2ORWA

Thermotoga maritima thymidine kinase 1 like enzyme in complex with tp4a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
171
Chain Sequence
SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKHSTMIVSGVEAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEIDVGGQEKYIAVCRDCYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidine kinase
publication title Binding of ATP to TK1-like Enzymes Is Associated with a Conformational Change in the Quaternary Structure.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 55
structure length 171
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2orwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2orwA01
4Q4HA 3T12A 1NKSA 5DH9A 2V7QD 2ZI6A 3NWJA 5KDDA 3GLGB 1S2MA 4UNNA 2QA5A 3SE0A 1W36B 1ONBA 3W5JA 2GF0A 2BMJA 3CH4B 2ZM5A 1JJ7A 3NIBA 4BFSA 1E9RA 4ABYA 4TL9A 2KJQA 5JFGA 1AN0A 3WRXC 1HQCA 2IF0A 1J7KA 3A37A 4NL4H 1P72A 1NMYA 4WZ6A 1IOZA 1PLKA 3PQCA 3ADCA 1NVXQ 5AUNB 2BC9A 1Z0FA 4NYIR 4PPGA 1U9IA 1E1RA 3KL4A 2OHFA 1MO5A 3CRMA 3K9HA 3N2EA 4RFSA 5HR5A 3VNUA 2GXUA 1EWRA 4C0QC 2O8BA 4TSFD 1GNPA 3FHCB 1ESNA 2ZSEA 3WRYC 3VKWA 1ZBDA 1PTQA 2BMFA 3OZXA 4DCVA 1BYIA 3K0CA 4IOJA 1DG3A 1ZC3A 4B33A 4RCZA 2UVQA 4JVLA 4URXR 3VR1A 3CRVA 2XZOA 2I3BA 4NYJR 4B2LA 2BDTA 3BH0A 3LH5A 3GLHB 4U5XA 1AS2A 4TZ0A 3R8CA 1ZNWA 1ZRHA 1Z0DA 3RRZA 1PUIA 3IBGA 4PHHA 4XIGS 4Q21A 2FN4A 1NIJA 2WVJA 2J0UB 3TAHA 5CK5A 4ON9A 3LW8A 3U7EB 3TE6A 1BO6A 3GJ3A 4MRRA 2ZXUA 1NMZA 1MO3A 4KV9A 2WWFA 3AF3A 5KNDA 2ODBA 4OI0A 5HE8A 2JA1A 4KLZA 2QP3A 4FCVA 1AGRA 5H8WA 4TYYA 2WICA 2REXB 1X8KA 1TEXA 3NEJA 4PHGA 3UEJA 2GXQA 1EX6A 3QKSB 2ZRLA 3J81k 1Z6TA 3PUXA 4M1MA 5DYGA 1GSIA 5CDFA 1TQ6A 5LPNA 1YR8A 4BLSA 2VA8A 2JAQA 3B2EA 3CRRA 3HYTA 1U8YA 2OFWA 4X8LA 4HEJA 5JHHB 5FTKA 1SVLA 1XMJA 2NOAA 3L82B 1IM2A 4Q18A 3UFFA 4BLPA 2B6HA 2RMKA 2VLIA 2CDNA 3I3SR 3NC0C 4JLDA 4B48A 4PQRA 4G5RA 1CU1A 5C4MA 3DZ8A 3LA6A 3VU9B 3W8RA 1QRAA 2XITA 1JR3D 1DO2A 1HA3A 4IVQA 3SBEA 3I5YA 2Q9CA 1VIAA 1EESA 3ZGXA 1DAEA 4PPNA 2IEYA 5IRCD 2X19A 4R2HA 2ODWA 1XEXA 3TLXA 2QBYA 5E7IA 3BBPA 4AY2A 3QF4A 4KSCA 1FAQA 3TJZA 2JLSA 1TX4B 2ZUCA 2D2FA 2J5XA 4DCTA 5KU1A 1VDZA 1FQJA 4M22A 2KWIA 2D3WA 2QAGA 1GRNA 4Q4JB 2UZ3A 4W7SA 1SXJE 3CWQA 1Z6YA 4DLUA 3GLIE 2EFCB 3MAAC 1XXHB 4XD7A 1E9BA 2DFLA 2ZQ5A 4DSTA 1SGWA 4LBVA 1N6LA 1G18A 621PA 5H1YA 4BFYA 1EFUA 4Q00A 4JZKA 3LLUA 2QRZA 3LVRE 1M1YE 1H8HA 2XNDD 3K8YA 3NBYC 5DISB 2J87A 3PEWA 4Q9HA 4A0GA 2WJIA 1HUQA 3OIYA 2FFQA 2HDNB 4A36A 2NTYC 1QHSA 1GL9B 1XDBA 1ZIPA 4KVAA 3T1OA 2ZRBA 2OCPA 4AURA 3DOFA 4TMTA 5BQ5A 2XZPA 2FA9A 1OLOA 5G41A 2BJWA 2CVHA 2GILA 3VHLB 4A6PA 4DRZA 4DSOA 1ZCAA 2O8EB 2BVNA 2ZSFA 1Z63A 2ZJBA 4L15A 1A2BA 1LF0A 1S9DA 2GHIA 4FMDB 5KUTA 5BXQC 5FI1B 1J8MF 3DVLA 1KDPA 1XEWY 1O3YA 2QMEA 4QGAA 3GFPA 1OT3A 4AG6A 2Q6TA 2FF7A 2ENZA 4TTQA 1GIAA 2GJAA 2OFXA 3DDCA 3RSLA 4D81A 2ZI4A 3EIEA 1Z07A 1G41A 4TT3A 1N2CE 1NL3A 1NVUQ 2CL7X 2NG1A 3F5FA 4MKGA 1I2DA 1UAAA 2WPDD 1U2RA 4Q1FA 5FBQB 2FV8A 4URZR 2CVFA 4K46A 1L4UA 1TQ4A 3KXLA 3VMFA 3VX4A 1KO8A 1KDRA 1E99A 1KK2A 1M8PA 2CJWA 4J0QA 2YHSA 2AWNA 5UKDA 3QG1A 1Z2CA 2D7CA 5GVRA 2G9NA 2VIIA 1PTRA 1OB2A 2V9PA 5K8TA 2D2EA 2YZ2A 2RGEA 4QBHA 2ZRKA 1KOFA 1OH8A 1E2QA 4I1SA 2H18A 2ZJ5A 3BOSA 1HTWA 3CF0A 4F4CA 1GM5A 2W0MA 1HE8B 1CTQA 1VG8A 4NBSA 1A7JA 3U5ZB 4BLRA 3Q85A 3AVPA 4LJ6A 2YNMA 1ZUIA 2IYWA 4EPYA 2QPOA 4LOAA 3ICQB 1Y3AA 5E95A 4NDZA 5TY0A 1YR7A 4C0JA 1NY6A 1N6RA 3EW9A 2YOGA 4XTCS 3K0FA 2O0JA 4JT4A 2E87A 2EFGA 3FFAA 4HYYA 1ZMXA 4LGMA 2CHQA 3LY5A 3WYFA 1TMKA 4NZYA 5JECA 2GEVA 5AR1A 1A82A 1FFHA 2DFNA 1OXTA 4M1SA 4O25A 1ZC4A 2VP2A 3QXJA 3SS8A 1F2TB 2QTVB 3T1QA 1OH6A 4IHQA 4A0FA 4FWIB 4W9MC 1CP2A 3P27A 1Q21A 2AFHE 2QI9C 4ZI2A 2AD5A 4I1VA 4RKEA 1Z0AA 4AYTA 4UXHA 3K0SA 4DJTA 3ECCA 2EU8A 4Q48A 1CEEA 4PZLA 2XJ4A 4JLBA 1S9HA 4D4KA 2V8OA 1W4BA 2F1RA 2NO7A 3AB3A 2A5GA 4L8GA 1XX6A 1PUJA 1N6HA 3BFKA 3D7MA 3TR5A 1X3SA 2PLRA 1Z0IA 4HAZA 4ZO4A 1YZGA 1P3JA 4AYXA 2GZHA 5TMPA 4Q4HB 3ICEA 2ZEJA 3LO5A 4M8NE 1QG4A 3P1JA 4LJAA 2ZR0A 121PA 1T0HB 3DM5A 3MLEA 4NHOA 3IHWA 4KYIB 2B92A 3HPQA 3FWYA 2IS6A 4MUBA 5JS7A 2C8VA 2ZAOA 1Z0JA 1T3LA 1NN3A 2QM7A 1MT0A 2REBA 4M9XA 1N5LA 4LK2A 4A4DA 3HJNA 1JAHA 2B21A 2IYLD 2Q0HA 3ZS8A 4H9GA 2GVZC 1LV7A 3RSOA 4A8JC 2QT1A 4DEYA 4KI0A 2OBNA 2AK3A 1OKKA 1OH5A 1ZM7A 2ZE6A 2PT7A 4ERNA 1VHTA 3QPWA 3A4MA 2P67A 2CNWD 3WHLA 1AKEA 1ZU4A 3A1VA 4YLGA 2D7DA 1HURA 1O87A 3S1AA 4RFSB 4RD0A 5CIWA 4IEIA 1FP6A 3IQXA 2REOA 2O8BB 2FWRA 1E79D 1T5LA 2W58A 3B82A 4PHFA 2G6BA 1U99A 5AWFC 1XTIA 3NKVA 4L16A 1P7CA 1SULA 4BLQA 2A5JA 1KZ7B 2GAAA 1OPXA 5EP3A 2XZLA 4WW0A 1ZNYA 3THWA 2P65A 4IDOA 1OHHD 3U4QB 3CZQA 1T8TA 3PR1A 1G8HA 3U44A 3AVYA 1X8LA 2IYRA 4BASA 3KJIA 4JLOA 2J1LA 2ZVPX 1XFAA 3OEHA 1P75A 3D6TB 4DDWA 3MWJA 3ND9A 4LYAA 3EARA 1QF9A 4R7ZA 2GAOA 5BYJA 1IN6A 5HKKA 5C18A 4A8JB 1S3GA 1G5TA 3A1TA 2YUUA 3QQ5A 2GBLA 2QAGC 3CW2A 3Q7QA 1RRGA 3BFVA 2QU8A 3HU1A 4Q1DA 2F3RA 2B8TA 1H65A 3ZS9A 5L3RA 3WBJA 2CHVA 3M4YA 2PX3A 1OXVA 1SVMA 2ZREA 3MUFA 4MKIA 1KK0A 1WCV1 2PX0A 3W90A 1GITA 5L3VA 2VSFA 1E4YA 3T06B 3VKHA 2WJGA 2BBSA 4TLAA 3ZYCA 4CRWB 1OIVA 3FGNA 1XTKA 4UXJA 2CLDX 3FFBA 1ZD8A 1G16A 2DWOA 5ANRB 2MSCB 5L3SA 3I61A 3C7KA 1W4RA 8OHMA 3U3KA 2JLYA 1QHIA 2C2HA 2DFTA 5EP2A 2J0VA 4YC7A 2CCGA 4NYMQ 4JKIA 4ZKEA 1YZLA 2ZUBA 4MUAA 3W6OA 3O8RA 1E96A 1SXJC 4RZ2A 1HT2E 1ODFA 1W46A 1CJVC 3U7FB 2WIAA 3LNCA 2VO1A 1FTNA 1G3UA 2GDJA 2RCNA 3OE7A 1XEXB 4URWR 2QBYB 5D3MA 3E2IA 4TMXA 3QF4B 5SZKB 1M7HA 2C04A 1OB5A 2ZR9A 1IN7A 4B47A 3QPVA 2CLCX 1KMQA 2GNOA 5LD2C 2QAGB 2VP0A 1E0SA 2F6RA 3UATA 2PEZA 2PMKA 1ZYUA 1CIPA 2GCNA 2XOKD 3O8BA 2RGNC 4M1KA 4D4JA 2O5VA 2H16A 1UBFA 2PBRA 1TF7A 5KSYA 3WMEA 3I92A 4TWZA 1EFRA 5FOWA 2HLDD 3K0EA 2DWQA 1G8PA 2Z0MA 1KHTA 4KVGA 5B64A 5LDDC 3DOEA 2FMXA 1KSFX 1GNRA 2BBOA 3T5DA 2D74A 3GFOA 4A1FA 3MJHA 4D2IA 3AP2A 4K81B 4B3GA 1GKIA 1EFTA 4Z8YA 4GI7A 4QHYA 1P2SA 4M9QA 3CUEF 4WOPA 4A0RA 4YONB 1JPJA 1G9XA 1KSGA 4XWKA 3KKMA 2ZS7A 2ZJAA 1AS3A 1CJUC 1QHYA 2HYDA 4I1UA 5KSPA 4B32A 1YJ5A 1P60A 3F8TA 1G6HA 5JWOA 1IY2A 4FMCB 3GLIB 1G17A 2XTNA 4DHEA 1MABA 2IHBA 1IBRA 1IXRC 4DUGD 1YE8A 3REGA 3EAQA 4CVNA 4NCJA 4XWOA 3QG5A 3HWSA 1S96A 3SQXA 3RS4A 2Q3FA 2FE4A 4NE2A 2GK7A 3TK1A 2X77A 3K70D 1RJ9A 2F9LA 5E3HA 4PPQA 3B60A 3JVVA 3QNUA 2JEOA 3Q3JB 1RW4A 1IN4A 2FDCA 4KITB 5KPDA 5BWMA 2A30A 1ZUNB 2D4HA 3GLFE 4QGFA 521PA 1HV8A 4LJ4A 1HYQA 4ACAA 4C30A 4B3CA 2OUKA 4ILEA 4P4TA 2CEAA 2QMUA 4R2IA 2YYZA 3U3MA 1EXMA 5J4LA 1AM4D 2ZRFA 2FNAA 4QJ5A 5E7MA 4PC3A 2CJWB 5FPYA 1JBKA 4V0ME 3I1FA 3TMKA 1Q22A 1XEWX 1S4QA 1Z29A 5DN6D 3AF1A 3OEEA 3EZ9A 3Q5DA 4G0NA 5GJWC 1NBMD 3TUJC 2Z43A 3BB1A 3FE2A 4RCYA 4V0KA 5BN3A 2H7VA 4WAUA 1QHHA 2CK3D 1GKUB 4DLZA 2WAXA 4LHZA 3UMFA 2WHXA 3HR7A 3D3QA 4RZUA 3C15C 3CKLA 1ZU5A 4N3NA 4DLSA 4EQ6A 1TNDA 4F38A 2DWPA 3KX2A 3RLFA 1DEKA 3UPUA 2WSMA 3FMPB 1XMVA 4F4JA 2NZJA 1G5PA 4TMVA 3RABA 2WKQA 2IS4A 4V03A 2AL7A 2P3SA 2VP4A 1Q0UA 3GQBA 4GBMA 1W36D 3K0FB 3EC1A 2FZ4A 2O8EA 2FSIA 4Q9KA 1H8EA 3PEUA 1II9A 2VHJA 3UGDA 1RE0A 2WSSA 1E1QD 2FPMA 3R9XA 3UG7A 3CF2A 5BW8A 1TUEA 2GTPA 3GD7A 3O8DA 2BEJA 4LHYA 1OW3B 3NBFA 5C1BA 4TMWA 3X1DA 1F2UA 1VPLA 1ZNZA 2ERXA 4Q9LA 4V0OA 1DE0A 4G5GA 5FH9A 4NTZA 1TQ2A 1VYVA 4ZV4A 3MWKA 5JJLA 3LBIA 3THXA 3AVXA 2J9RA 5HTKA 4LC0A 2JLQA 1RVDA 3AF4A 4EPVA 1KI9A 2CE2X 4LYFA 2ZPTX 1II8A 2CL0X 4JLPA 3T15A 3IUYA 2HJVA 4F92B 4CW7A 1IXSB 1XD2A 2GETA 2OXCA 4JLJA 4QL3A 1KY3A 4GOXA 3EPHA 4GDFA 2QEQA 1JQJC 1RYFA 2ZYTX 2BIFA 5AJXA 3THOA 3AP3A 3KB2A 5DYIA 1A5TA 1CR0A 1PLJA 1DAHA 2Z5FA 4LC1A 2WAYA 3RS2A 3QXCA 1EGAA 2QY9A 3DMNA 4Q7JB 1GNQA 4UNSA 1TU4A 1G6OA 2F3TA 5G3YA 5GJBA 4BQSA 4OKSA 3L0OA 1XJCA 2R6DA 2ZRCA 2O0HA 1M34E 3S1AB 3FB4A 1W0KD 4TLDA 4EJSC 1CULC 1VCNA 3OIVA 3CM0A 3LWNA 3EIHA 4PPFA 5C2JB 1JR3E 1JQLB 2A2ZA 1OH7A 1R0YA 2MSDB 3RRNA 1XMIA 1NVVQ 2PCJA 5L8VA 1X6VA 4A92A 3FMFA 3IPYA 2CE7A 4JLVA 1OXUA 4DSUA 1VHLA 3CNOA 5TVKA 3LAWA 1ZUHA 3U44B 2RGGA 1W44A 5IK2A 1U8AA 2G77B 3ZIAD 4QC2A 4C0SA 1E3MA 1NNEA 4DLRA 2WBLC 4MYUA 5B2ZA 2KBFA 5CITA 2BHRA 2OESA 2W6ID 1CJKC 1E4VA 1T8UA 4B75A 3NH9A 3LW7A 3GJ5A 4GP6A 2WJJA 5FBRB 4HLUC 5CLQA 4Q9IA 4XJXA 1G21E 1N5KA 4OQFA 4BFTA 1WBBA 1G291 4OQMA 2W2VA 3PUYA 4DIDA 3KXIA 3IEVA 3FYHA 2IL1A 3M6AA 4DSNA 4POAA 3BIFA 2N1BA 4LBZA 4B76A 3FVQA 3MG9A 4LCBA 4BFXA 4QNMA 5JCZA 2IWRA 4JLMA 1CRQA 2YC2C 2X2FA 4BFZA 2GCPA 1GRQA 1JECA 4X8HA 2ZE8A 2IK8A 4U00A 1G3RA 4OI1A 5K8IA 1IY0A 2CHGA 2A5DA 4MRVA 5L3SB 4G01B 1DARA 1XPOA 1IJEA 4UNPA 2ELIA 4YXWD 1EWQA 3SC3A 4NMMA 5P21A 2H5EA 2QENA 4IOLA 2E9SA 1GWNA 4R71A 1JXMA 5TARA 4IEEA 2ZRAA 4P0TA 5HE9A 3LD9A 4IKEA 3KUDA 3R7WB 4DLTA 2J0SA 3EXAA 1H8ED 1LFDB 4PZZA 221PA 3BRWD 1XMSA 2A7QA 3MMPA 3B1VA 3B9QA 3MWLA 2L0XA 5D3MB 4W5HA 5EE5B 4YMUA 2SHKA 1CJMA 2C99A 1KMHA 5FPSA 1BMFD 2VRWA 4HB3A 4A82A 4D6PA 1Z8FA 3EPJA 5EXTA 3IIJA 4D0NA 2RGAA 1OFTA 2OV2A 4BEJA 4M2LA 3AKDA 4GOKA 1KK3A 1JXOA 3B85A 5DLQC 4HDCA 3X1WA 2FH5B 3M1IA 4Q03A 1Z06A 4OBEA 5FPKA 4TN1A 1NP6A 3EASA 4YMWA 5JSZB 4JMPA 1P5ZB 4OQNA 4U02A 4D0GA 3U4QA 1UADA 4UNQA 5BN4A 2ZJ8A 4DLWA 1GKYA 3IBYA 1UDXA 4OYHA 1R0XA 1KO5A 3U6BA 1A1VA 2J7PA 1JB1A 5J4HA 1JALA 3BFXA 5JRZA 4IFEA 2QAJA 4OK3A 3RDPA 1NLFA 4ACBA 4EFLA 1OIXA 4JS0A 2CBZA 4Z51A 3ZQJA 4RSGA 4A8JA 4DLYA 1UDWA 2Z6VA 3NHAA 1R2QA 5SZIA 1KJZA 4QFMA 2AN9A 3KQKA 2BMDA 3V00A 3P4XA 4M1WA 1KO7A 2W83A 2X2EA 4KU4A 1MABB 1N3BA 1RFHA 3LBNA 1TAGA 1ZW6A 2DYKA 3SI7A 1Q1BA 1UKVY 1WP9A 1COWD 5FR2A 1E94E 2J59A 1AIPA 4EPXA 3RAPR 4LSGA 1S1MA 3L0PA 1E9FA 1RJ9B 3WMFA 3LQQA 4E09A 2G1KA 1JI0A 3QJYA 1DVRA 1OF1A 5EZ5A 5J5CA 4ARZA 1OFUX 3A1WA 4QG7A 3W3AA 2IX3A 4TMZA 5CYOA 4E03A 5FOXA 2DCUA 3TW4A 4B74A 1E6CA 1FOEB 3E70C 3P26A 2WMOB 3OAAA 1JEEA 3K53A 4QNRA 3FOZA 1JNYA 1G3MA 3KY9A 1U0JA 3WXMA 1DELA 1DS6A 3KKQA 1W0JD 2JDID 1F6BA 1NJGA 3SJBA 4JLKA 1BYUA 2IUUA 1XBTA 5FTNA 2X8AA 2CXXA 1VECA 1W48A 2ZI5A 4QHSA 3Q72A 3HU2A 5C46F 3TGPA 1D9ZA 1QHHB 4NYIQ 3QPUA 1N0UA 2FFAA 3ADKA 3FKSA 3LX5A 1KI1A 1Q20A 3IILA 1XJ0A 1VKJA 4WXPA 2BEKA 1B0UA 4JSTA 3W8NA 4EQ6B 4ZCMA 4MKHA 5CM8B 3RS3A 1XA6A 1OIWA 4NCIA 2JLUA 5CK4A 2JJ2A 5JBQA 1HY3A 2F55A 3WNBA 4PO9A 3UKDA 1E9SA 4E22A 2GK6A 4UXIA 4V0LA 2V55B 4NYJQ 2CCKA 3HYRA 5FUXA 4FKDA 1V43A 4FXPA 2BJVA 1P6XA 2AXNA 4JBWA 1SXJA 2VBCA 4HAYA 2CMKA 3U61B 3VKGA 3AUYA 3UIEA 3GLIA 3AKYA 1J8YF 4UNRA 3OIUA 3AVUA 4CDGA 5JI2E 4HAXA 2IHYA 1GILA 2QQ0A 2ZSAA 1DAFA 4Q47A 5KHOC 2KBEA 2C96A 1ZVQA 5B57C 2WZQA 1AK2A 3LXXA 5GJVC 1LNZA 3A1UA 4XVRA 1E1RD 4FINA 4E5UA 2PLFA 1F2UB 4FCWA 4GNKA 4TYPA 2RGNA 1FX0A 2HUPA 1UF9A 4BGDA 4MDEA 1UFQA 3W5IA 4DEXA 3THXB 4QM7A 5FBLB 3EZ7A 1DAIA 5H70A 4MRPA 5FI0B 1SHZA 1RFLA 3ETLA 4LWZA 4AKHA 2NO0A 2VP6A 5EE9A 1II8B 4HZUA 2QT0A 5DE3A 1NY5A 1ZCBA 5DI9A 3IO5A 2JIZA 1P9WA 3AH8A 1YQTA 4I99A 5A5GA 3QXXA 1XD2B 2BCGY 2PZFA 1XCMA 4RD2A 4O2RA 1MRNA 1M2OB 1KKMA 3IPXA 4I4LA 3TAUA 4ZI3A 2P6RA 1Z47A 4PXAA 4D25A 3CO5A 2NQ2C 4H1VA 5E4FA 3R9IA 2FPLA 1F48A 1II0A 1UKYA 3SBDA 4PO8A 4W5WA 1N6IA 3IIKA 4JLAA 3I62A 5J47A 1E32A 1QVRA 1KGDA 2ZI7A 1FARA 1SVOA 2RB4A 4AI6A 3HR8A 4RD3A 4B44A 1VTKA 4OI2A 1JAIA 1D5CA 2R6AA 3CLVA 2G0NA 1E9DA 4IVRA 4URYR 1UEJA 1OJLA 4OL0A 3NVAA 3UK6A 3QKTA 3I32A 4EFNA 1P4SA 1TF5A 3H2YA 3LV8A 5FUWA 4MRNA 3AVVA 2JGNA 1IHUA 2J46A 3V4RA 3FDIA 1TF2A 4P3YA 4OK6A 2IXGA 5L3QA 1R5BA 2ODNA 3RYTC 3B1WA 1ZJ6A 4NCNA 1M7GA 5J40A 3TRFA 1P61B 1Z5ZA 2W00A 3N2IA 1KTVA 5KDLA 3PIRA 2IUTA 3GJ4A 3SHFA 2WJVA 3HU3A 3QSYA 4DCUA 2KSQA 2IWHA 2QGNA 1L4YA 3BB4A 3QENA 2HF9A 2R6CA 2ZE7A 5AUQA 1DBSA 1YRAA 3MSXA 4M1YA 2WMNB 5IT5A 4TYWA 1E2GA 5JI3E 4TZ6A 1I4DD 3KJGA 1AJEA 1C1YA 4XD7D 3DPUA 3P32A 1CXZA 3ZQ6A 1SVWA 4RKFA 1I4TD 4Q7KA 2VHCA 1GDDA 2Z4SA 1FNNA 4OHZA 1SKYB 3B78A 5AJYA 3TNFA 2QPTA 3O8CA 3TUIC 4HAWA 1VCIA 1FTSA 1H8HD 1OXSC 3CB4A 4IOMA 3AUXA 5AK0A 5EZ6B 2ERYA 1GUAA 5F3WB 2NMVA 1E98A 3EZ2A 5KYKA 3K09C 3K0AB 4PAQA 3A36A 4LX0A 3NDPA 4M9SA 4PC2A 4DXAA 1SKQA 1ELOA 1HH4A 3AVWA 2ZRGA 4ASUA 1C4OA 1B23P 5KNCA 1D9XA 3A6PC 4AC9A 4R9UC 1KMHB 4QRHA 2IA5A 2VRWB 4GP7A 4RFVA 2ENNA 2HV8A 3R8FA 1Z0KA 4M1TA 1E69A 1KO1A 1XCGB 3EZFA 2V6IA 4Q1AA 4A0HA 4BZPA 1CLUA 4TT3D 2DBYA 2D06A 2RGDA 2NPIA 4MDFA 2AKAB 1Z83A 4D4LA 1NVWQ 2XB4A 1ZM2A 1NBME 4JL5A 3GEHA 3H86A 2X1VA 4IOKA 1T6NA 1ANKA 4C4PA 2VL7A 5BYKA 1OE0A 1Q3TA 2Z4RA 3FPAA 721PA 1W7AA 2ZYVX 2ONKA 2G88A 2IYZA 4AWXA 2R6GA 3BXZA 3I4LA 4CGZA 2RKOA 3M0EA 421PA 1CKEA 5HZHA 3B1ZA 4BFUA 4YDHB 3FHOA 4G5QA 3VHXA 2GEDA 2FEMA 1GTVA 1UJ2A 4EJSA 2QRNA 2ANBA 2GZDA 3GLGE 3BC1A 1OSNA 4LV6A 4PAMA 4FW9A 5CJPA 3TIFA 3ADBA 4NU0A 3CF6R 3RHFA 4LBWA 5HCIA 2XSZA 4IFBA 4MGYR 1GL7A 4MITA 1OFHA 4ARZB 3CPEA 5M04A 2NZ8A 2ONJA 2ZETA 2QMHA 3CIOA 4O0MA 4E07A 1R5NA 2C77A 1S1CA 3B13B 1MKYA 4V02A 1EX7A 3R7WA 4C0HA 3KJEA 1UEIA 4Q1CA 3I5XA 4WZBE 1ZINA 1KDTA 2HJGA 4DLVA 1KI2A 3SHWA 4EFMA 2NO9A 1GAJA 4CF7A 3NHBA 2QE7A 2VYFA 3CBQA 1WE2A 2ASEA 4HLUA 3UEYA 4IXNA 1G3QA 1V5WA 4TMKA 2RGXA 2VQSA 4JBXA 3F0TA 4HB0A 1WQ1R 2C9CA 2FGJA 5D3QA 2BKEA 2QP4A 5CLLA 3GEEA 2IEZA 5LBIA 2ZANA 3GLHE 3WYGA 1E2KA 1US8A 2W6JA 5JSZA 1GL6A 4LJ5A 4DCSA 4F93B 1CBUA 1NG1A 4PHTA 5EQTA 3I73A 2B7CA 2O0KA 3AV0B 1DAMA 1VCOA 4TTRA 2O52A 3BERA 2GESA 4QGHA 3CWZA 5JJIA 1RPZA 2QG6A 1YZQA 4MH0R 3L8YA 3THYB 3EIQA 3WMGA 3F3YA 4M53A 2Q3MA 2IS2A 3H1TA 5F2EA 1QVAA 2FX3A 2VEDA 3QIAA 1Z22A 4QBFA 1SXJB 5C4GB 4OQXA 3DMDA 4Q5IA 1S3SA 4LJ7A 5E7JA 4PSAA 3TQFA 2NO6A 2EFHB 4TL7A 4EPTA 3MGCA 4IJMA 2IYQA 4UJ5A 2BWJA 1OKKD 1FMJA 1F60A 1FP7A 5TB5A 1VMAA 4UKDA 3UGLA 2FSHA 3T34A 1KJYA 4GPTA 5LD2B 4ZIRA 4MYHA 2ORIA 3NBZC 1Z6GA 2IXFA 3AGPA 1FX0B 3ZVMA 3CRQA 5KNBA 3E1SA 3Q9LA 2F1HA 3RS7A 2XGJA 2VP9A 3OF5A 1YVDA 5DO9A 3UG6A 2FSGA 3SFVA 2V1UA 1E0AA 4HZUB 3B1YA 4KAXA 3LX8A 4URUR 3W34A 3NEYA 3OFNA 1P2UA 2W2XA 5TXGA 3IHLA 4CYMA 2LKDA 4Q1EA 3KUCA 5EUMA 3LLMA 1FW6A 1IXZA 2WWYA 3AKEA 1NKTA 4K8OA 3OEHD 3TKLA 1FPMA 2J45A 2JLWA 4KCGA 1XXHE 4X8MA 3BH6A 4LBYA 4LUCA 4OK5A 2A78A 2C5LA 5SZJA 5HKKD 2IW3A 2WIBA 2XEXA 2DR3A 2KI5A 1E0JA 4EPWA 3GLFA 1NLYA 1N6KA 5J4YA 3W9YA 3IEUA 3BK7A 4Z54A 3V9PA 2P5TB 1F5NA 3ZZ0A 2R62A 5K8LA 5FUYA 4MGIR 4HDQB 1P2VA 1NI3A 3EX7C 2BOVA 4HZIA 2QTFA 3WY9A 3GP8A 4V0MA 4JKYA 3GJXC 1VG1A 3DM9B 4WVFA 3UXMA 1R6BX 1OYWA 1LY1A 4F4IA 1SQ5A 2GJ9A 2ZRPA 3CONA 2YKGA 3PENA 1FMLA 1TADA 2ODEA 2OXRA 4KXFB 2JLXA 2V7QA 5FBVB 4NH0A 2VF8A 1M7BA 1AS0A 5FBWB 2I1VB 1P62B 3Q8XB 4TLEA 4Y0VA 5L3QB 2N46A 4XVUA 1KO4A 2RH5A 2ZJZA 2ZYUX 4DZZA 3EC2A 3SYKA 3OE7D 2XXAA 3U3OA 1T91A 1GZSA 1W5TA 3A58B 2A9KA 1RYHA 4P4SA 1YR9A 2OBLA 4B3XA 2EWWA 1NG9A 3CX8A 2KE5A 1E2JA 2E1RA 5FPTA 2YV5A 1F3OA 2HT6A 4L9SA 4XOIA 2FNFX 4KODA 4Q1BA 3WNCA 4D4MA 2QL6A 1G7TA 4TSFA 1EFRD 1E2HA 4OHVA 1N25A 2JJ8A 3T35A 3FMIA 4LPKA 3K70C 5IHPA 2OEPA 4MA4A 4QOSA 2O8FA 1CJTC 2AK2A 1T0JB 3IO3A 3EPLA 4PC1A 1HEIA 4JLNA 2IYUA 2YJTD 5DHFA 4Q66C 2ZS8A 1Q44A 5CM9C 2OG2A 3MRSA 3QKRA 4GZLA 1ZD9A 2AR7A 2HCBA 3ZJYA 1GRRA 1W47A 2EW1A 3I8XA 4FI3C 1YU9A 3TW8B 2OBMA 3AEZA 4BUJA 3N5CA 2ECKA 1ZD1A 3RVBA 2ZROA 2OLJA 1P2TA 2IBMA 2QGZA 3BJIC 1AKYA 4BECA 1KY2A 3C4JA 2XB2A 3T61A 1E2NA 4DDVA 1PVOA 2N42A 2OZEA 2JJ1A 4L5BA 2OILA 3FKQA 4KFUA 3OHMA 1G20E 3JVUA 3ASZA 4LPSA 4B35A 1G19A 5CB8A 4F91B 1P73A 2PMDA 1G4UR 4UQOA 4C3ZA 2Q9AA 5KTYA 2PZGA 4Z1MA 3UWKA 4C7OA 3VAAA 4OHWA 4RY2A 5AJWA 3TVTA 1J2JA 2Q21A 3AVOA 4TQ9A 3K9GA 3VFDA 4DDUA 4A15A 4L9WA 3VNVA 1W36C 4DIEA 2J0QA 4G3XA 1TL7C 3LXRA 4AIIA 1JR3A 4CEHA 3IIMA 1BH2A 3TSWA 3U6KA 1XTJA 3A1SA 1ZM9A 1X1SA 2ZE5A 3OEED 1VYTA 1W49A 1IJFA 1G8FA 2PJRA 3KQLA 1R7RA 2LKCA 1ZP6A 5CIQA 4CEJA 4EJSB 1E2EA 3LFUA 2C9YA 3B6EA 4LYJA 4QBIA 1WB9A 1TBOA 1W1WA 2ZU0C 4TLBA 1AQUA 4A2PA 3X1ZA 2R8RA 1KAGA 3K9NA 2YOFA 2ZAMA 2JLZA 2R6FA 3BH7A 3CR8A 3RC8A 2E73A 3KKNA 2BM1A 4GMXA 4YQFA 1KI7A 2B8WA 5EXPA 3FHTA 1KBEA 3V4FA 2QQEA 1I4LD 2QSYA 1XRJA 4ITRC 2ZITA 3K0AA 4R98A 3RNLA 2JLVA 5KPJA 2GXAA 3DKVA 1TBNA 1S8FA 4EPRA 1RRPA 4LV8B 2XNDA 3VR6A 3K9LA 3CRW1 1N6NA 1VG9B 3ONWA 3QI2A 5EP4A 2WSSD 4TQUS 3RRMA 4ESVA 3SQWA 1I2MA 5JCPA 4MQBA 1NSFA 4YDSA 1E9EA 2GWHA 5FTMA 2LWIA 1DOAA 4LJ9A 2OCAA 3ZVNA 1T9HA 4DWJA 2H17A 3NH6A 2BV3A 4PR0A 2YC4C 3NG1A 5JEDA 4WA7A 4A2WA 1US8B 3X2SA 5KSZA 4LI0A 4M9ZA 3I8SA 2QSZA 1JR6A 1ZAKA 1DAGA 2ZRMA 5A4JA 1MR3F 3OESA 1Q1EA 1VCMA 1LF5A 4M21A 2OSBA 1Q57A 3SN6A 3W6NA 3ZVLA 1WDTA 4EDHA 1VG0B 5FUVA 4LJ8A 2ORVA 4FWTA 3VR5A 4DB2A 2PCLA 3DL0A 4HLDA 3WNDA 2WPDA 1IQPA 2GJSA 3DEFA 3SYLA 3K09A 2EVWX 3LRPA 2HCJB 3BD9A 3TR0A 5CDFE 2AXPA 2IYVA 1P9RA 1R79A 4HUTA 2OCYC 3SU8A 1T5IA 4PAOA 5EXXA 2ATVA 4Q4AA 4LHWA 1VYUA 3RS0A 3PXGA 4D26A 2W0SA 3L8ZA 4PTLA 4DC9A 5JHGB 1KDOA 3GJ8A 1Z2AA 5EP1A 2ZS9A 2GA8A 1W5SA 4ZIRB 3UMSA 3G82C 5HPYB 1NSTA 4ZDJA 1G1MA 1X1RA 4BRUA 2ZTSA 1SVIA 1JJVA 2P2LA 3L0IB 3QVVA 4NCHA 2QTHA 1NRJB 1J70A 4TTPA 3UGIA 1MRSA 1N0WA 3N70A 4TL6A 2JJ1D 4LY6A 1KAOA 2BM0A 2IT1A 3LVQE 3PEVA 1TQDA 1E2FA 2YWFA 1K6MA 3CXLA 1KI4A 4Q01A 4WBSA 5FOVA 2F43A 1RRFA 4BZXA 5FOUA 4Z1MD 2UKDA 5IK2D 5F9FA 3PVSA 2WWIA 1WF3A 3KFVA 2ZSDA 2ZI3A 4I81A 3U7HB 1E0KA 2H92A 4FMDF 4JYCA 4TLCA 4AYWA 3KZ1E 4OJKA 4BFWA 1KSHA 4ZDKA 3VR3A 2WKRA 3RS5A 4G5SA 5B30A 4B43A 3GLFB 1BOFA 2O8CB 2DHRA 2IYXA 2YWEA 3BE4A 1YZTA 1L7VC 4LHXA 3SFZA 1DO0A 2OLKA 2HEIA 2WWWA 4QJ4A 2IYTA 3SJAA 3TH5A 1U98A 4FD2A 3B9PA 1JPNA 1NN1A 2QORA 4DT1A 3QXHA 3X1YA 3THYA 2AD1A 2FU5C 1XD8A 4M1OA 1Z3IX 2FPKA 2WWHA 4HSEA 1PZNA 3U3JA 3AVQA 4JJZA 5EJEA 3QVUA 2RGCA 5IF9A 4IDNA 4M4SA 2R65A 1IAQA 2FFBA 1CS4C 2FEOA 1UBCA 2GCOA 5JJKA 1YZNA 5ELXA 2WJHA 3ZVRA 1G7CA 4HDOB 4I1OA 2ORWA 2XJ9A 3KTAB 4PSVA 5AUOB 5KDOA 1OYYA 2OT3B 1RIFA 1TUIA 4Q02A 3MD0A 4JVNA 2JATA 4AKIA 2ZIAA 4KHZA 2XXAB 1L8QA 4NONA 1OFIA 2HYIC 5J4KA 3QEJA 4BLTA 4IDHA 5JRJA 3TUZC 3L2OB 3KKPA 4P4SB 4A2QA 3KKOA 3VR2A 4LHVA 5FPHA 3CNNA 3ND8A 1T4GA 4OI4A 4DLXA 4DB4A 3PCRB 2Q9BA 2CNWA 2CLSA 1CF4A 1AZSC 3I72A 1N6PA 2ZSBA 5A0FA 3ZZUA 2OO7A 1LS1A 2DB6A 3NXSA 5GADl 1E79A 4C9BA 4OHXA 2O8FB 2ZRJA 4HUQA 1WMSA 2RAPA 4N0EA 3WYAA 4TL8A 3GEIA 1WA5A 3SNHA 2XTMA 2J7PD 2GJ8A 5FFMA 1QHXA 5FOTA 2H57A 3P20A 1TEVA 1D2MA 1OHHA 3QKRB 4O2LA 1BIFA 1EG7A 2C78A 3DKPA 4US2R 4B6DA 2HXYA 1A4RA 2ROWA 2EFDB 5IDVA 5DGXA 2KB0A 3SOPA 4P32A 5H68A 2ZVQX 1A2KC 5K8UA 2ZUDA 1XF9A 2XX3A 2IYSA 1PLLA 3QBTA 3JZMA 4CZ2A 3B5JA 2I4IA 2OCBA 2FJUA 5DI3A 4ZKDA 4KJZA 3MFYA 4HLCA 2IF2A 3ADDA 2VHTA 3AKCA 2K5UA 2JASA 2YOHA 4GOJA 3RWMB 5JWHA 2EQBA 2F9MA 1U0LA 5KOYA 2ZJYA 4DKXA 4JVMA 1SZPA 3EWAA 4JJKA 2VHUA 4C7OB 2V6JA 3C5HA 4PC6A 4CT4B 1CR1A 3OAAD 4JSYA 4BE7B 5EE3A 2O8DA 3R9WA 1Z6XA 1NMXA 2W2TA 3D8BA 4KBGA 4N1AA 4WXRA 3QXSA 4LYHA 2AKYA 3AF0A 1AZTA 3HP1A 4B73A 1E2DA 2CL6X 3BS4A 4YMTA 4CEHB 1N6OA 1XP8A 2PL3A 2VSOA 4MYCA 3MWYW 4II7A 1YZUA 1U90A 1XTRA 3GMTA 3SR0A 3T5GA 4GL2A 4P33A 3QBVA 3BB3A 3MJRA 3AVTA 2I1QA 3GFTA 1KI3A 2FG5A 1EFCA 5JEEA 4Q9JA 4JIMA 1R10A 3TVDA 4CEJB 2PT5A 3FKSD 3GCGA 1Z6AA 5AJZA 3VTKA 1U9IC 3O47A 1ZIOA 3P4YA 4AKEA 5GVSA 4NKRA 3RRYA 3GPLA 1HT1E 1YR6A 2XOKA 4PSKA 3UMRA 2GJKA 4D80A 3LQRA 3G0HA 5FL7A 3SZRA 4XVQA 4HATA 2JJ2D 2BBTA 2PJZA 3AP1A 3UWOA 1IONA 4ZDIA 4RD4A 2HLDA 3K0CC 3WP1B 1R0ZA 2VPPA 3H0KA 2WTUA 1XPUA 3HDTA 3AF2A 4KFRA 3U2QA 2EYQA 1KK1A 3TQCA 1R4AA 4RVCA 2NPFA 2ZU6A 3DO6A 3QOFA 4KFSA 1FUKA 1SXJD 3OIWA 4XSHA 2B7BA 1G8YA 2FOLA 4NYMR 4GZMA 1WBDA 4Z8XA 4JYBA 3B1XA 4Q7LA 4QBGB 4CEIA 2P0EA 1NN0A 3D31A 3E5HA 4LV5B 1E2IA 4PC7A 1MO4A 1X8JA 3QE0A 4ESHA 4PX9A 3KQNA 1RKBA 2HF8A 3T1VA 5FL3A 4C2TA 2J3EA 2QM8A 3KB1A 5FR1A 3ZLJA 1U94A 4URVR 4AK9A 5JZVA 4MGKR 4C0KA 4HAVA 2BKUA 4C0AC 4DUGA 4A9AA 3HPRA 1R8SA 4NP6A 1KBFA 1D2EA 2V1XA 2DB3A 1W2HA 2JLRA 4TQAA 1OXXK 3CNLA 3BAFA 2JIZD 1YKSA 4HB4A 3TSOA 2QN6A 1DADA 3CR7A 1FZQA 5KO2A 2ZRDA 1RZ3A 4BZQA 2MSEB 4US1R 1ZNXA 2VP5A 2ZR7A 5EE0A 1KI6A 4Q19A 2EFEB 1E9AA 5G53C 1BKDR 1KI8A 2H8KA 2QMOA 1PJRA 2EYUA 2FSFA 3KDSE 3KJHA 4GSYA 4U7DA 4BPBA 1U81A 2C03A 1YRBA 2D62A 2OE2A 3H84A 4Q4AB 2Z83A 3KFXA 3BJIA 5JWRA 4LZZA 1R5OA 5TDHA 5DN6A 4RJLA 4UJ3A 1J99A 4OJQA 3EPKA 1NBMA 3SDZA 1Y8FA 4JL8A 2H1LA 1ESMA 1SHKA 1MV5A 2YINC 1XZQA 1EK0A 3EZ6A 2WKPA 3IDQA 2VSXA 2CK3A 3EA5A 4QXAA 1PV4A 1N5JA 2LCFA 4NPHA 2V4ZA 2ZI9A 1T3HA 5B58C 4XSGA 3PJRA 1LTQA 3MCAA 1UBGA 4JVSB 4H1UA 4B3FX 3C5CA 2F43B 1KZGB 5FTLA 3X1XA 3GLGA 2ZRHA 2P6NA 4PZYA 3B8HA 4B3DA 2F1IA 4EAQA 3VR4A 1Z08A 3ZDQA 3AQ4A 1MOZA 2GZAA 3PUZA 4FMCF 3VX3A 2G0TA 1QDEA 2OM2A 3TSZA 1TU3A 5FTJA 1NLZA 1R0WA 4EUNA 1RRCA 3KQUA 1X86B 5DSZA 1E1QA 1GG2A 1K5GA 1T3SA 1LVGA 3C14C 4G1UC 1J90A 1E2MA 4DCNA 1Q12A 4DVGA 2R9VA 3GJ0A 4NCKA 3WHKA 3Q5EA 5LB2A 4GRAA 2VH5R 1LW7A 3EA0A 4KO8A 1QBKC 3DZDA 3WBKA 3QF7A 3Q7PA 4MYTA 3W3ZB 1U8ZA 3QEOA 5F98A 4DT1B 2QUZA 1MO6A 5DNYB 3FTQA 2JCSA 5F9HA 2GKSA 2NO1A 2G83A 5EXSA 3ZH9B 1YZKA 1K8RA 2ATXA 5FL7D 3RANA 4B6FA 1KSJA 4KLNA 1IY1A 4GFDA 1W4AA 4FMBB 1NIPA 4S2EA 3IGFA 2GCOB 4AG5A 2ZJOA 3GLHA 2IS1A 1G3IA 2WOJA 1XTQA 2MMGA 1Y63A 4CIDA 1HQYE 1AA9A 1U0HC 2J41A 3SYNA 1E9CA 3IQWA 2RHDA 6Q21A 3SJZA 2J7KA 3T1TA 2J0UA 4WZAE 4BEBA 4FN5A 4IXMA 3U3RA 4MGZR 821PA 1K5DA 4LJYA 4ASUD 2HT1A 1E2PA 1KNXA 4PO1A 3NC1C 4QGGA 2ZJ2A 3IKJA 3A4NA 3G5UA 1NF3A 1G64A 4W5JA 4B2IA 4N0DA 4IDQA 5CYPA 1M74A 2HXSA 2OAQ1 2IXEA 1G7SA 1EFHA 3QKSA 1SVKA 3GJ7A 3CH5A 4P4UA 4F7WA 3NDBB 1IN5A 2DPXA 2C95A 2XNSA 1W0KA 1GP2A 1XJQA 1KIMA 5HCNA 3B7GA 1D2NA 2V54A 2NGRA 3L43A 2VF7A 1FL9A 4HUQB 4WIAA 3ASYA 2GEUA 2ANCA 1XB2A 2DFKB 1IN8A 3QY0A 4G5OA 2WWGA 2GVDC 1G4AE 4L4UA 4Q4LA 1CR4A 1S0UA 4XTRA 1XNJA 2BCJQ 1KKLA 2YWGA 3PITA 4IVPA 4PQFA 1NJFA 3VU9A 4QM6A 4AKGA 3C41J 3ZIAA 1UKEA 3C8UA 4EIWA 2O8CA 5J4VA 4IRUB 2PZEA 5KSOA 3CX7A 2UZIR 2W6IA 5AUPB 4OHYA 1VIYA 1XPRA 1HE1C 3PUWA 3GJ6A 2AHOA 3SEAA 3NBXX 3EWSA 1LB1B 1MH1A 2G3YA 2BBWA 3CZPA 4S35A 5DI3B 3WP0A 3K1JA 1UBEA 4TYQA 2GXSA 1NN5A 3PFIA 4Q4JA 3QKUA 4QJ3A 3EG5A 2FGKA 2V3CC 1GFIA 3JZAA 1OV4A 4B3BA 2XSZD 4BFVA 1XXHA 2F7SA 4PQYA 4RZ3A 1AGPA 2IYYA 1NVVR 1D6JA 1N0VC 3PV0A 2MMCA 4D0LB 2AX4A 2GRJA 4BLOA 3PG5A 3KTAA 3C16C 2AFIE 2CCJA 2NIPA 1QG2A 2XTZA 4JT2A 4D82A 3U60B 4X8OA 1QHNA 5EE1A 2O8DB 3A8TA 1R8QA 1XCPA 1XWIA 3BGWA 2WM9B 3KQHA 3L0SA 2YVUA 1YHNA 1DAKA 4YXWA 4BWYA 1UKZA 1W4CA 1QHGA 5G3ZA 4EKDA 2QE7D 4C2UA 1BS1A 4O3MA 1QZXA 3H4MA 2WJYA 4MKFA 3ZD6A 1CRPA 5HZKA 1CR2A 5GJCA 4US0R 1G5RA 1XTSA 1XEFA 2QZ4A 5DIFA 4B2PA 2QNRA 4B71A 1ZM4A 3AGQA 4HB2A 4RD1A 4JL6A 4CT5A 1TTTA 2VHQA 5CB6A 1E2LA 2W6JD 4PANA 3ZZTA 1BMFA 4YMSA 4ZCLA 3DHWC 2A5FA 5JMTA 4ZCIA 5BN5A 1C9KA 3NTUA 5FOSA 1Q1QA 2XAUA 4RZXA 1GVNB 4MRSA 5DHAA 2BMEA 5TV2A 4KYUA 2PEYA 2QROA 4M0LA 2IC5A 1ZM3A 4GMDA 2VTKA 2QP9X 2WOOA 2A5YB 2Y8EA 4IW3B 4KBFA 4IDPA 4P31A 2FFHA 1FUUA 2OFOA 2WV9A 1AQYA 2FZLA 3ZD7A 1DPFA 3UANA 1DTSA 2PH1A 2ZRIA 4CEIB 1XZPA 1UM8A 3LBHA 1P9NA 2R44A 2P6UA 5CJ2A 4AD8A 4B6EA 1WRBA 2ZYWX 4A6XA 4DBLC 1KJWA 4C0LA 4Q7MB 4L9MA 1KNQA 2P5SA 2R2AA 1GOTA 1RC8A 3U7GA 4XWAA 3PUVA 2C98A 3BWDD 2OAP1 1UPTA 2GBLC 4QHTA 4HLQB 1COWA 3REFA 5LB4A 1Q1ZA 4C0BA 3CPJB 4LRWA 2GF9A 3VQTA 2F1JA 3K70B 3CPHA 5EUQB 3SJCA 4ZDWA 4PFSA 3CX6A 4YMVA 3FMOB 1D8TA 2GVIA 3OFND 1FNMA 5JLJA 1FQKA 5AJVB 1ETUA 4V0NA 4FIDA 1TPZA 1N5IA 4LDJA 2A3RA 1KI6B 4BRWA 4KSBA 1DG1G 1L2TA 4ZPXA 3AM1A 4Y0AA 1Q3HA 3QUSA 3THWB 1WXQA 2G1JA 5SZHB 3W6PA 4RD6A 1M6NA 1SVSA 4HI0E 3TBKA 4QKQA 4HAUA 4B34A 1LS6A 1W0JA 2JDIA 3RC3A 4XH9B 2EWVA 3RWOA 1F2TA 4FCTA 1SKYE 1XD9A 5G40A 2WWXA 4DDTA 1XU4A 4KFTA 4JBYA 4GT1A 2AWOA 2TMKA 5JS8A 2DY1A 2RGBA 2YWHA 3PEYA 1G7RA 1JEDA 1G8GA 3A4LA 2RHMA 2ZRNA 3KXKA 2QPAA 3LDAA 4TYNA 1KYIA 2Q3HA 1Z28A 2C9OA 2IUSA 1W2GA 3BORA 3R20A 4OQLA
chains in the Genus database with same CATH superfamily
1W3SA 3C7DB 3P9YA 4M0CA 3T12A 2QRMA 5FAKA 2XDQB 3RYFB 4OVOA 1OBVA 2Q5OA 3KJXA 1FW8A 5EG5A 1TEZA 1RWPA 4FCCA 2ZDQA 2JHPA 3OPYI 3GLGB 1NBHA 3LUGA 1E6LA 1ZOIA 4LXHA 1RHQA 2ZUTA 3W5JA 4C7VA 4MOWA 2VAWA 2BMJA 4F7DA 4BFSA 4GU5A 2G72A 4TL9A 2PJDA 3QVLA 3U81A 2X40A 3JYNA 1SA0A 1HQCA 2IF0A 1JKXA 3L0YA 4IIFA 1W73A 5FPQA 5BV2P 5IUJC 3EDYA 5CGZA 4IGKA 4IZOA 1ZL0A 5CTAA 2BHTA 2AFVA 3HUEA 2JAXA 1P4HA 1TYZA 4M36A 1CY4A 4PPGA 5FJIA 4HDRB 3ZLTA 4KE7A 4ZVSA 3K9HA 4RFSA 1NC1A 2GXUA 1ZIDA 3NEPX 1TUBA 4O4IB 1O8BA 2X3UA 2ZSEA 4AY3A 2B34A 5K0ZA 1PTQA 3A06A 2I34A 5A05A 4DCVA 4Q16A 1NVTA 4G1EB 3R75A 2UVQA 3V32A 1ZN9A 1M2FA 4D96A 4FHDA 3VR1A 3CRVA 3PE4A 4D57A 3BH0A 3RIXA 1YFLA 2HA7A 2HJRA 1AS2A 1QC5B 2Q62A 3UJDA 3DV0A 2DEUA 4PCAA 4ZREA 3RRZA 1PUIA 1R9NA 4Q21A 3FPCA 2WVJA 2J0UB 4GR4A 2D3TA 3R7BA 2GYYA 3Q7SA 1D2HA 3WK6A 4CBVA 2FQXA 1AGYA 4DANA 2PUBA 1BO6A 3HS3A 4QEDA 5LZ8A 3M5DA 1ZLXA 5C7IO 2ODBA 5JSKA 3AL2A 4MWEA 2JA1A 3UOGA 2I7CA 1K8XB 1CUCA 2ZCVA 2DJIA 3VGJA 2REXB 3FUUA 1PT5A 1KORA 2CEKA 1N9ZA 4LGYA 2GXQA 4EO4A 4DS3A 1EX6A 1EFVB 3MFQA 2EJTA 5G02A 1RBZA 4Q3CA 2R5NA 3GRFA 4MZXA 1MW9X 2DR0A 3L1KA 5CDFA 4CIAA 5JAHA 1UOEA 1TQ6A 2ZATA 1SC1A 1H22A 1QYWA 1AQLA 1YR8A 4Z0TA 5DM60 1B0AA 2NM0A 3OO0A 4EYOA 4FR0A 4O4LF 1XMJA 4H6XA 4I36A 4INZA 4JVOA 1MNAA 5JNUA 3A05A 3TVYA 4KOEC 3JQAB 2DX7A 5ED4A 1T1SA 1ESDA 2RMKA 2WM3A 3FSYA 3NC0C 3WYCA 4KIJA 1C30A 4KI7A 4B48A 4G5RA 2WD8A 1VLJA 3DZ8A 3JV7A 4EUFA 1QRAA 1MGPA 2XITA 1JR3D 4YY3B 3IE2A 1O97C 2C9BA 5DKFA 3SBEA 2C2MA 2Q9CA 3ROQA 3ILSA 4FE7A 3ZGXA 1EESA 5IRCD 2X19A 2GIVA 4X6UA 3SFTA 1RZRA 4B3TB 4QSMA 2QBYA 3LCRA 4K40A 4IO0A 1XQ9A 3QF4A 4KSCA 4BFCA 3BL6A 2DHQA 5KU1A 3EVGA 1VDZA 2J5BA 4KX3A 2QSUA 3JD0A 2KWIA 2AYZA 2QAGA 2TRSB 4ZOLF 3L0DA 3NBMA 3GC6A 1GZDA 1SXJE 4NOMA 1IOLA 3NTRA 4H3HB 1D4OA 4Y2RA 1B6TA 1WU8A 3TTUA 2EFCB 1YB5A 4C1NA 5JCXA 3Q15C 5ITSA 3FDXA 3U56A 3LY7A 4QDUA 4XD7A 3K6SA 3E4DA 4JR1A 5MDHA 1TQHA 2RKBA 1TURA 2MSKA 5DNVA 5K3CA 3T1NA 4GF5A 3C6BA 2BI4A 5H1YA 2OENG 1GZ5A 1PJZA 1M1YE 4GZ6A 1O0BA 2D1YA 1H8HA 5CMLA 3NBYC 5DISB 1CQZA 4ARIA 1B8UA 5EXEA 1UCFA 4YJHA 4GPIB 4JITA 1COZA 1V25A 2NTYC 5A5VA 4AURA 1ZIPA 5T4FA 4CPDA 3OCWA 3ZJ5A 3DOFA 3QP9A 2FA9A 3H1GA 1QYDA 2BJWA 2CVHA 1EM8B 5G41A 4A6PA 4B3HA 4DSOA 3IAUA 4YLYA 2ZSFA 3L93A 1GL3A 2ZJBA 1T5DX 3L4SO 1A2BA 2HJSA 3A1NA 1B00A 4FDMA 5AH0A 4M0FA 3B20A 5KJ6A 4XXHA 3GK3A 4X7PA 1KDPA 4W82A 1DC5A 1KJQA 1YXMA 2Q4OA 1Y7IA 3MJDA 3UXHA 5BN5B 3NTQA 3OTIA 1MB2A 3DO5A 2YUIA 4BE4A 3HUFA 1IBSA 2DE0X 1I6MA 1NE7A 2ORYA 3GFPA 2YHAA 3I2GA 3L5KA 4PLTA 5IVDA 3SIPA 4H6PA 1FYBA 1DRKA 1ZOSA 2R87A 1SU7A 2EX4A 4E2XA 2FRVA 5JSFA 1YBFA 1Z07A 3NWOA 5BMVF 5U1PA 1FDIA 5IARA 3VR5D 1NL3A 1NVUQ 1ZUNA 2CL7X 1AMUA 1QGUA 4OMUA 1UAAA 1IU9A 1CT9A 2O50A 4FONA 2P5UA 4JOCA 5FBQB 5CH8A 4LC9A 3KHTA 4IDEA 5DRYA 1J24A 1QBGA 3RIYA 2VG8A 4ZAYA 2XEDA 4OMDA 1E99A 3NT2A 3SSOA 1KK2A 4ECEA 3DCIA 4KQMA 1A9XB 2VJYA 2CJWA 2IFTA 4J0QA 1JHYA 5KHLB 5FEUA 2EL7A 3KB6A 5UKDA 4R8MA 1M2VB 3QWBA 5JZMA 4TVSA 1OB2A 4D44A 2VDUE 2V9PA 4RDHA 2YZ2A 4JLUA 2RGEA 1ISPA 1RNLA 2R5WA 1KOFA 1XZ8A 1QRUA 3OJOA 3KAJA 2VTBB 3OA0A 2QRUA 1CFZA 4YBZA 5ADVA 5KVVA 2ZJ5A 4XGIA 1HTWA 1QP7A 2FKAA 1LPOA 1NGSA 4HNAA 4XGRA 3CF0A 5AW0A 3OBBA 2L8EA 2W0MA 4IP0A 1JJIA 1HE8B 4MI6A 1MN6A 1BDMA 4S3MA 3CTPA 2XNCA 5EYPB 4JC0A 2YNMA 5B12A 3RBVA 4EPYA 3T5PA 5JCOC 4RA9B 3LCUA 3OF2A 4XWOA 4IJUA 5C32A 1JHPA 3JRXA 1TZCA 4AECA 3DBHA 1SD1A 4CM8B 1X1QA 3UJ9A 1F4LA 3R40A 1FX1A 4XTCS 3K0FA 1G59A 3SE7A 4AN4A 3MLAA 3JQQA 1T2FA 5DLYA 5KSWB 4RW0A 5CNKA 3M70A 1HWYA 4LGMA 3RTDA 1OX4A 1UBJS 4CF6A 5JECA 2GEVA 3UJ7A 4EMUA 2YIVX 3CVVA 3CUVA 1OXTA 1SRRA 4RV5A 1ZC4A 2VP2A 3H2KA 4EEKA 1XR3A 3QXJA 5PGMA 3WV5A 1NQWA 2GN8A 4BP9A 1J1IA 1F2TB 3FSGD 1PX0A 4DNOA 2B99A 3R0QA 4W9MC 2JA2A 3NPMA 3PFFA 4DG8A 5B1HA 2AFHE 4ZI2A 3C6QA 4RKEA 3CCCA 2APJA 3QMVA 4GI3A 4OIFA 3RU0A 4UD2A 3X1JA 4N18A 1FFDA 3OA2A 4HXGA 2C4TA 4DCMA 1FBTA 3WGQA 2XJ4A 4JLBA 3H2SA 2V8OA 3SEFA 4BNGA 2NO7A 3AO0B 5LM3A 3DLPX 1PUJA 3GT0A 3TR5A 3HLKA 2PH7A 1X3SA 3E3AA 1FMCA 1LJ8A 1YZGA 2GZHA 3D64A 4Q4HB 3ICEA 3LO5A 1QG4A 3EXEA 3STVA 5BORA 3KWJA 2WIDA 4HYQA 1Y9JA 4Q93A 2FZEA 1JH9A 2QB5A 4C21A 3JWPA 1FXUA 1WSBA 2B92A 5IT9A 3FWYA 5FADA 2PXCA 2IS6A 1V6AA 4ID9A 1E7MA 2F3QA 2QXUA 4ZODA 3SZMA 5JXHA 1SOWA 1LSUA 4KKXB 2QM7A 5K01A 1N5LA 5KYTA 2Q6OA 1ZISA 3VYRB 2DXIA 3TDNA 2GCIA 3QVWA 4CM1A 1LV7A 2QDKA 4IIYA 4F1JA 3J80A 2AZMA 3WO1A 5KOIA 1H5UA 2OBNA 4ZVOA 3KKKA 2LUOA 4RIGA 1OH5A 1ZM7A 1LWOA 1KYXA 3GG2A 3IMKA 5H7XA 4Z4QA 3KOWA 1FFXA 4MWGA 1PDVA 4PF1A 1U7OA 4ZJPA 4LF6B 2P4EA 3P0FA 3FPBA 1P4JA 3WHLA 4FYJA 3G2QA 1O87A 1L7QA 1NATA 4IEIA 1BXRB 1FP6A 3TN7A 1SM4A 3DB2A 3CZCA 2WUDA 1C7ZA 1FJXA 4HGRA 2RHGB 5AWFC 1OCEA 2IKSA 1PDOA 4D79A 2WMDA 2C4NA 2A5JA 4Y9DA 2MJLA 3OIFA 1Z5WA 4I9HA 1TO1E 2ESRA 2HF7A 4FFNA 1JL3A 1U2TA 3PCXA 4LOHA 4MTCA 1ZNYA 3R5FA 2XZLA 2Y9PB 2F3SA 4Z2YA 4NJEB 4IDOA 1NYRA 4Q3NA 1HKUA 1Q83A 1KARA 3BF8A 3U44A 3AVYA 1VP3A 3URMA 4CCYA 4QLBA 5KOJB 3GRZA 3V2GA 5L3ZA 4BASA 3QYPA 3KJIA 5AVWA 2J1LA 1ODKA 3AX6A 4RPIA 5K6TA 2A1UA 3B48A 1U6JA 1OA0A 2VJMA 2XQFA 4TRNA 5EINA 5CCXA 1NVGA 4GI5A 1T15A 1XAIA 2X1LA 3JD1A 3WIDA 2E2WA 3QUCA 1D07A 2CLOB 4P0PB 2VA9A 1U3GA 3GCWA 5CFOA 1E6EA 1AUPA 2I29A 3PHGA 4PCLA 3SXUB 2H1OA 4KDRA 2EFJA 4KRGA 4J49A 4JCVE 4XX0B 1IQRA 2D5IA 4MRMB 1A8HA 2QU8A 2VHEA 2SKEA 4NJOA 5DYNA 3W2GA 2F3RA 1H65A 4UTOA 3UA4A 3ZS9A 4P2BA 4OD0A 1M8FA 4LQCA 2CHVA 3WBJA 5KWIA 1DX6A 3DTVD 2B5WA 3T9FA 3NUZA 4ZYUA 2GO7A 1K7XB 4MUGA 1Y7HA 2ZREA 1TK2A 3MUFA 3PNSA 1W85A 1WCV1 1LLDA 1XRMA 3E7PA 2P5YA 4FR5A 4XFKA 2Y4OA 3VZPA 3ZHTA 2WJGA 3ZYCA 3QYFA 3ZKAA 1RE1A 1DKMA 1UK9A 3P8ZA 4UXJA 3FFBA 4ECAA 1ZD8A 1G16A 2EHJA 4XUGB 3WLFA 3K9CA 2PZAA 1XAJA 5LZ4A 5L3SA 5A4FS 3DFIA 3EEOA 3U3KA 5CIYA 2JLYA 1C8LA 1DIOB 4QU0A 1TIHA 4IJWA 3TEFA 2J0VA 5F52A 3WK5A 3JQ7B 4YC7A 4ZKEA 1IHPA 1YZLA 4MUAA 2XT0A 1Q0HA 1S89A 2IY7A 4XWYA 1CJVC 3U7FB 3LNCA 3OF3A 3OT5A 1CT4I 2GDJA 2XODA 2XKKA 1M2NA 3ROXA 4I8XA 4URWR 5D3MA 3E2IA 4YT5A 3OM8A 4TMXA 3K1YA 4CKWB 1FP2A 1T9AA 1H0RA 1H2RS 3ORSA 4JUFA 3W7VA 3QPBA 3HY4A 1E0SA 1JE0A 1YWGO 2O2HA 3A25A 1QR2A 3A32A 1WXIA 1RWBA 3BULA 3E81A 3O8BA 4M1KA 4NS1A 5H3LA 2GASA 3H6GA 1FEZA 5IH3A 4A8TA 2X2PA 1TF7A 1W25A 2PV0A 3A3NA 3GGOA 4NF2A 4L78A 1U5KA 3I92A 4FLEA 5J2TF 3BXFA 1MHTA 3K0EA 1KHTA 4KVGA 4MKZA 1FQOA 3EIUA 3GBSA 1SC4A 3DOEA 2DPLA 1JPUA 3ZU2A 2ARKA 2ORED 1GNRA 3C98A 2BBOA 3T5DA 1ISFA 3GFOA 3AY0A 1LSSA 2P75A 1GFWA 2ZIWB 3B8EA 3BUSA 4LW8A 4ZHQA 1G5QA 2HX1A 4K81B 4J16A 4KX5A 4Z8YA 1N9GB 5GOZA 4B3GA 3JVDA 2BMVA 3KOZA 4H4CA 2OBXA 4WOPA 4YS6A 4QYSA 3TLCA 5DK6A 1TOTA 1G9XA 5ICMA 5JT1A 1UT6A 2AXQA 2ZS7A 1RAFA 3HJBA 4L1KA 4TKMA 4L4XA 4LRXA 3UFXB 1YJ5A 3F8TA 1Z25A 2DUJA 5U9CA 2ODTX 4DHEA 1RM5A 1P1JA 2FMHA 1IBRA 2NSJA 3MIZA 2C84A 2H6EA 5F4BA 3BL5A 5I9MA 1RLJA 3QG5A 2HC9A 3C3BA 3TQSA 3FVTA 1CSEE 4BTEA 3WFIA 4B45A 4L0MA 1CX9B 3STHA 1B3RA 3ZY6A 2FE4A 2W6OA 2ICAA 3K20A 3A4YA 4NE2A 4EVIA 5JMWA 1R4NA 2E4WA 4TKVB 5DNWA 1JHZA 4PFJA 5JXWA 3H16A 1CQJA 5TGTA 2QWXA 1T3GA 2VR1A 3MTQA 1BROA 2JGEA 3F49S 1IN4A 2WM8A 5DBHX 1CUUA 4RVSA 3Q11A 5MGNA 3MJFA 4LJ4A 2BZGA 2LXNA 3AR7A 2OUKA 4C30A 3AUAA 5BQOA 4AO7A 2GH1A 2XGGA 3WKDA 2CEAA 3KHSA 2QMUA 2Y1GA 2FWIA 2YYZA 4FN4A 1XZNA 4U7PB 5B3AA 3CVYA 1AM4D 1NBWB 1R18A 1ULZA 3ODGA 5CXSA 3SZOA 3GZTB 1A77A 1H1TA 3PIDA 3ULKA 4CL2A 4V0ME 3I1FA 3R8XA 1Q22A 4MPRA 4DMKA 4GOND 2OCLA 1Z29A 1O5IA 5DN6D 5AW3A 3RGWS 3LHKA 3Q5DA 4G0NA 5GJWC 4L22A 4DA7A 2BYTA 3TUJC 3AINA 4J9UE 4EF5A 3BB1A 3LFHA 2XNJA 4F85A 2YRFA 4RCYA 2NU2I 2SGFI 3FJYA 1J0XO 3INYA 4V0KA 4ZMSA 5BN3A 3INGA 1QHHA 4NDNE 3IJPA 4C08A 1EB9A 3E82A 4OGWA 4E1AA 3WBFA 2VF2A 1UJNA 1ADCA 3CXUA 3DZHA 3F4KA 3VZQA 4ZYVA 1AHPA 3D3QA 3AKZA 1Z0ZA 2E4UA 2MIIA 2VJOA 4G5XA 2H63A 3BKWA 4RZUA 4J1NA 1Y5IA 3KT0A 1TCUA 4DLSA 4EQ6A 2G1UA 1V1RB 1V1IA 3UGJA 2H4WA 4RLQA 3B12A 5ERYA 5IC6A 1DEKA 3ZK7A 3UPUA 2QVCA 1NJ8A 2WSMA 3FMPB 4MDHA 4Z86A 3USCS 2CT8A 3Q6IA 4JWKA 1D0SA 1HMPA 3P52A 3E7DA 4V03A 1V8OA 4TM8A 1WMDA 1K1EA 2PMWB 4GBMA 4EKEA 4WBXC 1HLPA 2FZ4A 3UAVA 3VR4D 1M66A 1O94D 2FSIA 2UDPA 4P58A 1W6UA 3ZWXA 3LKDA 3PEUA 3PSAA 1II9A 4RV4A 4RF2A 3ETEA 3VRHA 4OQDA 2HR1A 2ZW9A 3B4VC 4R8KA 3UGDA 1VSBA 3M6FA 3CPSA 2FPMA 4RHTA 4XJTA 3L4BC 5HOQA 1X7DA 4Y2HA 3CF2A 5DHTA 3TFWA 5BW8A 2JFZA 4BZWA 1QQ6A 4CKBA 3R9XB 2GTPA 2X0RA 3GD7A 3O8DA 5FP0A 1QG0A 1RR6A 2FPGA 2AFIA 2GEJA 2IEAA 1TTHA 1LLQA 1YI0A 3MRTA 3PX3A 4UBJA 5B3JA 3ZUGA 4BIMA 1JBEA 3BTOA 3VU1A 4Q3AA 5FH9A 3EVDA 4NTZA 2HLPA 3MWKA 2AG0A 5KTRA 2J9RA 1QRDA 5EN4A 5I7RA 2JLQA 5TPWA 3FJOA 3QUAA 2RBEA 4L9AA 4UREA 4B80A 3I45A 5K0LA 1RYBA 2AI3A 5BVGA 6REQB 1M1NB 1LKZA 1QDUA 1X7YA 4JLPA 3VYVA 2VH2A 3ITDA 2CB9A 3IUYA 2HJVA 3HDHA 2G09A 2MINB 4HH0A 4Q4CA 1XDDA 4KUEA 4NULA 4LF7B 1B8PA 5C1PA 3MA0A 4QDKA 4I50B 2Z5GA 5LQDA 1SUBA 4JLJA 4BJ3A 3EAGA 4QPJC 3TLMA 3THOA 5K3FA 4JD5A 3S28A 2HNBA 5I47A 1SHTX 2ZUSA 4H0NA 5EX3A 2NYAA 2R8XA 4X1YA 4KAFA 4MUEA 5KWVA 2UUPA 3DMNA 3O9ZA 4FFRA 3G7NA 3OLVA 4C4AA 3U7IA 4Q7QA 1TU4A 4UC0A 2H1CA 4OKSA 1PT7A 3EPPA 3SJUA 1BVUA 4RK5A 2R6DA 3PNOA 3ZW9A 2I3DA 1YDHA 2C42A 4ZV7A 1M34E 3QOWA 5BSRA 3WIEA 1STOA 2OCXA 4QPZA 1RXEA 4MMYB 5CFZA 3C3XA 1U5AA 1CULC 2PU7A 5AK5A 1ULMA 3LWNA 2Q9UA 5ALNA 1QPZA 1Q1NA 1QKIA 1JQLB 3HJTA 1OH7A 4J1SA 1SQ0A 3G5AA 4LOJA 3ZLUA 1DB3A 1V7CA 3U62A 1R0YA 4DQXA 2X22A 5A4DA 3KTFA 5LFAA 4Z9AA 5JNSA 1PNTA 3WYNA 2D54A 4FGLA 2PCJA 4A92A 5C3MA 4I1PA 3IPYA 4JLVA 3TJMA 5IEJA 1R6UA 2ERWA 2DH6A 1SUCA 2RGGA 2VQ6A 1W44A 3D3WB 3U9LA 1YB1A 5HBGA 3UW3A 2E85A 3SQMA 1AOXA 4YTEA 4LF8B 4LI3X 3ZI0A 3K94A 3KAPA 2PMCA 3DBOB 4ZAGA 3UTCA 3UGKA 3WWEA 1Z5NA 4B6GA 1MA0A 4RM3A 1CJKC 1L5VA 1T8UA 1EKXA 4RZQA 4B75A 4ETWA 4JR2A 3S7TA 4QG3A 2CLKB 1U5CA 3MGBA 1YR2A 4K26A 4HLUC 1BEZA 2PUVA 5CLQA 4BMZA 1F6DA 4CIVA 5EIEA 4UTNA 1FVHA 1U2ZA 4OQFA 2FEXA 4HEA1 4PLVA 2JAHA 4COKA 5FRDA 1J8DA 3AEKA 3M6AA 2YY6A 2BFEA 3OT4A 1P2DA 2IVFA 3BIFA 2N1BA 4PN7A 3QBEA 2FPPA 2G06A 4UPEA 4HDNB 2JC3A 1N3IA 2HA0A 3AIIA 4BFZA 2JBHA 4GYYA 2L2QA 1RPTA 1ZICA 2R48A 2IK8A 5HF5A 4OI1A 4G9GA 1HI9A 4BBJA 5K8IA 3Q0TA 1MD9A 4I46A 2A5DA 3WZLA 1VMKA 2F8LA 2QX8A 3GDGA 3OEYA 4E4YA 3DHVA 3QAHA 1EWQA 1OQAA 2IHZA 4FUTA 4XW2A 3SC3A 4BBZA 1RI3A 3CLRD 4RTLA 1U4NA 2E9SA 5T64A 4K7JA 3ZD8A 5LIRA 4IEEA 4BNZA 1R6VA 1YDGA 3PZRA 4LE1A 3SVLA 3GO4A 3KUDA 1KZHA 3W7BA 2A1IA 5AOVA 1H8ED 3ZBTA 4PZZA 221PA 2A7QA 2HADA 2ISQA 3PQ2A 4NCBA 3B9QA 3C3MA 4LZJA 1IHDA 3UA3A 2KLBA 1FVXA 2JHCA 3MVEA 3UCEA 1L7OA 2K2WA 3VYSB 2B2XA 1JYFA 1BMFD 4R7TA 2P91A 2VRWA 3GNTA 4NOJA 4D6PA 3ZDFA 1WB4A 4H7PA 4UU1A 5FAXA 1SGEI 4B17A 4BKQA 1ID1A 1NSYA 3NOOA 4KXNA 2IITA 4E21A 5IABA 2AJTA 2XTAA 3FBWA 1EFKA 4FHZA 5KWJA 2FZWA 4HXEB 4Q03A 4XDZA 3SYRA 4TN1A 5JSZB 3CT6A 5HYVA 4ZYZA 3U4QA 1UADA 1VPTA 1YUMA 4BLVA 1R66A 3RHSA 3H3JA 3E3LA 3ODPA 3RUEA 3ZHZA 2O19A 2JBAA 1IYZA 3KEFA 1SHLA 2BGUA 1KS2A 4CFSA 4YMGA 5I7FA 5DHQA 2A35A 2GHRA 4OAQA 1GPUA 2P9CA 2QAJA 4GOOD 4OK3A 1NLFA 4ZGBA 5LR6A 3DD1A 5E2IA 4EFLA 1OIXA 2Q0XA 1SUFA 4WQMA 1M5TA 3MTEA 1Z4PX 4RSGA 1PVVA 2ATIA 4DLYA 5LJIA 2GCEA 3PZBA 1FTQA 4DMGA 2ACWA 3EVTA 4QFMA 2BMDA 3CRZA 2O07A 4OHPA 5DGDA 3THSA 1KO7A 4EL0A 1TFRA 2W83A 3T7EA 1N3BA 3PNVA 3T7SA 1TCVA 5B58T 3ZN2A 1UM9B 4UAUA 3R7SA 2C1XA 4EX6A 1R3DA 4GRDA 2OXFA 4FOOA 4OB7A 1RSZA 2FZ5A 4LCEA 5FR2A 1LDMA 5AVVA 1UT5A 2FETA 4GM4A 2QUKA 2Z4TA 1Z2EA 1AIPA 3ZCXA 2QTTA 4EPXA 1HDZA 1S1MA 4UHJA 3L0PA 1O95C 3PFNA 4KXYA 1LQ2A 4XI9A 3L8HA 4O4JB 3WMFA 1RC0A 4AZVA 3ME5A 1JI0A 4EYQA 1T3ZA 2XUFA 3KVOA 3KZXA 3I23A 5K4AA 2VCEA 1UC8A 4YQYA 3DZIA 1PFQA 4GR5A 2Q5FA 2IPMA 2CMDA 2DM6A 5FOXA 1YR1A 3E7XA 2OV6A 1IEWA 1ORVA 4WLOA 3TCKA 3OAAA 3K53A 3TOSA 3FOZA 2G82A 3HMQA 1V41E 4NSNA 2YN0A 1UP7A 1YUNA 2OO5C 3FZGA 4EQZA 1TGYA 4G8DA 2JDID 4D6XA 1CWUA 1AKRA 1BYUA 1LPAB 4OXXA 4U1RA 5TT1A 2IUUA 3PHJA 3TX2A 1M6YA 1GCIA 4BKPA 4F60A 1XBTA 1YS1X 2H0AA 3TI9A 5KYXA 2AJLI 1YJBA 3OCUA 4EOGA 5EMHA 2RHRA 4CNQA 1JG4A 4PSCA 3SICE 3TGWA 4HQRA 2DLCX 5JD4A 2JZMA 2BM9A 3HU2A 3TGPA 1FTYA 5AICA 1D9ZA 2Y68A 1I3LA 1CT0I 2E21A 4NCAA 4F4FA 1FRQA 3ER6A 1MAVA 4G5HA 5DBFA 4RQUA 1KI1A 2GN6A 4BYGA 1A8UA 4K5QA 3U49A 4PG6A 1QQBA 1XJ0A 4ZP1A 3Q6NA 5BSVA 5IU6A 2YRWA 4ZCMA 1J1ZA 3W8NA 4E1VA 4KO4S 4BO5A 3RV3A 4RZIA 3PFHA 1V5GA 4L3WA 2G63A 3I2KA 3P0HA 3UKDA 2B1RA 3MTDA 5LSAA 1WCWA 1X80B 2EBFX 5J23A 4V0LA 3DS8A 3ELWA 3NVDA 2P3QA 4O4LB 1P6XA 4WNIA 1GKKA 2G1AA 2AXNA 2HMWA 2NW6A 1HXHA 2XR1A 2Y6VA 1SXJA 3N2YA 2X8JA 2CMKA 3ONFA 1KC3A 4HAYA 4JBWA 4BPRA 4WOCA 4ZGGA 4UNRA 5B7GA 3OIUA 4Z7OB 3AVUA 4CDGA 2PZMA 4X6YA 2AEFA 5AHRA 2O1WA 1SCUB 2QQ0A 3IP8A 3TZKA 5JI2E 3BWCA 4Y98A 2H7YA 2ADMA 3OCXA 4R54A 2C2BA 4B83A 5B57C 5KYWB 2CVZA 3DPIA 3LXXA 5GJVC 2BHSA 4JX9A 4FINA 4E5UA 1TO6A 3USZA 1JAZA 1M1YA 4IX1A 4YMLA 3VKVA 3QYAA 4WCVA 3SKYA 4L7QA 1IB6A 3ZWAA 3WQQA 3BQ9A 1HDGO 1ZGJA 3QVJA 3W5IA 4CKCB 2PL1A 4QM7A 1YQQA 5FBLB 2IZ0A 3LE8A 2HU7A 1J0AA 1KERA 4P7BA 1KAHA 1RFLA 5AHXA 1BCSB 1IOVA 3E23A 1CHOI 3EGIA 4HZUA 4E2WA 4X66B 2QT0A 1ZCBA 3VISA 1G9TA 3FX2A 2W11A 3FSRA 2JIZA 1P9WA 1UBHS 3A7EA 4X95A 1X1AA 3OQIA 5A5GA 2I67A 4HDMB 1EWYA 2PZFA 4LXIA 1XCMA 4MUMA 4Z4GA 4CKZA 4LS3A 1KKMA 4HTFA 4DR4B 3FNIA 1IXKA 3RBZA 3EGCA 4HDKB 3RB8A 4RADA 2DZDA 2NQ2C 3CO5A 3L18A 4H1VA 4I6JA 4ZAXA 1GU1A 1U02A 2Z09A 3R9IA 1F48A 3OZ7A 2AJ8A 4OKIA 1AURA 2C9ZA 1UKYA 2OD7A 4G09A 1TTQB 2R8BA 1Q19A 3K1AA 4R3NA 4W5WA 3MJEA 4YAOA 2ZSKA 3A9SA 4JLAA 1A5SB 5ALSA 3FWNA 3F7TA 2DVMA 3IPCA 4JBNA 3RC2A 4FNAA 1E32A 2I2WA 2BGMA 1KGDA 4UVIA 3VUEA 4RV9A 4AU1A 2F17A 2ZI7A 1Y98A 2OPHA 3TKAA 1Z5VA 2RB4A 2CW5A 5AO9A 2G6TA 5JFTA 1X7WA 3GGGA 1JRLA 4K6KA 1JAIA 1VSVA 2AMVA 4KNVA 2I62A 5ALFA 2BTEA 1OPRA 2R6AA 3HG7A 2G0NA 4LKRA 1Z7YA 2H2FA 4IVRA 4RHXA 3BILA 1L4BA 4HX9A 1OJLA 1VJGA 4G1MB 3NVAA 1JFRA 3QKTA 1VKOA 2PQ6A 2BEWA 2XCUA 1NE2A 4CKEB 1TF5A 3SHOA 1WZ2A 2OBFA 2XVAA 2JGNA 4IH4A 3UENA 4YT2A 5JSQA 1JSZA 2J46A 5BMVB 1M6VB 3I01M 1JR2A 1J25A 1OZ0A 1TF2A 3N0XA 2WQZA 4O5OA 4P3YA 3RF7A 1NI4A 2WHEA 4FE3A 2IXGA 4M1ZA 4HPJB 1R5BA 4W7HA 5CDTA 3RYTC 1MIOB 3WWPA 4NCNA 2QV7A 1M7GA 5FEMA 1CPYA 1JTVA 2HA4A 3HZHA 5BV1A 3F4BA 1XC7A 3FRHA 1KTVA 5I4CA 1G8KA 1RZRD 3KSMA 4WV3A 1DBIA 4O2BF 3AESA 3G0OA 4DCUA 2KSQA 4AXBA 5FOQA 3JD2A 3D8HA 3QENA 2JIQA 2HF9A 4YRJA 4F86A 1IPHA 3JR7A 3RYCA 2ZE7A 5JPIA 1DBSA 5IDXA 1V6SA 2M6RA 1QRTA 1E2GA 3IOBA 3NIGB 1NMQA 3CVOA 4GBED 2WFAA 1U8EA 1ZIXA 2A92A 1I4DD 3BA6A 3PHIA 1PG0A 2BLLA 3OOJA 4M0MA 4XD7D 5KYGA 1ADGA 3I30X 5IW8A 1HOXA 2OMEA 1C81A 4RKFA 2I4TA 1EWTA 1I4TD 2X0JA 4JFRA 2Z4SA 3RUHA 2QTRA 3ZZ1A 1SKYB 4G67A 5IHXA 1T6ZA 3GRCA 3FSEA 1QV9A 4I5GA 2NU8A 3SDBA 3HCWA 3DLHA 1RHMA 2AUTA 1H8HD 1BW9A 2AFHA 2C8LA 4UEKA 3WGMA 5BUSA 3T3DA 5EZ6B 4MUKA 1J49A 2OZPA 4NBVA 1WG8A 4Y6SA 4HGPA 2HH9A 2P2NA 1AH2A 4GWKA 3I9LA 4PAQA 5BUZA 2Q8NA 2BDEA 4JP8A 3HYLA 3TW8A 4O59O 3BZBA 3M5PA 4RVUA 4AJOA 3HA5A 2ZRGA 3S70A 3AVWA 3BG5A 4WGFA 1YFZA 3SC4A 5E38A 1C4OA 2E1PA 4NFYA 2P6RA 4O6VA 1D9XA 1KMHB 2CXTA 3CLSC 2A0FA 3NNNA 4GP7A 7ADHA 4QJIA 5IS2A 1V16A 5AK6A 3R8FA 4H3KB 4L28A 3AG6A 2QTMA 3FWHA 1RKVA 1XTVA 1X87A 4G8JA 5FX2A 1XN1A 2BW0A 3OTWA 5L4SA 1LZKA 2EL9A 4A0HA 1H1DA 2HSWA 3HYCA 4EGFA 1CLUA 3ZHUA 1I9CA 4P93A 1KYVA 3UYLA 2O3JA 3PFKA 4D4LA 4JENA 3QUTA 2UVPB 2NACA 3QLVA 3IE1A 1FDVA 3H86A 4W9NC 5D7NA 4HN4B 1T6NA 2CUNA 1ANKA 2GKGA 1EVIA 3S3TA 3BGVA 1CR6A 4DLNA 3EOBI 1UUFA 1IRIA 1ESZA 1CCWA 3GL9A 2YIJA 2H0QA 4RVFA 2WWTA 5AXBA 5I5EA 4ZU3A 1JFVA 1QB8A 3EEFA 4JBGA 2PR7A 2C82A 3I4LA 3O21A 3MHTA 1I4WA 1DKNA 2EW2A 4S1PA 1KFBB 3F6PA 4H59A 3MJVA 1E3JA 5DYYA 1Y1PA 5IH7A 1THTA 1K08A 1ZGGA 3TM4A 1N2GA 4EJSA 3GLGE 2QRNA 2GZDA 2XMZA 3BC1A 2AI1A 1OSNA 5AKXA 1EIWA 3AOEC 1M2HA 2PX5A 2DLNA 3I9OA 2Q7DA 4NU0A 1KYTA 3CF6R 2IDJA 5FWXB 1QH0A 2YNMD 2XSZA 2BDUA 1OBFO 1ZMTA 5BT9A 3GGDA 1L1FA 4EMTA 5CB4F 5M04A 1ZK1A 4M99A 2W4IA 1JS1X 5F77A 2QMHA 3KOOA 4QYXA 4E07A 1KP3A 3HWX1 3B13B 2I4NA 4IMRA 3T7TA 3C6YA 3SOZA 1EX7A 3PBKA 1LSJA 6PFKA 3PC7A 3P0EA 1I0ZA 1NF8A 3CMMA 3KJEA 3UHPA 5DWDA 4G37A 2A9PA 4XYGA 1DXQA 1A95A 1W5FA 2HJGA 4DLVA 1KI2A 4HRXA 1N8SA 4YFYA 3RKRA 3S4YA 3NHBA 4FGZA 3HZZA 3SHWA 1CZUA 3CBQA 4X62B 1I7DA 1V5WA 1YE3A 2VQSA 1BVYF 4JBXA 1GT6A 1R0RE 4HB0A 4TKLA 4B31A 1WQ1R 2BKEA 2QP4A 3AJ8A 2DIPA 3GEEA 5C9ZA 3BMQA 1QCZA 1MGOA 5JZ9A 3O2JA 1DXHA 4B5KA 1L5FA 4DUYB 1CS0A 2WVAA 2PL5A 1KEWA 3LZDA 2P4QA 3L4KA 1ZAYA 1GL6A 4LJ5A 3N7AA 4UUMA 4DCSA 4F93B 1DSSG 2AN5A 5JJBA 13PKA 3I73A 4GYWA 4EY4A 2O0KA 2F90A 1DAMA 1VCOA 2VPYA 3GT3A 3MMZA 4NS4A 3U4CA 3HU5A 3AT1A 4G1BA 1N57A 1JP7A 4FS3A 5JJIA 4UARA 1ODIA 4XDHA 2VDPB 4BQQA 5BNTA 1YZQA 4G4JA 1U8FO 3VHQA 4Z99A 3NFYA 2X9VA 1INLA 3WGJA 4D7AA 5A4KA 1PFUA 5IJ0B 1EXDA 5LU8A 3H1TA 4H1HA 1LW6E 2C4KA 3OO1A 1N7GA 1P19A 1Z22A 3PGLA 3FGZA 2JCGA 3NHSA 2F67A 4Q5IA 3WBBA 5E6UB 2YBEA 2X3TA 3I64A 4LDQA 5GTDA 2NO6A 3Q1LA 2RARA 2HFKA 4TL7A 4B6JA 4IF4A 1D6NA 4QULA 4BX0A 4OQZA 3WL8A 6ADHA 1FP7A 4IILA 5CGQB 3T34A 4KJXA 4ZIRA 1E59A 1NV8A 1REQB 3L1VA 3PXUA 1Z6GA 3VH3A 1LBHA 2IXFA 3AGPA 3OZDA 3X3HA 3Q5GA 1NBEA 5AKJA 4X20B 1R6XA 4R16A 1M9NA 5BWOA 3I2FA 2HSZA 5DXAA 1EHIA 1F6WA 3Q9LA 5EHZA 4LSWA 1T2AA 3GPCA 4J7AA 2XMSA 4R2JA 4XQEA 3SFVA 2V1UA 1E0AA 5DXJA 2ZTHA 4E13A 3R09A 3NEYA 5K8UA 5FLKA 1IULA 1MVLA 2X8LA 2WIKA 3OFNA 4WJLA 5KCZA 5KNDH 1VHQA 4MQ4A 4YEDA 5J2TB 2HSJA 3QWIA 1PNOA 4Q1EA 3U7JA 5EUMA 3BFJA 3LLMA 1HFWA 1FSPA 4F1WA 4E7OA 1T2NA 3AKEA 2GAJA 3MTAA 4N5DA 1O9GA 1WW3A 2SKDA 4KC0A 2Z3WA 1R9JA 3TKLA 1HSZA 2KQUA 1N1GA 1UMBA 4TMYA 3RFCA 2R7LA 4BRZA 4UOZA 4LUCA 2GD0A 4OK5A 2A78A 3EDRA 3WMWA 1RM0A 4GE0A 2CJXA 1XZAA 1ZH4A 1GTL1 5C53B 2TMGA 3AR9A 3EAFA 2DR3A 4EPWA 3JQ8A 5K5EA 1PTJA 3Q4GA 4NE9A 3HBLA 2CXUA 1USUA 1WXDA 1VLQA 1I33A 3W9YA