KPEC 4JYMA 3SBXA 1WSBA 4ZK6A 1IMOA 4U8HA 5AVQA 2ZUDA 4DFDA 1JLMA 3S2UA 1W25A 4LY0A 4RPLA 3GEHA 4ESEA 2A9VA 3DZKA 3L49A 2IQ5A 3KVOA 5TS3A 5TMPA 2FWAA 3K0AB 3ZC3A 1JA0A 2VC2B 4MUHA 1KNQA 1CQZA 1SC3A 1B4DA 1IEXA 2AC4A 2LV8A 4BO8A 1NP3A 1RCTE 2G06A 3GN2A 3L07A 5LZ5A 2GZAA 3DSRA 4NF2A 2AJ8A 3UK2A 3VFDA 2WU8A 3B12A 5BY2A 1IPHA 3RHSA 1EFPB 4FYMA 3KSUA 1JJVA 4LGVA 4B79A 2GEVA 1GLVA 4FZJA 4QEZA 4U3JB 3NTLA 2HMVA 1NFRA 2JFGA 3EH1A 5DEIA 3IT3A 5KTKA 1VL8A 2GBCA 2J4DA 5KWVA 1QU3A 2XTNA 1MXFA 4AN1A 1QF6A 2BFEA 2ERCA 2VZ8A 1OBFO 3M81A 3PHLA 2O3SA 3OE7D 4YJHA 5BN4A 4YC7A 1TO2E 6AT1A 5EWJB 2GT1A 4TWJA 5BT9A 1BEZA 2AR7A 5DBGA 4U9UA 4G89A 1RWOA 1K7FB 4ZEOA 4ZZ3A 1P6XA 2VFAA 4MS4B 2R0QC 4EG3A 2J0UA 1KO4A 2CJYA 2GXSA 2ID7A 3L6UA 1QHHA 1SEPA 3FGNA 2OYCA 3R3HA 5K6AA 5AYVA 3P0IA 4YGXB 3KFVA 1AZTA 3DMYA 1LX6A 1M7BA 4RA6A 3V2IA 9ATCA 5LJLA 3DZBA 3M5DA 1JG1A 3CLUD 1CGII 4RIGA 3BB3A 3S27A 3WNCA 3W3AD 5M3BA 3WTCA 4HK4A 1WW2A 2JI8A 3O2NA 3UTCA 5AW2A 3THWB 1KVUA 2FXVA 2A78A 2V74B 3Q9UA 1DAPA 3ORYA 2H48A 4YREA 2PH7A 4WFIA 4OLFA 2QSZA 3RYHA 2I4MA 4U0KA 4LOAA 3A8TA 1CETA 3HR8A 2NVUA 1ODKA 5TJ9A 1BCRA 1XA4A 4ARAA 2C7PA 1NNLA 4ND1A 3ELYA 1CHDA 1Q1NA 1QMGA 1T1EA 4KKVA 3S7TA 4ER6A 1R27A 4HJXA 4F8JA 3TB4A 4CKXA 5GVSA 3AIIA 1KSFX 3IX7A 1Q7TA 3A4YA 3NAQA 4NQRA 4XUGB 1C14A 4QOSA 1KZHA 3TBFA 2A5FA 3U2QA 3AI2A 3HP7A 3I09A 3QU9A 4J0KA 4RF5A 1PT8A 3O03A 3O8LA 4EKGA 1YRLA 2FAXA 1SGNI 1N1DA 3D9QX 3P2MA 1GQSA 1XYGA 3DLIA 3E2MA 3I73A 2IEGA 1Y9AA 4KXXA 3MTBA 5NULA 7GPBA 4AZVA 1L5NA 4YXWD 3NKLA 6REQB 1HDRA 2Y6VA 1M1YA 4XCQA 3ZWWA 4DNOA 5DNUA 2H1WA 1XZAA 3RFVA 3WK9A 2R1UA 3LYLA 1I01A 5BSEA 2WUGA 4DSTA 3WWDA 5FPYA 2BEKA 2PO5A 4HDQB 1TQHA 1CY4A 1OPXA 1RQNA 4M1OA 2C99A 3GT7A 4TMFA 2WWRA 4KH0A 4Q0MA 2JZOA 2QX4A 2H1IA 3ROZA 1JHXA 2PSSA 3CF4A 7ADHA 1HNWB 1MVNA 2HBZA 4MNTA 3HCCA 4PGGA 1U8ZA 1JVSA 3WIVA 4CM9A 3T1OA 1NLYA 3T3HA 4K9OA 3EC1A 1OVOA 1P72A 4J1TA 4D3DA 1R4MB 1T43A 2HU5A 3S8YA 1CR4A 1QB7A 2BC9A 3AU9A 3DC2A 5EJ8A 5I9TA 1KPGA 5GZ3A 2CB9A 2PLAA 1VGRA 4ZU3A 3ZDEA 4HLCA 3LH5A 5CEEA 1PX2A 1P74A 2NAFA 1UDAA 1OY1A 5CBPB 3KBOA 2WTUA 2RHHA 1E4OA 2J3EA 3DM9B 3ISTA 1RHKA 4CRWB 1M2FA 2X41A 2WA1A 4TMYA 4XDGA 3GLVA 1W7AA 2GARA 1GTG1 4LDZA 3P1JA 1VG8A 4ITRC 4S1PA 4IXTA 3KM0A 3VZSA 1CY8A 4DG5A 4CIBA 5K05A 1QIKA 5CDUA 5HGXA 3L4JA 2Y67A 1ZOLA 3AOEA 3GT0A 4E2ZA 1LX7A 2JJMA 1YDGA 1CRPA 1NI3A 2XDQB 2CNBA 4H77A 5I3CA 2E9SA 3CF4G 3GP5A 1LLUA 4MRRA 1B3BA 4U00A 1R0KA 1XCOA 4B76A 2W2LD 2IEBA 2IS6A 3HYCA 5BQOA 3NT4A 2VAPA 4JDUA 1NXSA 1WUKS 2I78A 3BMQB 4JD5A 3KWMA 2QJRA 121PA 1AM4D 4Q4DA 1Z9BA 2HCFA 2OCYC 3M4YA 2GYVA 3IAFA 3N28A 5C7LO 4YMVA 2JLYA 4FKMA 2J85A 1WM1A 4Q00A 4NNJA 3QV1A 1YKFA 2RG7A 1UBUS 2PBFA 1UZLA 3PTLA 1G3QA 2RH8A 2W90A 3EVNA 4Z53A 5JYEA 2B3TA 4IXDA 1AN0A 1C3LA 1G0NA 3MNFA 4FOTA 3KHKA 4FUQA 1M1UA 1L8XA 1QKJA 1LTKA 1XXLA 2IHKA 2P5UA 4QTXA 5I8ZA 3ZBQA 1RI1A 2AKAB 1LLCA 2MDTA 3SFTA 1U2DC 3K70D 1MX5A 4GOLD 3AVWA 1LDYA 3DLTA 1NVFA 3Q85A 1ZJZA 1WB4A 4W7SA 1GG2A 5HIIA 3RT7A 3HP1A 1ZMTA 3U9TA 1W581 2C4TA 3HFRA 2QVXX 1ZZGA 2VJOA 2VPXA 1D5WA 4MTCA 1BDJA 4O5OA 3UT0A 1K5HA 1KI8A 4LGMA 4BKMA 1HYGA 1RMYA 2BR3A 3E05A 1QPBA 1EFRD 1OFGA 3GJTA 3FTDA 4EHNA 4R1MA 3FRJA 1BWQA 3I53A 3O74A 2H4FA 3GGSA 4OMFG 1G1MA 4HRVA 4CKEA 5H02A 2AKEA 4LVUA 2NM0A 2V7BA 2UVDA 4K26A 2DQSA 3U62A 3L04A 5BW8A 1OGIA 4C76A 4D9BA 5F64A 4X1YA 4HQRA 5JIBA 2ATIA 1GYPA 2HCRA 4PNPA 4D6PA 3U44A 3GLFA 3OBBA 2AR9A 3BFKA 3KR0A 5L51A 4AMZA 1L5SA 5BVGA 4DA4A 3TUJC 1XOIA 3QV2A 4ECAA 2CEAA 2O8NA 4B2YA 3K6SA 1SHKA 4LYHA 2DMRA 5CMLA 4RS4A 1Y4DE 1P0CA 5E4JA 3AESB 3L0IB 1X4SA 3K5IA 1KYTA 4I5EA 4RA9B 3EPKA 1LNQA 3BJMA 5D01A 4DHEA 3GGDA 4RSGA 4EZBA 3Q8MA 1L6IA 5ALVA 3REOA 4LE2A 3ZVRA 4Q37A 1T34A 1F2UA 1N7IA 4K9MA 1FTGA 3B9BA 1L7DA 4WNAB 3R6TA 3DTNA 1FLDA 2EOAA 4RIEA 3WLEA 2LE0A 2UXCB 4W5NA 1NMSA 2B34A 1FTSA 4G0VA 4YDHB 1N5JA 2JAHA 3FIJA 4OAOA 1B16A 1TIPA 4UM7A 2ZJFA 4OX9Y 4P1ZA 3VUFA 4HYQA 2R1TA 3OZVA 1N0HA 4Z0TA 2XTAA 3O1LA 3RVPA 2KM1A 4YO7A 3V3TA 1AMUA 2H5EA 4LX0A 4CHTA 4RSHA 2DPHA 3DCYA 4C3ZA 3JD3A 2OEPA 2J08A 5AKHA 2LRHA 5DLEA 3RVLA 3ZX4A 3WK7A 2VJYA 2PA3A 1KQGA 3ZIUA 1AS3A 2IXAA 3NYIA 1I32A 3L6EA 4FU0A 2OXTA 5KHLB 2A6PA 4KFCA 3ZV5A 4DQXA 2E0IA 2CXRA 1U0EA 3IJRA 5ERYA 2GKRI 5KTMA 4FYPA 1Z5PA 4R8SA 3EZGA 3KKOA 4XVHA 4RVGA 5SYNA 3ZE2B 3G0IA 3CUEF 1IEQA 3DVRX 1GY8A 4FXOA 4Q4HA 4EHLA 1NV8A 2ZYAA 3DT8A 4QICA 3OEHA 4RK1A 4O6VA 2ZJ6A 4JCCA 2OZUA 5JEDA 2Q49A 3H9UA 2HDHA 4G8CA 2Y05A 2JFHA 1QOZA 1SUSA 4IZ6A 4IUYA 3BKXA 1EDDA 4IFBA 4P4SA 2H9IA 4C7XA 4P4NA 4A4DA 1ESDA 3ZCTA 5CA0B 3KAJA 2UUOA 4K40A 1TIBA 2W43A 4DV5B 3TSOA 2FG7C 1TVEA 3IAM6 4JOBA 1P4JA 1C0EA 5ECWA 4DQUA 2IXFA 4X6XA 1HLPA 1O77A 3CLTD 2J41A 2HIHA 2GK3A 2BCEA 2PS9A 3P0EA 2A14A 4DJAA 1AVTA 2OD9A 4S1NA 2R9VA 4U7PB 4TTQA 4PSUA 4KMOA 4QYIA 2IYYA 3P96A 4D3YA 4DZTA 4II7A 4NFYA 4IHJB 4PVCA 1AGNA 2EJWA 4R8VA 4J91A 2BLNA 4S2EA 5FHQA 1KPIA 1IM2A 3TCXB 4ZYXA 1VRWA 5A5VA 1L5MA 2FWIA 1QRRA 4MPPA 2Q0XA 3JX9A 1H2FA 5HTOA 2H59A 4IUBS 4BXOA 3AVQA 2YY5A 4WGGA 4Y1RA 2ENZA 4PZEA 1X77A 4H1VA 4GYYA 5FEMA 2WVAA 4PLWA 4OQNA 4BC1A 1OBOA 4MWOA 1P2BA 1Z5ZA 2E3JA 3GZNA 5L3RA 4BEVA 3CO5A 2IOFA 3QVTA 5D6NA 2VDRB 3I01A 3UB3A 2X9NA 4A6DA 4HUTA 2D4HA 1YU9A 1E1KA 1PR1A 4J8PA 4D4KA 5J4YA 4PS1A 1GNPA 3GPCA 4CWAA 2CVPA 4XQ9A 2ERYA 2GLXA 4G1CA 3ESAA 4KLCA 3TAUA 1BE8A 3DZJA 3R6GA 4UXJA 2Z95A 4HVAA 4JC8A 3ZD9A 3VOSA 1NN3A 2PUBA 3BXEA 5CFPA 2VT2A 3RS8A 4BNDA 4DIMA 4MRVA 2DY1A 2VBIA 5KNLA 1PV2A 3K0CA 1LGYA 3GOXA 1ORHA 1SRRA 4IHQA 3FZQA 4EOGA 1HDCA 3G1UA 2C5HA 2XTJA 1I36A 3KJEA 3Q6MA 3FNGA 4MR8A 2CK3D 2ILTA 1Y3AA 2HIGA 1HYBA 2NNWB 3PQ3A 4AN0A 1CFJA 3M5CA 3GLGA 3GGPA 2R8BA 1SKAA 3JCZA 2HWKA 2IZ5A 2QQ5A 3LXXA 5E7JA 1GL3A 3U4HA 3WLAA 2VHCA 1H8HD 3FAZA 5EIHA 2AMYA 1W96A 2DQYA 2I4RA 2J09A 2QE7D 2XA1A 3FHCB 1NR1A 2VK8A 4MA4A 2CDNA 4RZ2A 4EMSA 1C1DB 1J00A 4J49A 1XDBA 3RSFA 1YI0A 2RHMA 3OVMA 2FEKA 4CLRA 2NXEA 2ZOSA 4G4IA 4MICA 2PXAA 3SBEA 4INAA 3Q9LA 2C3OA 5HFNA 2GD2A 3ZXYA 4E22A 4UNSA 5ADWA 4GC5A 3MCTA 3ZHSA 4D4LA 1NDQA 3DTVB 3FNRA 4GRIA 3E22B 4Q05A 3SYMA 3UF0A 1JVBA 2AXNA 5B58T 4EYSA 3KFLA 4ZTUB 5EPEA 3AX6A 3VA7A 2BEUA 3WP1B 1IQPA 4R9RA 1OWMA 3RIYA 2NO7A 3OLWA 1B15A 2FW8A 1MC4A 3JTMA 1Z2CA 4GICA 5CVCA 5AM0A 1Y3CE 4BE4A 4JI5B 1ZGZA 4G4SO 2HF8A 3ENKA 4AVYA 4D0SA 2JFVA 5JAIA 1A82A 5BO5A 2J6BA 2OKGA 3NP9A 5IDYA 2YXPX 3LX5A 3RH0A 1TK9A 3JQRA 1ZCFA 2LP4Y 2HBYA 3QGMA 5HMMA 1XLVA 5ALJA 3TSAA 4Z9BA 1G19A 2ZRLA 2DB6A 3KPYA 1Z28A 2O2XA 3PKIA 5B7PA 4KHPB 2R62A 1XZFA 3QE2A 1ZIOA 2AOTB 4A6PA 4C0XA 2XGGA 1UFRA 3CRRA 2VK2A 4OUDB 1RAGA 1ZN9A 1SGWA 1V5WA 3AXSA 3K0EA 1JW9B 3VUEA 4OJQA 5E9JA 4AZ3A 4MJXA 4ZICA 4MQEB 2XE8A 4JGGA 4WZBE 1YBAA 4HADA 4S1OA 4GVXA 3SYTA 3TW6A 4ND8A 1ECLA 3D3QA 4KR3A 3BWVA 3DBHB 3D1VA 3VJMA 1WGTA 4J7AA 3TO9A 3BIXA 3NEAA 3CE6A 3MGGA 1AD2A 1ZH0A 4RDCA 5I9MA 1U0OC 4H6PA 4N6GA 3T5DA 4B3GA 1JEAA 2HMUA 3K09A 1P6UA 2Y71A 4R2WA 5H68A 5T4HA 1ZOOA 1ILWA 3CUTA 1XQXA 5KPDA 4L9RA 1GM5A 3H9EO 1OFVA 3IXQA 3OI7A 4JA0A 2YCBA 3KKNA 4W5JA 2QLLA 1P7PA 1T0PA 2J4CA 3FNHA 4QUGA 1Q0UA 1DQNA 4NZ9A 4R0NA 4BYGA 4C9BA 1NZJA 5BSTA 3ZVKA 4IHJF 4Q3LA 4MYDA 5DASA 1QH0A 5EJMA 1GFWA 5BV0A 4B7UA 5LVAA 2O2DA 1YS2X 2JPDA 1SBZA 2JW5A 1YK0A 2ZE8A 2V03A 4ITUA 2AMLA 3OCVA 4QWWA 4EI2A 4W5QA 1Z6ZA 2GZSA 3H83A 4R83A 1JDJA 1EGAA 3E3LA 2QN3A 1E6MA 2DR3A 5DLPA 4QU0A 4ZQCB 5GP1A 5E6SB 4EUEA 1OTXA 1T10A 2BONA 2O52A 3UO8B 1CIPA 3GOQA 3EVBA 2H92A 2OB2A 3L06A 3QUSA 5KOYA 1WAMA 3LPLA 1SQGA 3QKIA 4OKNA 4MZDA 3UXYA 2MHCA 2NLOA 2WLTA 1YE3A 2YN0A 3NYQA 3S8MA 1PTKA 3GY0A 1ZXXA 1J24A 1LWOA 1TPZA 1ZCAA 5LCXA 4DQKA 4WESB 2XE7A 5B1YA 1Y33E 3EZ7A 3PWZA 3FPEA 2QDKA 2SKCA 3DO6A 4FN5A 1V3TA 1VHWA 4LC9A 5BMVA 4Z49A 5B3LA 3CPEA 4GL4A 5E3HA 3IPRA 1FAQA 2G88A 4NV1A 3O8QA 1B0PA 3G7NA 4BMSA 2GUWA 2VQSA 2WAAA 2GA8A 3P9ZA 3ZWCA 4ID9A 3UK6A 1Z6AA 1C3OB 4Q3KA 4HS9A 4K28A 1NUUA 2GYUA 2PH3A 3AUUA 3GEEA 3FG9A 3OX4A 4U7HA 4LSMA 5TDHA 4E14A 4JJEA 1O89A 1TLLA 3B60A 4OOEA 4WVLA 1OH5A 2Y1LA 4PAWA 4UDYX 3ZHCA 5G1NA 1P5RA 1BRMA 4PZPA 2WV9A 3TPCA 5JXGA 4V02A 1DIAA 4FFNA 3DOJA 4P36A 5GM2A 2RHGB 3TQQA 1WSWA 2I87A 4MLPA 4JUBA 2XVAA 5I5GA 3N8GA 4P83A 4X7MA 4XEUA 5DGCA 5HRAA 1HKHA 5ICSA 1YB6A 4QUBA 4MYCA 4RO0A 1FB5A 4A3SA 1JJIA 1NTRA 1USWA 3I28A 4R1NA 2UZ1B 4EQZA 2WNSA 4C43A 4HNAA 1DBQA 4NJEA 4HCJA 4N54A 4MS3B 2XMPA 4H27A 2OQVA 1JQ3A 2GK7A 2ZS8A 2O1EA 4NRDA 4EG8A 4MEBA 2CSXA 2NVBA 4QSHA 3V8EA 4YASA 2AG8A 2FPUA 1VIYA 1C9DB 3KELA 5CNMA 5EOVA 2Q29A 5ITZB 3W2EA 4YQYA 1C7EA 4G84A 3OHPA 1O7JA 2C83A 3FOFC 1XZBA 2O7SA 3Q7QA 2ROWA 5DNCA 2AOVA 1JR4A 3FSRA 3K2BA 2Q9AA 4JSYA 2REXB 4AY5A 1Z34A 1GPMA 1LU9A 2X0JA 3TOAA 4CL8A 5ICMA 3UICA 2PXCA 4O8CA 3FJYA 1T1JA 4RBNA 5TQ2A 5JXHA 1A1SA 3RRJA 5CCXA 3EA4A 1KHTA 3BJIA 4PYQA 4DR6B 5D85A 5KOHB 1E60A 2YIJA 3CPJB 3QRWA 2EP8A 1MCZA 2O3UA 2WJIA 4M9ZA 4ON9A 2PQ6A 1AV7A 3JZIA 4AUNA 1YXMA 1TKCA 3JQFC 4D9FA 3CT4A 2Z09A 4IG9A 2YJZA 4C03A 3BMOA 2NMVA 1QGOA 3U7FB 4KACA 2J5KA 2D0PB 4X91A 3RWBA 4N3NA 3L82B 5JNTA 1V6SA 3L01A 2N47A 2YX1A 3SLRA 1DDIA 1VBFA 4HX9A 1QSGA 4MDHA 2VVTA 1E1DA 5CGQB 2GTHA 1J0DA 2JRLA 3A9VA 4UTZA 5G0WA 3EUWA 3ZHTA 3QEAZ 3PT5A 4HGNA 3PDNA 2GIVA 1RWNA 1SIBE 1TKBA 3DR5A 4LJ9A 4RLFA 4ZTBA 4CMGA 1Z35A 1T2NA 1W9HA 3EQ8A 2Q6LA 3AUTA 3B52X 3H2ZA 3TSCA 1MOZA 2J3DA 3D81A 4Z8XA 3FWKA 1F48A 1T3HA 1RU3A 2VA9A 2B99A 2Z1NA 4ZAWA 3ICQB 4LZJA 4PR0A 2C82A 5F5XA 3BSWA 4PX2A 5AW7A 2W5UA 4BLSA 3G0BA 4HNSA 1PL8A 2C3PA 3CCBA 3SSNA 1H93A 4XCXA 5HQ3B 2GDJA 3HFSA 4XPIB 1BNCA 3I9MA 2I55A 4BP8A 2GTIA 4LDPA 3D8UA 4G5RA 3KOZA 1LSJA 2O1WA 3AHJA 4L27A 2M6SA 3D8NA 2YWJA 3C1UA 3HEBA 3VYWA 3ZUPA 1C29B 3IR6A 2X5KO 4JLOA 1PYOA 1N2CA 1CF4A 1YZGA 1QORA 2V0NA 1GZ3A 4M83A 4S12A 4WZBB 5DM0A 1FMLA 2NPIA 2OLKA 3R5BA 4QATA 4UZFA 1O96A 3IEXA 1KO1A 3ZWDA 5TJHA 5BXYA 1FLAA 1OA1A 1T25A 2AEMA 1D2NA 2FHSA 4AWAA 1T0IA 1E1QA 2D1SA 3FGPA 4IQFA 4PSAA 5AVTA 2ZAGA 3UMFA 4S04A 1UT6A 5JWHA 4CF5A 3ZWVA 4Q9HA 3FR8A 4BVAA 4IY1A 2QLTA 3Q8LA 1LEHA 4DOMA 4TYNA 3BT7A 4ES6A 1ZA1A 2FMUA 2RI1A 2Z5VA 4R81A 4X97A 1QIHA 1Y9EA 5KSPA 4LDNA 2B0CA 4YECA 1JAIA 1EG7A 3EWSA 4JVLA 1BS1A 1HLGA 1PGNA 2CLSA 2CNKA 2H07A 4XJTA 2R6JA 1EJ0A 4PC7A 1CVLA 3H9GA 2CBGA 5A3SA 1KQNA 4N5DA 1XKXA 4QXRA 4YA6A 2A0UA 1VP3A 2P68A 3FDZA 4JJZA 5DTQA 3WGOA 2CVOA 3HU5A 10MHA 5A1TA 3VDQA 2OYRA 3IAS1 4CXMA 1I4LD 1KETA 1SK8A 3MAGA 2P6NA 1CUBA 1NUTA 3E9RA 1QGED 3IQFA 1H0SA 4M46A 4QELA 2ZI9A 1CJVC 2JLCA 2H1OA 1A8PA 1ZU4A 2NGRA 4K9LA 2B20A 1LPPA 1US8A 3GDWA 4OL9A 2SCUB 3VAZA 1HDZA 2AYZA 1HE1C 3DWEX 3OAAA 4LHXA 4TXMA 4YY3B 1RCUA 4FGKA 3C4JA 1NY6A 2C5GA 4LTNA 1XDUA 1A98A 2B8WA 4FW9A 5JYDA 4AMBA 1A2KC 1EK2A 4P2BA 2FFRA 5DT9A 4BIIA 4FGLA 2CD7A 3F8SA 4JLJA 4QQFA 2BGRA 1W0CA 4CV3A 1H2EA 1QR2A 3LQ1A 1JDPA 2ON6A 1PGQA 3RVRA 4RTOA 3L0ZA 4L6AA 4N18A 4QDOA 4WXHA 5B53A 2C0CA 3JW8A 3NBQA 1DMSA 5CCDA 3WHIA 4TKVA 1U28C 2EIXA 2R7LA 3BWYA 5F3WB 1BTOA 1TL7C 4TLMB 4OBWA 3T7DA 3W9BA 1CJKC 2YZMA 5H4GA 5K0CA 3S8EA 4I9NA 4BGDA 4ILEA 3VTKA 1W93A 2R8PA 1RRKA 1F0PA 1ZESA 4B8WA 1IXSB 1F4LA 1GTRA 3BZUA 2VT6A 2TSYB 3DE3X 3P2JA 3L6CA 3RAEC 4FBGA 5HFAA 4DUYB 3UEJA 1HZJA 3QKWA 5CPBA 3SQNA 4WY8A 5IABA 3PCXA 5K0FA 4R8MA 4KGDA 1C3JA 3LHKA 1XD8A 2ZIVB 3E3AA 4P3XA 5EKSA 1I6KA 1XZHA 3ZCSA 4LW8A 2YQ5A 4B43A 5FUXA 4B6QA 4HEJA 4CDNA 2PEYA 2GM5A 2IOHA 5EQDA 1XQWA 1J5PA 2P27A 2JLZA 2PX3A 3KL4A 2IH4A 2XUFA 1D2HA 1MO6A 1PR0A 5JFOA 3G82C 4L4RA 4M98A 5JAUA 3NIFB 2VNSA 1ZSYA 2XKBA 2ZBFA 3NORA 4M0MA 4YLEA 2JIPA 1EVKA 3HXOA 4NJOA 1R0XA 4WZZA 5KYYB 1QONA 3NIWA 5F33A 4E5VA 2D2XA 1BGVA 3HV0A 3E1SA 5EVCA 2XVXA 3WXBA 2IHNA 3VHRA 1BH2A 1L5QA 3P27A 3PQ8A 3DHNA 1YQ9A 2CHVA 2JVKA 2UZ0A 4GEKA 5KU7A 5E4FA 2H5JA 4R16A 3C5WP 3O82A 2NACA 3PQCA 4P4TA 4PG6A 2CFCA 4FYVA 3P26A 3T3MB 1J7JA 3WGHA 2HA0A 2I91A 2CLLB 5ARCA 5IBPA 4RHCA 1KYVA 2FQWA 4GYWA 3EWAA 3IDZA 3N8HA 4UU1A 5K45A 1P75A 1G5TA 2ZS7A 3HJTA 4M8NE 2WTAA 3Q6IA 3VPGA 2QR5A 1J0XO 3R7WA 3U3XA 2C4VA 1FQOA 4BVKA 3WXMA 3CPHA 2ZCUA 1HV8A 1N7GA 2G9ZA 4G81A 3RF7A 4BNWA 4E07A 1CW2B 2GZDA 4O29A 1CUWA 2DFNA 2FPOA 4EVSA 3HKDA 3S2YA 3MGKA 2AHOA 1PFQA 1A7KA 4RVNA 2O0HA 2HWWA 3G8AA 4LY3A 4D0GA 1KJZA 1W5TA 4FLMA 4J90A 4FNGA 4OJYA 3V80A 2Z4RA 3QFRA 5KYUB 3BWMA 4JL8A 4OY3A 4HEA6 1TCBA 4YP6A 2BGKA 4HDKB 1CEYA 1J49A 1E2DA 1UR5A 1ZICA 2ZSBA 2P1DA 5LQJA 3H9QA 1ES9A 1CZRA 2RAPA 1PR2A 1X3SA 2A57A 3BHMA 3R6LA 4OQZA 4BJ1A 2FR0A 5JU6A 3GDFA 1B41A 4Q1FA 5LDDC 2ZB2A 1V2HE 2QRJA 1JIXA 4FPXA 4HR7A 1NOIA 4B3TB 4DY4A 5FTKA 2QMHA 2ZIXA 3IA7A 3WAKA 4MGKR 1DMRA 1JU4A 2CZQA 3V1KA 3N2KA 5IVPA 4FWTA 1A77A 1T2VA 4FBMA 2B7CA 3TNLA 4K2HA 5EHGA 4Q9IA 3GLIA 5DDIP 4E46A 2I4LA 3QXCA 2B1GA 4G1EB 4XQGA 5JAPA 1AXRA 3I8SA 4HWKA 2CJWA 4UTNA 3K9CA 5E1DA 3FUUA 4IEEA 3ITDA 5KNCH 1LY1A 2I71A 3MUNA 3IP1A 3GUHA 2P2ZA 2B4QA 3JYQA 3UQZA 4N5MA 4HAUA 5BWBA 3D7MA 4CT4B 4FS3A 4GWLA 3GHYA 3ZU4A 4XWAA 3V4PB 3REFA 3RUHA 1Y98A 3ZBTA 1UWLA 1UUCA 1G7CA 2P9QA 1R6BX 5AJHA 2X3UA 4AO6A 2F1KA 1N92A 4D8TA 3L7AA 3N2YA 2HRQA 1E98A 5EYPA 5ES4B 1LRLA 3HYTA 3CMMA 1H0ZA 1J8FA 2WHPA 4MEJA 2PQ0A 4JFRA 2JLXA 1A7UA 5B4VA 3HVKA 3HLTA 1UK7A 3FFWA 4PONA 1LPBB 1MRZA 4A8JB 4UEOA 3SFZA 4YRRA 4U7WA 2CLCX 3MFYA 4EYEA 2YCLA 5BR8B 3UMBA 1O6GA 4ZCPA 1XAJA 3E48A 3ZHXA 1QFZA 2IYEA 3VC3A 4BZWA 4E6EA 5ADHA 2NU8B 3NW9A 4QQ8A 1FS4A 4RQUA 3GA7A 5A4KA 1NDUA 1P60A 1T0HB 1OXVA 3L7BA 3ZLBA 2P6AC 3VSAA 1T8YA 3GFFA 3ZWPA 4DDMA 4QUAA 4C4OA 4EG1A 5H7XA 2BWJA 2Q3EA 4B3XA 2IU6A 4I6JA 1OWLA 1VI5A 2OVBA 3H8VA 4OQPA 1GZUA 4G9EA 4RXUA 3QK7A 4G24A 3ZVLA 5KNCD 4W5RA 2FF5A 4PBTA 4RTPA 4GLLA 3OQOA 2HRDA 4UNRA 1RXIA 1QQ5A 1S96A 3KWLA 3W2IA 1ZVMA 1KK3A 1L3BA 1TZMA 1Q16A 3UGDA 1RZV