2ORWA

Thermotoga maritima thymidine kinase 1 like enzyme in complex with tp4a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
171
Chain Sequence
SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKHSTMIVSGVEAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEIDVGGQEKYIAVCRDCYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of ATP to TK1-like Enzymes Is Associated with a Conformational Change in the Quaternary Structure.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidine kinase
total genus 55
structure length 171
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2orwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2orwA01
5IHPA 2IL1A 1II8B 2BOVA 4HAWA 4I4LA 4QJ5A 5SZIA 4M8NE 2D2EA 5IRCD 3FMIA 1AS0A 1W2HA 1EFCA 4W7SA 5L3QA 1XB2A 2NG1A 4P32A 4R2IA 4RD3A 2F9LA 2LCFA 3U7EB 1XD8A 2GBLC 2VO1A 1J7KA 1F6BA 1KZGB 1N0UA 1KJYA 3TUIC 1ONBA 4DDVA 3NHBA 1DAFA 5BYKA 4LPSA 1YZTA 5KU1A 2CJWB 2PZFA 4P4UA 1GUAA 4YLGA 4G5RA 3B7GA 3NBZC 4PC3A 1FNMA 1KTVA 1Z0IA 2BMDA 2CL6X 3EZ7A 2RGBA 4YONB 3TW4A 4FINA 3DL0A 2GXUA 2H57A 4KCGA 1OH6A 3I8XA 3SQXA 2AXPA 3B1WA 2WAYA 4I1OA 4OK3A 3A58B 4TQUS 2D7DA 2X8AA 4PHTA 4GZLA 4FMDF 4KO8A 5DIFA 3QKSA 3NTUA 3IQWA 1XEWX 1ZUIA 4URXR 3MG9A 4BZXA 2EQBA 1E4YA 4AY2A 3AVYA 3HPRA 4HLCA 1KMHA 5J5CA 2Q9CA 3QXJA 3ZVRA 1NKTA 4A2WA 4XVUA 1JPJA 2YKGA 3IBGA 1RE0A 3EIHA 4MKGA 1QZXA 3U44B 4NYIQ 4ESHA 5FTLA 2WJHA 2WWGA 3CH5A 3QBTA 3D3QA 4U7DA 5JSZB 4I1UA 4BRUA 3LVRE 4JT4A 1J70A 4G5SA 1UEJA 1IXRC 221PA 4JS0A 4TLBA 3GFOA 5JEDA 4KXFB 2ZSEA 4MRNA 4JLDA 5F98A 4A8JB 2CMKA 4US2R 1XEWY 2ZRAA 1NY6A 2OV2A 1D2NA 3BJIC 4QGAA 4HI0E 3THWB 5JRZA 4PQFA 3GLIE 3H86A 3OAAD 1U8ZA 2VSFA 1TEXA 3HJNA 4A8JC 4IXNA 4JLBA 2ZTSA 4X8MA 5EP2A 1K8RA 2QE7D 4RZUA 1CU1A 5BWMA 5JJKA 1F5NA 4JLPA 2Z83A 2GXQA 4QNRA 1GP2A 2QA5A 1QHIA 1XJCA 1L7VC 2FEMA 2P6UA 4PSVA 1KNQA 4MRVA 5M04A 2IUTA 821PA 2FF7A 2R6CA 1ESMA 4M9QA 5EJEA 1YR7A 3N2IA 4KJZA 1GDDA 3FDIA 3VHLB 4CEIA 4NPHA 3LDAA 4HB2A 3QXCA 3PR1A 2ASEA 3U7HB 2QROA 1S4QA 4IOMA 2GCPA 2ZR7A 3A1TA 2ZSFA 4ARZB 3OEHD 3CNOA 3UXMA 3DM5A 4Q1EA 5FPSA 4HUQA 5FTMA 4YMVA 3FGNA 4A36A 2GXAA 4EPTA 3WBKA 1RRGA 3QJYA 1ZW6A 4WAUA 4BFYA 2PLRA 3ND9A 3RYTC 2VEDA 1JR3E 2J0VA 2CLCX 1A7JA 3CR8A 4WW0A 3SJCA 2FSHA 4Q4JA 5EXSA 4HDQB 1DAEA 3NHAA 4F4CA 3PFIA 3PIRA 3TNFA 1RFHA 1YJ5A 4B44A 3E2IA 3JZAA 2O0HA 3P32A 4TMZA 1YHNA 2AD1A 5E4FA 2PMDA 1ZCBA 4OBEA 4C7OA 1VCIA 2VA8A 3CIOA 1SZPA 1E2MA 2FFBA 4UXJA 3A4NA 5JS8A 4MUAA 5JECA 5EE5B 4D82A 2GETA 4QM6A 3N5CA 2HEIA 4M9XA 4XD7A 2V54A 4DXAA 2ZM5A 2ONJA 3GFTA 2FGKA 4RFSA 5GVRA 2HCJB 3OEEA 1MABB 1ZMXA 2EYQA 4OQXA 1E69A 1RJ9A 1GSIA 2ZRBA 1AKYA 1WMSA 1FL9A 3RVBA 4KODA 1E9CA 3T1VA 1Z8FA 2QPAA 4TT3A 3W3AA 1KSFX 2C8VA 2OBMA 4RVCA 4QBGB 4LCBA 4M9SA 4ZO4A 4F93B 1ODFA 1CTQA 2KE5A 3UMFA 1NMXA 2A9KA 2W83A 3FFBA 3GLGE 1M74A 3BB3A 1VG0B 4DLWA 1NN1A 3L0PA 4KU4A 1EX7A 3WMGA 4LC1A 4IVPA 2ZUBA 5SZJA 3Q9LA 1QDEA 3F3YA 3KKNA 4B3XA 4TL8A 1R0WA 1MRNA 1WA5A 1KI2A 4PO8A 2IX3A 4FWTA 1Z29A 1CR4A 4ASUD 2O8CB 3BIFA 3TGPA 2HT1A 1V43A 4C0LA 1E79D 3DKPA 3GLFB 5FI1B 2CL0X 1DVRA 2BMEA 4HEJA 3BH0A 1DE0A 1ZVQA 4MKHA 3VR4A 1P62B 2OCPA 4ZCIA 1R6BX 3HYRA 1Z63A 4QBIA 5EP3A 4Q9HA 1M34E 2CVHA 2GNOA 5DH9A 3V00A 1ZD1A 3ZJYA 2J0UA 3ZVMA 2JA1A 3GEHA 1FOEB 3K0CC 3LWNA 3VU9B 1U0HC 3UK6A 2H5EA 2OCYC 2FZ4A 2NO1A 5E7JA 4IW3B 4CVNA 2RHMA 4JKIA 3Q5EA 1LTQA 3THXB 2ZU0C 4I81A 5FR1A 1VCNA 1ZU4A 2RB4A 3L8YA 2C9OA 1GRQA 1P7CA 2AWNA 1TUIA 3B2EA 1GIAA 3P27A 4E5UA 1G6HA 4YXWD 3FKSD 5EE1A 1OFIA 2ZI9A 3SQWA 1KYIA 4I1VA 3GEIA 1XTQA 1XF9A 1E3MA 1ZP6A 1FUKA 4DCTA 3KQUA 3OHMA 2ZETA 3SOPA 3OFND 2ZE5A 2ZYTX 3K9GA 3WYGA 2VHJA 4B6EA 4C0AC 1CS4C 4B3DA 5FOTA 2ZRPA 3UMSA 3GLIB 4OJQA 4D25A 1U98A 2EVWX 3LBNA 1A4RA 3QY0A 1WXQA 2OILA 3O8CA 2V9PA 2WWXA 4M1YA 3IHWA 3EWAA 2J0QA 1KI4A 2XSZA 2EFCB 4BLPA 5DNYB 1LB1B 1XCPA 4W5WA 3ZQJA 5DSZA 2ZR9A 2AK2A 4L5BA 4QHSA 1KDOA 1WBBA 2P3SA 3NWJA 4H9GA 1A5TA 3K0EA 2PMKA 2BMJA 4ACBA 4LV5B 4JLKA 4F38A 2V6IA 5AK0A 4FXPA 2IYUA 2IS6A 2PBRA 1OXUA 2ZRJA 5FTNA 4B3CA 4NCHA 5G3YA 2HLDD 1SVWA 5C4GB 4CEHA 1W49A 3H84A 5KDLA 5P21A 4KAXA 2ZSDA 4C2UA 5LDDC 4OQNA 2G83A 3WRYC 4V0ME 1W2GA 3UWKA 4YQFA 3X1XA 4A0RA 3X1ZA 1D2MA 5KDOA 2WMOB 2FSGA 2GVIA 2ZE8A 3BJIA 1G8PA 1GKUB 1R0ZA 4FI3C 2XZPA 5TV2A 4CEJA 5FPYA 2QMHA 5F3WB 3FTQA 3GLHB 4JJZA 4B2LA 5IK2D 3KQNA 5CM8B 3K0AA 1NJGA 4HUQB 2BEKA 1D8TA 4LHYA 3AEZA 4X8OA 3ADKA 3FMFA 1CJKC 3S1AB 1G7TA 1NMYA 3BGWA 1KKLA 5D3MB 2ANBA 2V7QA 4W9MC 4NYJQ 2V7QD 3A1SA 2QTVB 4WVFA 1Z07A 4ZCMA 5JMTA 4ABYA 2FOLA 1YZGA 2WHXA 2Q3MA 4RZ3A 1ZNWA 2O0KA 2QENA 3W8RA 2QMUA 1TQ2A 3DMNA 2QQEA 5KSPA 3PCRB 1FAQA 1DS6A 5FUVA 3A37A 4B33A 4OI1A 1Q0UA 1Q1ZA 1R0YA 3C41J 3Q7PA 4U00A 1MO3A 2A5GA 4OQFA 2LWIA 2HCBA 1I4LD 3LW8A 3BC1A 4IJMA 4KFSA 1W4BA 4TMTA 1E2KA 2IEYA 4TYNA 1Z6YA 4G5QA 5HKKD 4M1WA 4B48A 3B60A 4IVQA 3RNLA 3LRPA 4LJ8A 5JS7A 1EFUA 2J0SA 3SHWA 1G5RA 5C4MA 1YRBA 2ZS7A 3CUEF 3HR7A 1TL7C 2ZYVX 3LFUA 5ANRB 4K46A 2ZE6A 3SJZA 1OLOA 3AVWA 1W0JA 4QNMA 3RHFA 1OHHA 1Y3AA 2C77A 3LQRA 1G8FA 4BE7B 3Q3JB 2R6AA 1CJVC 5DGXA 2WSSD 2JLZA 2NO9A 3AKYA 2IYXA 2X1VA 3NBYC 3K53A 3W6OA 1UAAA 4JYBA 1Q44A 1WCV1 3OESA 1IN8A 1NN5A 2DWOA 4P4SB 3TAUA 2G3YA 3CRRA 4JLVA 2Z5FA 3I73A 5EXTA 1P60A 1XD2B 4BECA 4K8OA 2BIFA 3RLFA 2C96A 1T9HA 2QY9A 5DI9A 1BO6A 4RD4A 3BB1A 2RGXA 3Q72A 1Z83A 4YMWA 2ODNA 3TBKA 1G4UR 5FBVB 3CPEA 2QMOA 4R2HA 4NMMA 2A5FA 2IK8A 3OZXA 1VPLA 3CBQA 5HE8A 1CRPA 2BC9A 1XX6A 1X8JA 1X6VA 2IHBA 2O8FA 3TQFA 4ZKEA 2J46A 3M0EA 1KO1A 3RSOA 3LA6A 2O8CA 3CZPA 4IDOA 2GEDA 3REGA 2QUZA 2YUUA 1HQCA 4GRAA 4TYWA 2GZDA 5IDVA 1OYYA 3I8SA 1YVDA 1FUUA 2NMVA 3ND8A 3LH5A 5FOUA 5CIWA 3C4JA 3JVUA 3MUFA 5E7MA 5TY0A 1FW6A 3P1JA 4L4UA 3MGCA 1MT0A 3BOSA 3M4YA 1DG3A 2ATVA 3JVVA 4XH9B 1U81A 2VP0A 1EESA 4S2EA 5CIQA 1MV5A 4A1FA 3NDBB 2ZREA 1XTKA 5A4JA 4OHXA 3TUJC 4KSCA 3THYB 4UXHA 4BWYA 5KOYA 1OB2A 2QGNA 1LY1A 1W36D 3CRQA 5EE0A 1FARA 1CJMA 1T0JB 3I3SR 2FPMA 2WOJA 1I4TD 3DPUA 5JI3E 2HYDA 1UDXA 3GEEA 1L4UA 2VP6A 5H70A 4FCVA 2FA9A 2OBLA 2XB4A 4BRWA 1WB9A 2VLIA 2C9CA 2JEOA 4A9AA 1IAQA 1SHKA 4NE2A 3ZDQA 1DO0A 2QL6A 2QP4A 5TMPA 4G5GA 5EZ6B 4ZDIA 3E5HA 4GI7A 4D26A 1R2QA 4LX0A 5CITA 2WWWA 4NCIA 2V3CC 4TZ0A 3BAFA 2J45A 4RFSB 3NC0C 3NEYA 1UM8A 3AUYA 1E9RA 3WYFA 3F8TA 2ZANA 3BFVA 1HEIA 1VIAA 4IKEA 4Q5IA 3RRMA 1RC8A 3PUXA 2YNMA 2FFHA 3TQCA 2E87A 4P4TA 2GWHA 2JJ2D 5B57C 1NVWQ 3K09A 4LHZA 3P4XA 2PX0A 4RZXA 4IOJA 1KKMA 1BS1A 1MO5A 4FWIB 2ZI6A 4RKFA 2Z43A 3IO3A 1DPFA 1HUQA 1OKKD 1Q1BA 3U60B 2ZSAA 4MGZR 4TMWA 1TAGA 5AR1A 3FYHA 5DN6D 2OFOA 1XTIA 4X8HA 2G6BA 1W0KA 4EKDA 3EXAA 4UXIA 2OE2A 2DWQA 4NP6A 1CJTC 2GESA 4XTCS 5JWOA 1JJVA 3EARA 3ZD6A 2IYWA 1G3IA 2ZRHA 3CB4A 2FG5A 4TWZA 3TRFA 2AL7A 2A5DA 3BXZA 3WMEA 1WF3A 2RAPA 4P4SA 4Q47A 2JLYA 4RD2A 1QRAA 3DZDA 3B82A 3AVTA 2FSIA 2QPTA 1OT3A 4DSTA 1C4OA 4Q4AA 4BUJA 2YWFA 2AN9A 3OEHA 4E22A 4EPWA 3BERA 4DSUA 1RFLA 1TQDA 4TYYA 1NVVQ 2W00A 2EFHB 1KNXA 3VU9A 3IQXA 2QGZA 2B7CA 2DPXA 2BM1A 1SHZA 4PAQA 4BEBA 3KKPA 4QGGA 3AVXA 3ASYA 1OIVA 4JKYA 1FZQA 3SYLA 3U7FB 4MYUA 1VG8A 1J2JA 5FI0B 3CXLA 4D80A 1P72A 1KJZA 2HLDA 4GNKA 2J9RA 3HPQA 3TR0A 5K8IA 4QRHA 4ZI2A 2H16A 5EXPA 4EUNA 5B30A 1E9DA 2BM0A 2YV5A 4ZDJA 1F48A 4C9BA 3DDCA 3WYAA 1ZYUA 1S1MA 3IEVA 1TX4B 1GFIA 2QZ4A 1DAMA 2FZLA 1N6OA 2NO0A 1RJ9B 4PC2A 4BEJA 4P31A 3U5ZB 1VYVA 2X2EA 1FMJA 2XSZD 2N46A 1OIWA 4DRZA 3P4YA 1GL7A 4XWOA 2O8BB 4EPVA 3FOZA 2XTZA 4XWKA 2SHKA 4LV8B 1G7CA 3V9PA 4KVAA 1W36B 2CK3D 1EWQA 1P3JA 4B3FX 4EFMA 3U4QB 5LB4A 3CR7A 4IHQA 4GOJA 4JBYA 2IYRA 4H1UA 4AK9A 3SJBA 1UKYA 3VFDA 5EQTA 2NO6A 1IONA 3IBYA 4G3XA 5D3MA 3GPLA 3ZZUA 1H8EA 3EPJA 2QRNA 2N42A 5EE9A 4HB4A 1ZNYA 2JAQA 3SYNA 3R9WA 1KY2A 4YXWA 3NG1A 1RZ3A 1XFAA 2L0XA 1NBME 1E0JA 4YC7A 4DB4A 1T5IA 5GJVC 1S2MA 4Q1BA 4QKQA 3LY5A 1HQYE 2MSDB 4FD2A 1S0UA 2B92A 1KI1A 3RWOA 3QNUA 3T15A 3W5JA 2XOKA 1OPXA 4DLRA 2OZEA 1KBEA 1N5IA 5FBWB 4HZUA 2O8DB 1QHXA 3I61A 4V0KA 1KDRA 4QGHA 2C9YA 3W90A 4DLXA 4WIAA 1NNEA 4PR0A 4TTQA 2CK3A 4JJKA 1EFRD 3ZIAD 1Q57A 5DI3B 4M0LA 1YZKA 2ATXA 3U3RA 3DO6A 5JZVA 3VTKA 1JBKA 2VP4A 1L2TA 2VF8A 1E9BA 1PTRA 4LBWA 2GEVA 2VRWA 4Q48A 3TK1A 4HDOB 5AUQA 5HCNA 5JHHB 1GTVA 1HA3A 1E9AA 2WVJA 3KTAB 2YINC 1H65A 4B34A 2CCJA 4GL2A 3KJIA 3VNUA 1F3OA 2ZJYA 3CH4B 4OK5A 3CO5A 1IOZA 2QMEA 3RAPR 5FR2A 1G3MA 1GOTA 1KZ7B 1OIXA 2WJVA 3GLIA 721PA 5K8UA 4MGIR 1Q1EA 3N70A 4V0OA 4EFNA 4DDUA 3KKQA 1VHTA 2WV9A 1SKYE 3O47A 1M6NA 4LV6A 3C7KA 3HU2A 1GKIA 2OAQ1 2OFWA 1S3SA 2ZVPX 2OO7A 2I3BA 3OEED 1JXOA 3NEJA 4Z51A 4F91B 5DLQC 5KSZA 5CK4A 3WY9A 4NHOA 3TMKA 3QSYA 2ZROA 5KNCA 3KY9A 1TPZA 3K70B 3EZFA 4OHWA 4II7A 2QAGB 2FE4A 4TYPA 1XZPA 4A4DA 4DIEA 5HE9A 1PLKA 1TADA 4M21A 3LBIA 1OW3B 1ZIOA 3MWYW 1TQ6A 2EYUA 2XZLA 1Z28A 4EQ6B 2ODEA 1E2PA 2O8EA 2HUPA 1T0HB 3KUDA 2ODWA 2ZSBA 3U6KA 1ZC4A 1W5TA 2E9SA 3JZMA 5JI2E 3VQTA 4Q7JB 4CT5A 4PPQA 4QBFA 2JIZA 4BFWA 3QPVA 4NH0A 4F7WA 3B1YA 4MDEA 3U3KA 4DUGD 2XGJA 5CB6A 1W1WA 4JIMA 4A2QA 2QT1A 1N3BA 3R7WB 1PLJA 2IS1A 1PTQA 1JJ7A 1FP7A 1NL3A 2WIBA 1N6IA 1KO5A 4J0QA 4A0FA 3K9HA 4IXMA 4MRPA 1XBTA 2QBYA 3ZS8A 2P67A 2CHGA 3TH5A 1AQYA 2WIAA 3QKTA 4BZQA 5JBQA 2ZXUA 1CP2A 5F2EA 4N3NA 2BJWA 3M6AA 3KXLA 3ZH9B 2OG2A 3K0CA 4OYHA 1S9HA 1Z0FA 3I4LA 4LBYA 1UADA 1LF0A 4MYCA 3ICQB 2ERYA 3GMTA 4B3GA 4KBFA 2XEXA 2IUUA 2AWOA 2YOFA 3BE4A 4EJSB 3MMPA 3MAAC 1QG2A 3SEAA 4D0NA 2FFAA 5G41A 1R8SA 2FPKA 2AX4A 3RRYA 3TSOA 2BBTA 2UZIR 3QKRB 1M8PA 3D31A 1E2EA 4A92A 2WWYA 3DOFA 3KKMA 4NYIR 3VKGA 2R9VA 1HE8B 1UKVY 3H1TA 2DFNA 5BXQC 1UF9A 1QHGA 3T1QA 5H1YA 3HYTA 4TQAA 1G20E 4XSHA 3SE0A 1NVVR 2IYTA 1Z2CA 2ZS8A 3GJ8A 4CIDA 2GTPA 5FUXA 1N5LA 1NN3A 3REFA 8OHMA 1Q22A 4MYHA 4L9SA 4PANA 5HPYB 1QHHA 4PHFA 1XDBA 3MWJA 4O2LA 1LFDB 1XD2A 4LYFA 3UGDA 3DHWC 2B8TA 5TVKA 1X1SA 3KXKA 2Q9BA 4KLNA 1W47A 4TSFD 2J3EA 2DFLA 1TMKA 4LHWA 1X8KA 2GVZC 4LJ9A 5FTJA 2WWFA 3W6PA 1D9ZA 2F9MA 4AYWA 1GG2A 2YOHA 1ZAKA 3L43A 4IDNA 2IF0A 1I2MA 1CF4A 4GOKA 4FCWA 1IXSB 4BFZA 5E7IA 1ETUA 2PX3A 1XEXA 2AKYA 1G7SA 1SVMA 1R8QA 5HR5A 2G0TA 1TU4A 2G1JA 3CRMA 5JJIA 1BMFD 1KGDA 2F55A 4QHTA 2QEQA 1KJWA 1AGRA 1R79A 2N1BA 2D3WA 2Q6TA 4M53A 4EJSC 3W8NA 5IF9A 1CJUC 5BN4A 2F1IA 1GL6A 2ZRCA 1KBFA 4ERNA 4B6DA 3BFXA 2YYZA 4HLQB 3RS7A 4G0NA 4B32A 2QQ0A 3B78A 3U7GA 2ZYUX 4Z1MA 1AS2A 3ZQ6A 4A6PA 2ORIA 4NL4H 4MITA 4IFEA 5FOSA 1M7BA 2YJTD 1NJFA 3HDTA 4L9WA 1FNNA 4WOPA 3KKOA 3T1TA 1IN6A 2PJZA 1FTSA 2D7CA 1E1QA 1P75A 3BB4A 1FTNA 2TMKA 4RFVA 5JLJA 3LX8A 1SVOA 3FB4A 3ONWA 4V03A 3QENA 1JB1A 5DI3A 1AGPA 1TQ4A 3CWQA 1KMHB 1ZU5A 1E2FA 1ZBDA 1E98A 1YR8A 3U44A 2JASA 3IPYA 5KNDA 1E0SA 2NZJA 1G5TA 3DZ8A 5KUTA 5GJCA 4R98A 1OB5A 2W2TA 1PZNA 2IXEA 2V6JA 3NVAA 3T5GA 4Q00A 2ROWA 4YMSA 1JAHA 2Y8EA 1XP8A 1KIMA 3NIBA 2BKUA 1BH2A 2OFXA 3BWDD 3QQ5A 3VR6A 3UATA 5KSYA 1DBSA 1W46A 3W6NA 2FJUA 2GVDC 2D74A 2C78A 1K6MA 3AF0A 4M1KA 1Q1QA 4D4LA 1VTKA 2GZHA 3EC2A 1FQJA 1T3LA 2AK3A 2UZ3A 2IXGA 4Q9LA 3K0SA 3I92A 2IHYA 2REXB 1KAGA 521PA 1GM5A 2VP2A 4D2IA 1R7RA 3LNCA 4HAXA 3K70C 2DYKA 2J1LA 4D4MA 3SBEA 1HURA 5B58C 2PJRA 2FU5C 2RGDA 3MWLA 3PEYA 4KBGA 3IKJA 1D6JA 2QAGA 3WNDA 1BIFA 1YZNA 4OL0A 2DWPA 5A0FA 2YZ2A 2WWHA 1W0KD 4HZIA 2QM8A 2PCLA 2RGAA 1E1RA 2BVNA 3QEJA 4PO9A 5IK2A 3SDZA 1KK1A 4RY2A 1G3QA 4V0LA 1N0VC 2GEUA 4KFRA 2QORA 3MJRA 4OJKA 2HDNB 5L8VA 3VAAA 3EZ6A 2ZU6A 4EPYA 2C5LA 3IIJA 1NLZA 1AN0A 2OESA 3W3ZB 3B1VA 1WDTA 1ZRHA 1B0UA 1UPTA 3SJAA 2A7QA 3I5YA 3FHTA 1E2NA 3ETLA 3TIFA 3BFKA 2J87A 2QU8A 4QOSA 2HJVA 4DCNA 3K8YA 2V55B 4RD1A 4M1SA 2J5XA 2VIIA 4C0HA 5J4HA 2WJGA 1E6CA 1E1QD 1LNZA 3RABA 1IN4A 1D9XA 2AFIE 1G41A 4PQRA 1R5NA 3NBFA 4ZV4A 4NKRA 3VNVA 1ZD8A 4GSYA 4DCSA 2O8FB 2H7VA 4LK2A 4Q1CA 3WP0A 2W6ID 2FMXA 4PXAA 4UNNA 3AVVA 1IY1A 1ZM2A 2BEJA 1F2TA 1Y8FA 3AKCA 1HY3A 2VYFA 2QI9C 1DTSA 3TVTA 3EW9A 3QOFA 3I32A 1DO2A 4Q01A 1G4AE 2C03A 3BH7A 1XMSA 5HTKA 3LLUA 1HV8A 2QAJA 1QBKC 3H0KA 1Z3IX 3SFZA 3MRSA 1Q3TA 4IOLA 1IY2A 5K8TA 4G5OA 3GLFA 2OT3B 4BZPA 1JPNA 2CLDX 3BRWD 3PXGA 3WNCA 1W4CA 4B75A 5EE3A 1RYHA 1TF2A 2I4IA 2B21A 2ANCA 3Q8XB 1NVUQ 2J7KA 2ZRMA 2IF2A 2QSZA 3EWSA 4YDHB 3AB3A 1II9A 2MSEB 3SBDA 1ANKA 3CZQA 3WP1B 1RKBA 3KX2A 2VSXA 3FVQA 1CULC 4PQYA 3KFXA 1IHUA 3ZS9A 1Z5ZA 3GJ6A 1XXHE 2EFEB 2GXSA 4UNQA 4BFVA 4WZ6A 5LD2B 4DSNA 2A5JA 4B6FA 2KJQA 4OK6A 4TQ9A 4BLSA 4WBSA 4EPRA 4H1VA 3VR2A 4BASA 4MGKR 2B8WA 1NBMD 4NDZA 3F0TA 2IW3A 2ZUCA 4M1MA 2OXCA 4URUR 2XJ9A 3TUZC 1SKQA 1IXZA 4O0MA 1AZTA 1LV7A 4URWR 4ARZA 2P5TB 4DLZA 1VCOA 2WJYA 2REOA 4OHYA 2P2LA 2YHSA 1S1CA 1JALA 4Q7LA 4DIDA 3G0HA 2DFKB 1SXJE 5C2JB 1P9WA 2OUKA 1FFHA 2BHRA 4Q21A 1GNQA 1H8HA 5CJ2A 3SNHA 2FX3A 2ZQ5A 2ZI4A 3UIEA 2YC2C 4F4IA 5CLQA 4DBLC 2E73A 3GLHE 1G21E 1LW7A 2ZI7A 4HLUC 4WXRA 4FKDA 4JVMA 4C0QC 4JSYA 4PC7A 3J81k 1PUJA 2JLVA 4ACAA 1DEKA 2RMKA 3CPJB 3KZ1E 4PPNA 2H18A 5JFGA 2R6FA 4LGMA 3BD9A 2A78A 2JATA 2ENNA 2KB0A 3QPWA 2WWIA 1G1MA 4FMCB 4JBXA 4M1TA 4GDFA 5CDFE 2H8KA 3KJGA 4OHZA 3TAHA 2OBNA 3QIAA 3U3MA 3L82B 5JRJA 2F1HA 2JLWA 1ZM3A 4C0JA 1NVXQ 4DZZA 3OIVA 3TW8B 3H4MA 3WHKA 4JMPA 2NQ2C 2EFGA 1W7AA 5EP1A 5EUMA 2ZRDA 4HAYA 4GMXA 1JAIA 2V8OA 1ZIPA 4V02A 4C30A 1E94E 3X1WA 2JIZD 4PC6A 1XTSA 3NH9A 1EXMA 1SQ5A 1IBRA 4IFBA 2FPLA 2W2VA 2O8DA 2WTUA 2CCKA 3LX5A 3D7MA 2F3TA 3AQ4A 3RS4A 1G291 1U9IC 4KVGA 1FQKA 1CXZA 1KK3A 1SULA 2UKDA 3R9IA 4RD0A 2HXYA 4PTLA 1IY0A 2XNDD 2ZI3A 1BOFA 2B6HA 2OLKA 4JLNA 3GJ5A 4B47A 4JVLA 4L8GA 1KK2A 2W6IA 2IYQA 1PUIA 5FPTA 4DLVA 5BN5A 1QG4A 2AD5A 2VHCA 1XEXB 1S3GA 5L3VA 1YQTA 1RRFA 5DYGA 2VP5A 1JR6A 2RCNA 2W0SA 2DCUA 3GJ7A 2AKAB 2FV8A 2YWGA 1XD9A 1PV4A 1XCMA 1T91A 4AYTA 1ZUHA 1QF9A 2VBCA 2W2XA 4LJ5A 1YRAA 2GBLA 1KY3A 4Q1AA 3GJXC 1AA9A 4TLAA 1Z6AA 3QE0A 3QF7A 3RSLA 3TE6A 1DELA 4LJ7A 3PEUA 5D3QA 3B1XA 5J4VA 2RGGA 3CRVA 3AVUA 1NIPA 3T1OA 4DLSA 1NG9A 1E1RD 1XPUA 3QXHA 3K9LA 3EPHA 4TMVA 1WQ1R 5JSZA 2GKSA 1BKDR 4XOIA 4N0DA 3IHLA 3R9XA 3I1FA 4D0GA 2PT7A 2D06A 2WZQA 1LS6A 4CDGA 1G6OA 3EA0A 1AZSC 4NZYA 2GJSA 3GJ4A 5SZHB 3W34A 4Z54A 2I1VB 1US8A 1BMFA 3OFNA 4AG5A 4URVR 2IC5A 2R6GA 4KI0A 1I2DA 4Q4HB 1KI7A 1P5ZB 2ELIA 2IBMA 1CIPA 2RH5A 1YZUA 4ZKDA 4JLOA 3FHCB 3FKSA 2V1XA 1T8TA 2CXXA 1II8A 3L0OA 2F3RA 1M7HA 3EIQA 3A4MA 4DJTA 3C16C 1DOAA 5EZ5A 4QL3A 1FPMA 4TSFA 1ZC3A 2J7PD 2ORVA 4QFMA 4ZPXA 4A0GA 1JI0A 1NG1A 1ZNZA 1A82A 3C8UA 1EFHA 3QXXA 2FSFA 1H8ED 4N1AA 4P33A 5H68A 1AQUA 5HCIA 1NN0A 4Q4LA 2VTKA 4DLYA 4NTZA 3GQBA 3C15C 3U3OA 4ZDKA 3PENA 5BYJA 4FMCF 3M1IA 4Z8YA 3A8TA 3QF4A 2J0UB 4LYJA 5E3HA 1DAHA 2J59A 4DCUA 5C18A 3CM0A 2ZE7A 1VYUA 1SXJB 5KPDA 1UFQA 1R5OA 2LKCA 4CW7A 1IN7A 2JLQA 4E03A 1DAGA 5FOWA 1E32A 2NZ8A 2PT5A 5FFMA 1VCMA 2WKPA 3PJRA 2JJ1D 1G9XA 5J4LA 4P0TA 4R9UC 3EASA 2Q9AA 4GBMA 4EDHA 2GK7A 2WBLC 2ZJAA 5TARA 1N6LA 4A6XA 2QG6A 1C9KA 3KQLA 3IUYA 1II0A 2ZRGA 1S8FA 1UKEA 1U0LA 1JQJC 2RGCA 3ZVLA 3VKHA 1SXJC 3KL4A 4B43A 2Q3FA 5DYIA 2H1LA 2CDNA 1EG7A 3QBVA 4MUBA 5FPHA 5G53C 2IWHA 5BW8A 2QT0A 4JL6A 3FWYA 1SXJA 4TL7A 4HSEA 1F2UB 5DHFA 3SS8A 1Q12A 5FL7D 3MCAA 1AJEA 1XTRA 2W58A 1SGWA 2WPDD 1P9NA 2ZIAA 4LSGA 2IXFA 2CNWA 1QHSA 3KXIA 2YWHA 3LW7A 1E2HA 4C2TA 1E96A 2PEZA 2NPIA 1XEFA 2G9NA 3WHLA 2ZUDA 1E0KA 2D4HA 5J4KA 1HTWA 1MO6A 5AUPB 3GD7A 2MSCB 1JECA 1PJRA 4FW9A 1JQLB 5CDFA 5CB8A 2GILA 1UBCA 1ZM7A 1FMLA 2W6JA 3ICEA 3A1VA 4Y0AA 2F1JA 1PLLA 4QGFA 2QP3A 1N5KA 1W44A 1XCGB 4FIDA 4AURA 1UKZA 1MH1A 1DAIA 4W5JA 2GK6A 2H92A 2CE2X 3DOEA 1ZNXA 4A8JA 3DVLA 5CYPA 1OH7A 2IS2A 4XVQA 4CEJB 4URYR 2A5YB 3MWKA 4MGYR 3SI7A 3K9NA 1XMJA 3EC1A 3FFAA 2RGNA 4JZKA 3OIYA 3PQCA 1Z0KA 3IPXA 4OI2A 4JSTA 4Q9KA 3QF4B 4V0MA 4Q1FA 2WM9B 3FHOA 3NKVA 4CYMA 1GNPA 3UG7A 1D5CA 4W5HA 4KLZA 5IT5A 5AJVB 3UEYA 2VP9A 4E09A 4KSBA 3S1AA 4US0R 2Z4SA 1HE1C 2P0EA 4PAMA 4WZAE 5FL7A 4R71A 5FH9A 2Q0HA 3R8FA 1XPRA 1CBUA 5J47A 2DFTA 1X1RA 4HLUA 4LYAA 4BLQA 1E9SA 1HT2E 2WOOA 1E2DA 1IQPA 3U61B 1NRJB 2WJJA 1X8LA 4PHHA 1P2UA 1CR2A 4AG6A 6Q21A 1P9RA 2ORWA 2QE7A 2EFDB 1KK0A 1RVDA 2K5UA 4GMDA 1MR3F 4POAA 3W5IA 1XJQA 3KFVA 2FH5B 3L2OB 3NDPA 4HB0A 3GCGA 1U0JA 1G3RA 5TXGA 3VR5A 1KI6B 3IIKA 2JLRA 4XIGS 2XTMA 3OIWA 3OE7D 3Q85A 2ZYWX 1DG1G 2JCSA 4ILEA 2F43A 4Q02A 1NI3A 4UJ3A 3CF2A 2XJ4A 4AIIA 4DUGA 4RJLA 2IYZA 3MLEA 5FPKA 4AKHA 4Q7MB 3IDQA 2HV8A 4JT2A 5AUNB 1OFHA 3X1YA 1O3YA 1R4AA 1KI3A 5AUOB 3EIEA 1G64A 2GCNA 4Q66C 3VX3A 3C5CA 4OQLA 4LOAA 2GJAA 1W5SA 4Q03A 1KI9A 5JEEA 5KYKA 1J90A 2XOKD 3IGFA 1YZLA 4B74A 2BBWA 3U3JA 4BFSA 4Q18A 4RSGA 5AJYA 2GA8A 2QPOA 1SVKA 1EX6A 1OV4A 1X86B 3UKDA 3VMFA 1QHYA 1W4AA 3U6BA 2YOGA 1A1VA 4XSGA 2WPDA 5AJZA 3T06B 4M2LA 2UVQA 2P65A 3D6TB 4Q9JA 5UKDA 4UNSA 1KSGA 4YDSA 3UFFA 4HB3A 3LXXA 4GP6A 4PFSA 5AJXA 2V4ZA 4JVNA 4XJXA 2J41A 2XNSA 3A1UA 4GOXA 4KFTA 4PZYA 4RCZA 4XVRA 3NBXX 2QP9X 4Q4HA 2JDIA 1TF7A 3EX7C 3IIMA 5CM9C 4DC9A 3R7WA 4D6PA 1PVOA 1VDZA 3AVQA 3ZVNA 1N5JA 1YE8A 3A6PC 1T4GA 3B1ZA 3U4QA 3WRXC 1XXHA 1ZM9A 4MYTA 1JNYA 2LKDA 2OCBA 1HT1E 4CGZA 3CF0A 2GJKA 5HZHA 5GADl 1IJFA 1N6RA 2VQSA 4KHZA 4MKIA 5H8WA 2CE7A 2HF8A 3EZ9A 2FNAA 1JEDA 1ZCAA 2WSSA 1WBDA 2GJ9A 2QTFA 1M7GA 3EAQA 1OH5A 2C2HA 1KDPA 3FE2A 4MKFA 3HP1A 2OHFA 3PUWA 3DKVA 4DHEA 1TEVA 1T5LA 3TR5A 3GLGA 2DR3A 3ZIAA 1T3HA 2CBZA 2HT6A 3LO5A 1GAJA 3AF2A 4ZIRA 2WSMA 3D8BA 1P2SA 3FMPB 1E2GA 1N6HA 3K70D 3IILA 4CRWB 4HDCA 1TBOA 3QI2A 3SFVA 5KNBA 5HKKA 2R44A 3LV8A 2FNFX 1N6NA 2KI5A 2F6RA 3V4RA 2VHTA 4QG7A 1XRJA 3W9YA 3THYA 1KO8A 2IEZA 3CNNA 1P4SA 1P2VA 4TMXA 3SR0A 1R5BA 3H2YA 1J8YF 1KOFA 3GJ0A 2ENZA 3KUCA 4B76A 1QHNA 2YC4C 4QBHA 5L3SA 4CT4B 1KMQA 2KBEA 1GWNA 3B5JA 2YWEA 3AV0B 3PVSA 2ECKA 2QAGC 2OCAA 3FPAA 3LLMA 3K09C 2RGEA 2NGRA 1KSJA 1TU3A 3T35A 2ZITA 4CEHB 2C04A 4UNRA 3QXSA 2ZS9A 2O52A 4L9MA 2GHIA 1ZM4A 1U94A 3ZGXA 1U90A 3KJHA 2BBOA 5FTKA 4B35A 1O87A 4WA7A 1OFUX 1Q20A 5LD2C 2ODBA 3C14C 3AP3A 4IVRA 4RKEA 3MSXA 4DEXA 1XMIA 1OXXK 4TZ6A 2O8BA 4C0SA 1RRCA 3WBJA 1ZJ6A 3RRNA 3K1JA 4L15A 4MRSA 4Q7KA 4TLDA 3CNLA 3AP2A 1XJ0A 1TNDA 2NO7A 2QM7A 4KYUA 2V1UA 4DWJA 3I5XA 5AJWA 2HJGA 1WRBA 5BQ5A 3RC3A 4A15A 2JJ8A 5B64A 1OXTA 4ZCLA 2G1KA 1U8AA 4MDFA 2JJ2A 2XTNA 2P6NA 1GRRA 5LPNA 4I1SA 3RRZA 2I1QA 4DCVA 3CRW1 3AM1A 2ZJBA 1Z2AA 3TVDA 2DY1A 1QHHB 2G0NA 1Z22A 3B9PA 1KHTA 4NYMQ 621PA 3L0IB 4IDPA 4V0NA 1Z6GA 3B9QA 4BLOA 3Q7QA 2NOAA 1G8GA 4BPBA 2PL3A 1BYUA 2F7SA 5FBQB 1W4RA 2RKOA 2R2AA 3CW2A 1OFTA 4CF7A 3NC1C 3V4FA 1X3SA 5CK5A 1Z6TA 4PX9A 421PA 3UGIA 4HAUA 2FWRA 2H17A 2ZRFA 1H8HD 3KQKA 3LAWA 4I99A 3AP1A 1KI6A 4DDTA 3IO5A 4C0BA 1GKYA 4AKIA 2HXSA 2VH5R 4JVSB 1OF1A 5KSOA 3DMDA 3RS2A 1U8YA 2OAP1 4G01B 4URZR 4EPXA 1CEEA 1P61B 3UPUA 4OHVA 4NU0A 3TKLA 4U02A 5G3ZA 1YR6A 3I72A 4GP7A 4LBVA 3WXMA 1RYFA 5C1BA 2NTYC 1TF5A 1NBMA 3KDSE 4DLTA 1RIFA 3KTAA 2EWWA 3DEFA 1OJLA 2BDTA 2IYVA 2YVUA 1KSHA 4IRUB 5G40A 3VKWA 2OSBA 1W36C 3FKQA 1JXMA 4MQBA 4X8LA 4NCKA 4KV9A 1MABA 5DN6A 1E2IA 1FX0A 1G8YA 1RRPA 4LUCA 2WAXA 4LYHA 1OKKA 4PO1A 1P2TA 4MA4A 2ZRNA 4D0LB 4JL5A 3T12A 3G5UA 2VF7A 3RDPA 3EPKA 2GJ8A 2ERXA 2HF9A 3TLXA 1DADA 2WICA 2QTHA 1VMAA 4U5XA 4PHGA 3Q5DA 4UKDA 1U9IA 2MMGA 3CONA 2OXRA 3VX4A 1IM2A 3QKUA 4JLMA 1XZQA 4AD8A 5JCZA 1XMVA 4D4JA 1GNRA 2ZJ2A 3X1DA 3ADCA 3BORA 3C5HA 3K0FB 3BBPA 3UANA 5TDHA 1YU9A 4EIWA 2GCOA 4Z8XA 2ZEJA 5JWRA 1MRSA 1QVRA 4TLCA 1JEEA 4TTPA 5KPJA 3CX7A 5EP4A 2Q21A 1P6XA 1ZD9A 1IN5A 2R8RA 3L8ZA 1NKSA 2PZEA 3KJEA 1COWD 5JCPA 4Q19A 5LB2A 3PEVA 4GFDA 1MKYA 1UEIA 1ESNA 1I4DD 2FN4A 2KWIA 2RHDA 2Z6VA 4DSOA 1Q21A 1NMZA 1NP6A 1QVAA 2AR7A 3ASZA 3LQQA 4LPKA 3AF4A 1VIYA 1R0XA 2CJWA 5FBLB 2IS4A 2JJ1A 2VHQA 4M22A 1U99A 4ZIRB 1DAKA 1NIJA 4S35A 1OHHD 1OXVA 2WKRA 3PG5A 4OI4A 2ZJZA 2F43B 2REBA 1GL9B 1W0JD 4FCTA 4LJAA 4AC9A 1VHLA 4DT1A 4US1R 3HU3A 4IEIA 3RS5A 3THOA 4A2PA 3QEOA 4Q4JB 4QJ3A 2VSOA 4TL6A 1UBFA 3SC3A 4ZDWA 2D2FA 1E2QA 3AGPA 4MRRA 2VPPA 3NH6A 4XD7D 3B85A 1W48A 5JWHA 4BQSA 1Z47A 5CJPA 3CWZA 2ZJ5A 4PSKA 1K5GA 3QUSA 4RCYA 3HWSA 4JLJA 1YR9A 2J7PA 2A30A 3WMFA 4HAVA 3SU8A 4FMDB 3AKDA 2OLJA 5KO2A 1MOZA 4OQMA 4A82A 2QN6A 1HH4A 2PCJA 4PSAA 1GILA 1SKYB 1XU4A 1V5WA 1N0WA 2ONKA 3QKRA 3BH6A 5JHGB 2C95A 3ZZ0A 2CL7X 1S9DA 4GPTA 1ELOA 4LBZA 3N2EA 3T34A 3CPHA 1XTJA 5KHOC 1US8B 1NF3A 2BV3A 1KO7A 3L0SA 5GJWC 3U2QA 4DDWA 4K81B 1F2TB 1NSFA 4EAQA 3AVOA 2EWVA 4PC1A 4BLTA 4NYMR 2IWRA 3UMRA 2GAAA 4C4PA 2QSYA 1OSNA 1B23P 2R65A 3UWOA 4DLUA 1M1YE 3AKEA 4LHVA 2NPFA 4M1OA 4QXAA 2BMFA 4OKSA 1T8UA 3O8DA 2HYIC 2AFHE 3B13B 3QVVA 1WP9A 4ITRC 4LI0A 3ECCA 2PLFA 2A2ZA 4N0EA 1OH8A 3EG5A 4LWZA 3RS3A 1GZSA 3UG6A 5F9HA 2ZJ8A 3A36A 4EFLA 4R7ZA 3RANA 5E95A 3PUZA 4LRWA 4OI0A 2CCGA 2D62A 2JLXA 4HZUB 5CLLA 3RS0A 2IA5A 2ZI5A 4Q4AB 3LVQE 3GP8A 4QHYA 1N25A 2MMCA 3KQHA 3R8CA 4DVGA 3G82C 2XXAB 3A4LA 4HUTA 2BCGY 1NSTA 4KFUA 3ADBA 4LC0A 4HAZA 4NYJR 5KTYA 2WJIA 4TYQA 4F92B 3GLFE 1XWIA 4Z1MD 2O8EB 2XNDA 2QBYB 1SVIA 2GF0A 4PPGA 1RPZA 1GVNB 2W0MA 1Z06A 3GFPA 1L8QA 1G18A 4E07A 4C7OB 4D4KA 2AXNA 2EW1A 5FOXA 4BLRA 1L4YA 4BFUA 4WXPA 2A3RA 4QM7A 1EGAA 3GLGB 3P20A 3OF5A 2PEYA 1C1YA 1WE2A 5F9FA 1CR0A 4G1UC 3EA5A 3E70C 3ZYCA 3QG5A 3R20A 4PZLA 2XITA 3WNBA 1FX0B 1VG1A 3CLVA 2XXAA 4P3YA 3SHFA 4LZZA 1P73A 2ZRIA 1EWRA 5K8LA 2C98A 4O3MA 1J99A 2NIPA 2WMNB 5KDDA 4IOKA 1D2EA 2JGNA 4NONA 1RW4A 4CZ2A 4QJ4A 4IDQA 4BFXA 1VKJA 1EK0A 4C3ZA 4DB2A 3AH8A 1LS1A 1BYIA 5ELXA 2IT1A 1E9EA 1XXHB 3QVUA 3RC8A 5HZKA 1Z0JA 4RZ2A 3ZLJA 1KO4A 2DB3A 3IEUA 1G3UA 2VHUA 3AF3A 2ZPTX 1F2UA 2ZRKA 2XAUA 1E4VA 3PEWA 1E2LA 1E9FA 3I62A 1E79A 2ZRLA 1VYTA 3NXSA 5DO9A 1NLFA 4CEIB 3OIUA 2CHVA 4FMBB 3TJZA 3B6EA 1LVGA 2O5VA 1UDWA 1TTTA 3E1SA 4TL9A 1NY5A 1MO4A 1CR1A 1Y63A 1AS3A 2P6RA 1E2JA 2ZAOA 4F4JA 1COWA 3CX6A 3K0AB 3KB2A 3O8BA 4NCNA 5J4YA 3THXA 2ZAMA 2X19A 3P26A 1UBGA 4LDJA 4A0HA 4B71A 3PUVA 2BKEA 4TT3D 1FP6A 1A2KC 4DT1B 2JDID 2XZOA 5A5GA 1VECA 4JYCA 3X2SA 3PUYA 1CLUA 1G7RA 3EPLA 3LXRA 1KI8A 4TMKA 4GZMA 4O2RA 1XPOA 1SVSA 4GT1A 2DB6A 1OYWA 2VRWB 5AWFC 2ZR0A 2G88A 2JLSA 2XB2A 1G5PA 1E0AA 4M4SA 4DKXA 4PPFA 1OXSC 1Q3HA 1G16A 1K5DA 1GRNA 2F1RA 1UBEA 1AIPA 3QPUA 3CX8A 1TUEA 1T6NA 4B73A 2DHRA 3B8HA 5C46F 4B2PA 2CLSA 5EUQB 3FMOB 3QKSB 1AK2A 4NCJA 1G17A 4EJSA 5B2ZA 1ZUNB 4Y0VA 4HLDA 5FUWA 4FN5A 1Z0DA 1GITA 3PITA 5L3SB 2FGJA 4AYXA 2VL7A 2GAOA 3HU1A 1HYQA 2IYSA 2X77A 4IDHA 4MH0R 2X2FA 3TSZA 4AKGA 2GDJA 1TBNA 5GJBA 4UJ5A 1KAOA 3SYKA 3TSWA 5LBIA 3DM9B 2Z4RA 1NLYA 4JL8A 2ZJOA 4D81A 4AKEA 4KITB 2CEAA 2PH1A 5L3RA 4ASUA 3LBHA 2WKQA 1JR3D 5FL3A 4AWXA 4NBSA 3OE7A 3AUXA 4EQ6A 2Z0MA 4HYYA 1Z6XA 4L16A 2KBFA 1AM4D 1U2RA 2IYYA 4UNPA 2FDCA 1N6PA 1R10A 4O25A 1UJ2A 3AVPA 1N6KA 4JBWA 5J40A 3PV0A 4XTRA 4ESVA 5SZKB 2Q3HA 3ZD7A 3K0FA 4TTRA 4B2IA 2BWJA 4PZZA 1T3SA 5DISB 1LF5A 2GCOB 3MJHA 4C0KA 5L3QB 2G77B 3HR8A 4UQOA 121PA 3CF6R 4LJ4A 2KSQA 2C99A 5FOVA 5TB5A 3SZRA 1IJEA 1YZQA 1Z0AA 1S96A 2AHOA 3UEJA 5GVSA 1XA6A 3LD9A 4YMUA 1J8MF 1JR3A 3BK7A 2QNRA 3SN6A 1N2CE 1YKSA 4PAOA 3T5DA 2B7BA 5CYOA 5EXXA 4DEYA 3A1WA 2PZGA 4LY6A 5FUYA 2E1RA 1AKEA 4TN1A 3UGLA 3KB1A 3QG1A 1VG9B 1EFRA 1OE0A 4Q1DA 2IYLD 2W6JD 3MD0A 2O0JA 4M9ZA 4ZI3A 2FEOA 5JJLA 2CHQA 5FBRB 1G8HA 2R6DA 1SVLA 3RWMB 2BBSA 1CKEA 4AI6A 3F5FA 3ZZTA 2OM2A 1Z08A 2XX3A 3BS4A 5DHAA 4TLEA 4LHXA 2CNWD 2ZVQX 4IEEA 4LJ6A 1DARA 4BGDA 1EFTA 1E99A 2IUSA 2BCJQ 4RD6A 3VR3A 4WZBE 3O8RA 2EU8A 2RGNC 1XNJA 2FFQA 4XWAA 3CKLA 2QRZA 4LJYA 2CVFA 5BN3A 2GZAA 1F60A 1SXJD 1M2OB 1G19A 5DE3A 2GRJA 4Q9IA 3GJ3A 2R62A 4HATA 4JLAA 3AF1A 3MFYA 3VHXA 2JLUA 4BFTA 2P5SA 1KDTA 4KYIB 3VR1A 3AGQA 4YMTA 4ON9A 4B3BA 3T61A 2OEPA 3ADDA 3THWA 1ZINA 1A2BA 3OAAA 3EZ2A 3GLHA 2GF9A 4QC2A 2BJVA 1CRQA 2DBYA
chains in the Genus database with same CATH superfamily
3HCBA 1A1VA 4DMFA 2XEDA 4I4LA 3W05A 2MSWA 1IN1A 3MMXA 4MV1A 2D2EA 2NTNA 5CBKA 1O95C 5A3RA 3G9UA 1M1NA 2QZJA 5KTOA 4BU1A 1EFCA 4FS3A 5L3QA 2DE0X 4G0VA 3PX3A 3D0RA 2WKSA 2F9LA 1XOIA 4Q6WA 1DDGA 3NTOA 2YNMC 2GBLC 3C74A 5EJ4A 2N75A 4XGNA 2Y6UA 5CFNA 4M8SA 3VR5H 2PO7A 1MOPA 3I2HA 3I2FA 1U2GC 1YB7A 1WNFA 4LDNA 5YASA 3OZRA 5BYKA 1RWOA 4YLGA 2EZTA 3EPRA 2I9PA 1X94A 3W2GA 2WI8A 4PC3A 2X9VA 4MGEA 1KTVA 3PFHA 2BMDA 3EXHA 3DCJA 2AB0A 3EZ7A 3TW4A 4BWFB 4DBZA 1X19A 3TXAA 1EFPA 1J1IA 1BE0A 1I24A 2GXUA 4Z0HO 1JG3A 5J9FA 4GX5A 3I8XA 3PF8A 3PKJA 2AXPA 3HLYA 4LRSB 3VNBA 5AOVA 1RQ2A 4OK3A 4JSRA 4G4JA 3DAHA 2XWBF 4EX6A 3PEFA 3A58B 1O57A 3KBOA 2YZNA 3IUBA 4OB7A 3BJEA 1YCGA 4IJ6A 3FBWA 1MG0A 4FDTA 4YJGA 5DGTA 3ZLTA 3QKSA 3AEQA 3SXJA 1U9JA 3IQWA 3VVCA 1XEWX 2HDHA 3FSGD 5CM2Z 4BZXA 3QUBA 1PHPA 4HLCA 1FNCA 2Q9CA 4OOEA 1NKTA 4R8RA 3ICPA 3VR4H 2JKYA 5C5CA 2VVTA 3WLKX 2V45A 2GLTA 3EIHA 5FWXA 2QYHA 3P19A 4MKGA 1ZQ1A 3HZOA 3MCWA 4NYIQ 2ZUTA 3KPUA 5K45A 2WJHA 1ZL0A 2RIRA 1MNQA 3AR8A 3OD5A 4I3HA 1U8XX 3LVRE 1J70A 5ECDA 4G5SA 2BR5A 5CYGA 221PA 3M34A 3OCWA 3PUHA 3DKKA 3GN2A 1R3UA 3EXFA 1HDRA 1Q19A 3H13A 4TLBA 1DCTA 4QD3A 4HVAA 1FRVA 2JK1A 2P6OA 2GD1O 2WD7A 3AOEC 3QLJA 3LY7A 5FHQA 2OV2A 3TW8A 4TROA 1EFLA 4MV8A 5JRZA 4PQFA 3GLIE 3GG2A 2H4FA 3H86A 4K8RB 1U8ZA 3BTVA 3HVUA 5IT0A 5KB3A 4A8JC 1Z45A 4YRTA 1K8RA 5IKEA 1PSWA 2QLLA 4JGBA 2ZBVA 6LDHA 2OXTA 5CNIA 4QNRA 1KVQA 1GP2A 1Z6PA 3NWBA 1JEQB 3SSMA 2OBXA 4F9FA 3RYIA 3TD9A 4MMYB 3O5AA 3W4KA 3HDHA 1UFRA 1ODSA 2IY8A 2PMFA 4L9RA 4O4LA 3LA8A 3BL6A 1U3GA 4HBGA 1ABEA 1D2GA 2G8LA 1R0CA 1HE4A 4I7EA 3T3OA 5EJEA 2YL2A 1W94A 4F3YA 4UAVA 4I4IA 2FK7A 1UR5A 3LDAA 4NPHA 5LXTA 4CEIA 4RE6A 1W85B 1ZA2A 2WFAA 3U7HB 2QROA 3QTBA 3O4RA 4ZGWA 1C1XB 4RQBA 3KTOA 1WD7A 5A7GA 4BO3A 1VA4A 3JWJA 4N3BA 4ARZB 3UXMA 4X7PA 4RIEA 5K3FB 2Q2QA 5T7BA 4PZDA 4ND6A 1DIHA 4A36A 4K6OA 2RSLA 4QPDA 3WR5A 1GV0A 1SEPA 3M5PA 3V4LA 5J43A 3NV9A 2YS7A 4MAFA 4GYJA 1V1JA 3CR8A 3K2BA 1B43A 1E2UA 3LCRA 4HGNA 3TKAA 2ZIUB 1YBHA 3OOYA 4WEOA 4HDQB 4F4CA 3WGJA 1ZG3A 2AF4C 2MIIA 1XZMA 3JZAA 1WULS 2BFCB 2O0HA 3L7DA 3SK0A 1VJTA 1T0PA 3RTGA 4YJFB 4QTZA 1HEUA 1RPTA 2AD1A 2PMDA 2QVLA 1RXSA 4WXMA 1UQUA 3UENA 1MW9X 1KPIA 1KR2A 3E7WA 4IGFA 4C7OA 4PGGA 3T5AA 1SZPA 3TXYA 3CHYA 4CKBB 4YAKA 5JECA 3TCKA 5HX7A 4MVJP 1EJ6A 1W1UA 2O6LA 1I9GA 3IA7A 4CEHA 4J16C 3BTSA 4G0OA 4BMCA 3GFTA 2FGKA 1VJRA 5GVRA 3VPXA 3ASVA 1MABB 1DQPA 3TJQA 1RYDA 2O0LA 3PKIA 5IU6A 1GLVA 3H1AA 2ZRBA 3H1BA 4XM2A 3SVTA 7REQA 4HWTA 1E9CA 1A8SA 4CIVA 1EQUA 4KK3A 4Q15A 4BTVA 2QPAA 4UVGA 4Y9SA 1M2GA 3V2UA 3OZWA 3H2BA 2C8VA 3MTQA 1WS6A 1YMUA 3FPGA 3LY9A 4ZO4A 4HVCA 4GKAA 2YFYA 3HCEA 1QO0D 1CTQA 1RCFA 2KE5A 4JR2A 1OY1A 2FMHA 2W4QA 1WOYA 3FFBA 3CF4G 3CVJA 5AKKA 5K1ZA 1PQYA 1JFFA 4KU4A 3WMGA 3HCOA 5H59A 1HPLA 1U9YA 5SZJA 2JFXA 4TWJA 4RM3A 3KUXA 4ZHQB 3T1YB 4AQDA 2YXLA 2QL5A 5CR9A 4LI3X 1KI2A 4ZMRA 2IX3A 2X14A 4FWTA 1CR4A 2MYNA 3R5DA 2BFBA 3ML1A 5HEKA 3TLKA 5HTOA 2WLTA 2C5HA 3RUPA 3UVEA 1XN1A 2HT1A 3NVMB 3DKPA 1U7XA 4PRLA 3DE6X 2C9DA 2C1EA 4HEJA 2F3PA 1M1YA 1N2BA 2P4UA 4QOGA 1EZZA 3H8SA 1GRCA 1R8YA 2JC3A 1Z63A 2Y05A 4QBIA 1DCMA 1AUPA 3PPVA 5DH9A 2HIAA 2RK4A 3V4SA 2J0UA 4TMYA 1RWPA 3GEHA 2PGXA 3PXXA 3QTLA 1R4NA 2OCDA 4V0QA 2XAAA 3K0CC 4YJHA 3ROTA 1HDOA 1SZJG 4F2GA 5C1PA 2Y1LA 4L78A 1O54A 2I33A 3QLEA 5E7JA 4CVNA 1HTBA 1GCAA 1BKSB 1FLNA 1E7WA 1QP8A 1H2EA 1PR0A 1Z35A 3BJRA 2A67A 2H2WA 4M0DA 5FR1A 4D9EA 3DFFA 3L8YA 1UZAA 5K0FA 1RKXA 2AWNA 3QWPA 4MLPA 1C81A 1OV6A 1G6HA 4RZSA 2RH4A 4RNCA 1HEVA 3I9LA 3TNDA 5D01A 3UJDA 2X4GA 2EKDA 3ZE6A 3GEIA 3VJMA 4A8TA 4FFRA 5HUJA 2EC5A 2QXYA 1XF9A 2VPTA 3R5SA 5HUQA 1U1IA 1OMTA 5KSWB 2C2OA 2HSDA 4DCTA 2ZETA 4IDAA 3MMZA 1Q1GA 4NOKA 4EEZA 5MHTA 2I03A 3L0ZA 4GQIA 2G36A 2FRVA 1L7DA 2YZ7A 4Y6RA 2J0EA 2Q28A 3QVOA 1BJKA 2E49A 3D43A 4RHUA 1V3QE 3W9SA 4B6EA 1GTG1 5IXSA 4B3DA 1H42A 2ZRPA 3RV4A 3OKPA 3GLIB 3BGSA 2NYUA 4BATA 5J3JA 2LV8A 3V7WA 2AG6A 3F90A 4MWTA 1L8OA 5BORA 4PLZA 1JG4A 4QDOA 4OY3A 1EEHA 3I0NA 1NQXA 4NV3A 2GPAA 3ZQKA 2AEMA 2J0QA 2K87A 2CVPA 5EL0A 4KTTE 4W5WA 2Y71A 2C4WA 2FMUA 3W78A 1EVJA 2AK2A 1KDOA 1D4FA 2IEAA 3X0DA 1X0VA 1PFKA 2P3SA 3MUOA 4MR9A 5DM0A 4D9KA 1W87A 3DNPA 4H9GA 3B5IA 5DSXA 1J23A 1VKZA 3MWEB 3RVJA 2N0SA 2WVGA 4P6VF 4XCQA 1PG2A 3N2ZB 4C6TA 5CFQA 4LV5B 2WUWE 3F8SA 4WH0A 1OXBB 2B30A 1U0NA 3E9EA 3UK0A 2IYUA 5AVWA 2GEKA 4LFCB 2GBFA 1OXUA 3L7LA 3SYTA 4BKUA 5IM4A 3QFFA 2O6HA 5B1DA 4GQAA 2H0QA 4REQA 2FJPA 3DFMA 2A58A 2K7ZA 3Q8KA 2R1VA 3NTLA 4TVOA 3MPUA 1ECCA 5AXDA 1FXWA 1E4EA 3HTXA 1E60A 2K2WA 2C4NA 3AOGA 2P91A 3GRKA 3X1XA 4LNHA 1QDLB 5KDOA 4UPDA 3AXTA 2GVIA 2Z3VA 3L1JA 4WDQA 1WHSB 3MJSA 3OFKA 4Q3CA 2XZPA 2VXOA 4FFBB 3RSHA 1XAGA 5D87A 5E1OA 5C34B 5H4GA 2QMHA 3E48A 3FOWA 2AG0A 5B36A 3FTQA 3K92A 2CDCA 5FEMA 3JQFC 3GAZA 4GM1A 4P7JA 3H0CA 4WFJA 2E48A 1LLDA 4AMBA 4F1KA 2BEKA 1M8FA 4KR7A 3QU2A 5BWOA 4LHYA 2WU0A 4X44A 3SS7X 1OILA 3PWKA 3TSYA 2HHAA 3CN7A 4DG8A 3AEZA 3RHSA 2WHPA 1GARA 1NAIA 1RU3A 3LC7O 1KKLA 4CUZA 1U8CB 2ANBA 4D9GA 3OCXA 3A1SA 1NSYA 4WVFA 2RIJA 2HIHA 4DRXA 3ROQA 4BZWA 4L8FA 4RQUA 3S99A 1YZGA 2D59A 4JV5B 4N48A 2Q3MA 1P74A 1SHJA 3OSUA 4J0FA 2VJAA 1NZJA 3F97A 3KT0A 1RYNA 4JUFA 1QIFA 3W8RA 1N2XA 2QQEA 4KE6A 3MINB 1NONA 3LVBA 1TA4A 4DJAA 1FFSA 1DS6A 4ZU1X 2X6QA 5FUVA 1BGVA 4B33A 4GLLA 3GRZA 2AFHA 1Q0UA 1TYAE 3C41J 3KP1A 3Q7PA 5KAMA 4I5EA 1MO3A 3HC7A 4HMOA 4KYVA 4CMAA 4DY4A 2F62A 2ZUUA 2C5GA 1A8QA 2PLAA 4EY7A 3LW8A 4I9FA 5EZSA 3BC1A 5ARCA 5I7HA 1NBEA 1W4BA 3CEJA 4ZT6A 5EWJB 3TOVA 1X2EA 4KOEC 4DNPA 1E2KA 2AI3A 1V5GA 2C5EA 2HMSA 3NQ41 4W9NC 4XYLA 2XV1A 2PYZA 1AQJA 2G6TA 5CG2A 4TYNA 1M2JA 4K9OA 4MVJM 3TQHA 1QZTA 2O3TA 3RVLA 5DTMA 5IJZA 2DM6A 1HWYA 3LM8A 1FP1D 3TLAA 5JS7A 3U3XA 3DSRA 5JMOA 1E77A 2XVMA 3PE3A 5C4MA 2ZS7A 3HR7A 4QYMA 4BYGA 2Y0DA 1Z0ZA 4C7BA 1CIVA 4W4TA 1I36A 5I9MA 2PKQO 3AXSA 3SEFA 1OHHA 1SBYA 4KAJA 4ND2A 1EZ4A 3PJDA 1PW7A 2VNIA 1R8XA 2R6AA 1T1RA 4JC5A 5TMEA 5DGXA 1FK8A 2MSNA 2VDNB 3H9JA 4PINA 3AKYA 2IYXA 2ZZNA 2X0EA 4JYBA 5HS4A 2OWEA 1F38A 3ZWDA 1NN5A 2GEFA 3AONB 4D46A 5LNK1 1CDOA 2XMRA 3FZYA 4JLVA 2Z5FA 3I73A 3GNQA 3HN7A 5HI7A 2FHSA 1OWOA 1U5AA 3RLFA 1P9LA 2GPYA 1X7YB 3ZXIA 4H3HB 1T9HA 3BXGA 2XGOA 3JD1A 4NS4A 1YIAA 3GLKA 2ILTA 3GZJA 4RD4A 4LZAA 4TTJA 4YASA 3L6CA 1Z83A 3HH8A 2VWPA 4UPVA 1SA0B 1G4UR 3ETJA 4KXQA 3G3EA 4QPNA 3SX2A 1RWNA 1P8AA 3CPEA 3U0VA 2AC7A 1QIDA 2IK8A 1VPLA 2LR0A 5B7GA 1R6AA 2GLUA 4LCJA 1PYOA 1X6VA 1X8JA 1DC4A 2BC9A 2VCHA 2XUAA 3K31A 4QXQA 5IYZF 5C3UA 3RBXA 1PG5A 3M0EA 5JXWA 5JJLA 1BFDA 1ONPA 1RPAA 2O8CA 4IDOA 1BA2A 1W88A 4DADA 2O54A 4FFMA 1T1SA 3GELA 2GZDA 3HADA 2O7RA 4AG3A 4DRXB 3D2CA 3B6IA 4P84A 2RG1A 4BE9A 3HL4A 1YVDA 3IMEA 4XVHA 1O97C 1R50A 2KW5A 4FXOA 1KJIA 5HCUA 4RTSA 2YRWA 4OG2A 2JRCA 5CH8A 3WK9A 4L4UA 1FW6A 3MGCA 3IDFA 2IYPA 3M4YA 3WGOA 1M8GA 3EZYA 3HCWA 3IPLA 3JVVA 3RVKA 2JFFA 3DLCA 4S2EA 3MPOA 4XGQA 3CURA 3MBOA 5A4JA 3QYFA 1KVUA 1WMFA 4RYLA 4JY7A 4KSCA 2NYRA 5AKLA 2FSVC 2YJ6A 1J00A 4BWYA 5CG1A 2XQJA 4Z4QA 3THYB 1LY1A 2V7EA 3AR7A 2RBGA 3CRQA 5TF4A 5EE0A 4H27A 5LMNB 2D3TA 3I1IA 1E9VA 3V8EA 4RJTA 2R8YA 1I4TD 3LI2A 3ZYZA 3BEDA 3VBEA 1U5KA 2O4CA 3A11A 2H1CA 3L3BA 5HDQA 3RKRA 1XCOA 1NW5A 2JZCA 5LZ2A 3AJAA 3VC3A 3HEBA 4FDMA 5E6UA 1P9ZA 1IAQA 2E4XA 1P1CA 3ZV5A 1QQAA 1JLSA 2PXXA 4NE2A 3W3AD 2EXXA 1FSGA 3DJFA 2ZYIA 3V4VB 2QP4A 1BW9B 2OZKA 5DBOA 4ZDIA 2WHQA 4XWTA 4Z2YA 3D8HA 3GIDA 3ZDAA 2V3CC 4EI2A 4TZ0A 3BAFA 3RU9A 4MYRA 4IFIA 2KCXA 3K73O 1KR5A 3L7YA 5IVHA 2NO4A 1Z5NA 3K6SA 5JNWA 4R5HA 1E20A 3F8TA 1EVIA 2ZANA 3BFVA 1IXYA 1QORA 1VIAA 3ICOA 4ED9A 3UQYS 1UOPA 1WW2A 2JBWA 3L1UA 2YNMA 3NM4A 3P71T 4ZEMA 1RYZA 1N33B 2XMSA 1Y37A 1EUDA 4E5YA 4EJMA 2J48A 3HI6A 5B57C 4G9EA 1G2QA 3PX7A 2HZ7A 1GDHA 2B1JA 1UXKA 3HO6A 1QH1B 4LHZA 4E4YA 1MO5A 2FKNA 3A06A 4I5FA 4OA8A 3FYHA 4M9RA 3VUEA 5JYEA 2Q8PA 4REMA 1N2ZA 3G1WA 5DN6D 2BFMA 2QUJA 3HUUA 3V4PB 1RLJA 3A2NA 2G6BA 4FT4A 4HXYA 3KZXA 3P2EA 5DNWA 3ZI0A 1DBPA 4ME6A 4CF6A 6AT1A 2OVBA 2Q3EA 1CJTC 4QOFA 4BQQA 4JT9A 1ADCA 3EARA 3ELUA 3NJRA 4HDSA 1LI5A 2GVNA 1V3UA 3DB2A 4YA6A 3W1VA 3ZV4A 1B8PA 1GTJ1 1I1HA 2ZRHA 5ARBA 4JCOA 1AKUA 1WF3A 3P9NA 3CMMA 2X5KO 1O96B 4P9NA 2HY7A 1XRSB 4IFTA 1GGHA 3VI4B 3LDGA 3FGPA 4FZ5A 5FD8A 3B82A 3BUSA 2I6FA 1TFUA 1P91A 4HS4A 1RKQA 3SM9A 3ZTTA 2RD2A 4W8OA 1UXJA 3FSGA 4RPIA 3Q0TA 1TQDA 1WB6A 1BD4A 4J76A 3PICA 4KWCA 2ICAA 1Y4ZA 1KNXA 3C8DA 3IQXA 4RFLA 5NLLA 5CDTA 2BR4A 5L51A 2B99A 2ZPUA 1D03A 3H6HA 1C9DB 4G5YA 4MV9A 3UPDA 1IBMB 2RHBA 4KN8A 3USZA 3WZLA 4CQLB 1O9BA 3B6JA 3K9QO 2G07A 2XRZA 3RR2A 1J9GA 3P0RA 4FYJA 3SYLA 4RY0A 4RLFA 3FNQA 2ZT8A 3HCAA 4R8MA 3JQAA 4HRYA 4MYUA 1YK0A 3DMHA 1VG8A 3H9UA 3NBKA 3PD0A 5FI0B 3SAJA 3CXLA 2ZYDA 1BROA 3UN1A 1Y3FE 2HLDA 4GNKA 5ESRA 1KWGA 1A2OA 4Y1RA 4DFDA 4F3KA 3HB0A 2VNAA 1AQ6A 1S8AA 4MUMA 5B30A 4MJ3A 3WRVA 3F6BX 2G04A 3L6DA 4C9BA 4X66B 3D0OA 1PTKA 5BVHA 3IEVA 1M2HA 1VRWA 2QZ4A 3E3MA 3EPPA 3LUPA 5CFOA 1UC9A 1PZMA 1H2ZA 4BEJA 1RJ9B 4XIYA 4P31A 4MR8B 3PLNA 5EWJA 3T7JA 1XYVA 1OLXB 1NJSA 2XSZD 1OIWA 4I36A 3K8OE 4XWOA 4IIJB 2O8BB 8AT1A 1LX6A 4WI1A 5DBGA 2ZKLA 2CT8A 4S1VA 4EPVA 3D2BA 3C1AA 4E31A 3FOZA 2XTZA 5T6BA 4KQ9A 4J1QA 3UT5B 4XWKA 1AXGA 1C3XA 2SHKA 4EKIA 4LV8B 5L4LA 4ZAWA 3SVLA 2CXNA 1JV2B 2BHLA 1L9KA 1H3FA 1ECGA 3K30A 4OMDA 4U2BA 1Z9BA 2FDXA 5C8VA 4PCVA 4CDMA 1YL7A 1QVWA 3UK2A 1T0IA 4MUIA 5L40A 5LB4A 3CR7A 1SGNI 4CLRA 2IYRA 4H1UA 1JBEA 2OFFA 4YJ3B 1M33A 2IYFA 2BKLA 1YMVA 2WSLA 5EQTA 2NO6A 3IBYA 2C0CA 2N47A 3GPLA 3ZZUA 5EWMB 4BXOB 2UV8A 1U3FA 2NUAB 3QXGA 5HILA 4F6CA 4OGFA 2AMYA 2JKVA 1QUFA 2Q29A 2VUIB 1LPNA 1EGVB 3L1VA 1U8EA 3HVKA 4XASA 3S6JA 4E11A 4KC0A 3DEIA 3DOHA 2ZB7A 3BX1A 1QF7A 3DGFC 3RBAA 5FJIA 2L0XA 7WGAA 3SQLA 1MH9A 2Q46A 4JEUA 4CM4B 5LMCA 2P3QA 5KTRA 4ZCQA 1TVCA 4E14A 4GSLA 4FD2A 2ZIVB 1XJ5A 3NP7A 2B92A 1LRJA 3RWOA 6NULA 1P5JA 3BK1A 3CE9A 3QNUA 3TLEA 2XOKA 2ZATA 3H8VA 1OPXA 2YIJA 4MDYA 3S70A 4BQFA 1U6JA 4R6XA 1KBEA 3ZBQA 3WTBA 3BHJA 2W6ZA 4CU5A 4HZUA 2YBDA 3GGPA 4LF4B 1T9DA 1V26A 4V0KA 3GJQA 3AI1A 3CJQA 5ALZA 4DLXA 4QGHA 2C9YA 2HI0A 2MINA 1U8FO 4PLCA 1R16A 4PLVA 1DRVA 2PPLA 4JJKA 1DXQA 4TTQA 1EFRD 1Z0UA 3ZDRA 3ZIAD 1Q57A 1O94C 3KU4A 4F1WA 3HJHA 1G4HA 4G41A 2GM4A 1R6UA 1HC7A 1QYCA 3I2IA 1KPGA 2AC4A 3N7UA 1JLMA 3O2NA 4ND8B 4RXMA 1L2TA 2VF8A 1QE3A 4UM9D 4YS6A 3ZNPA 3WO1A 1OVGA 2C2BA 3OLWA 2WABA 1SXPA 2ASVA 2GEVA 2IHUA 4LXGA 2OCGA 4HEQA 2XBLA 5AUQA 5HCNA 4HDMA 5CGQB 2NVWA 3SQNA 3G8DA 1HA3A 3N3AC 2WVJA 3JVDA 2R4QA 3CEAA 4QXMA 4GL2A 4BV2A 4C5CA 1KP9A 1TA9A 2WK1A 1R6VA 2PZ8A 2X2PA 1F3OA 2ZJYA 3RIYA 3DR3A 2UZ1B 1KFEB 4MJLA 5FR2A 3H65A 1GOTA 1PDOA 2WJVA 5LQUA 4H6VA 1JBQA 4XPZA 3O74A 2B4KA 3B52X 3IAEA 4OFBA 1PRYA 3FPSA 5AW0A 2J9ZB 5K51A 1DGQA 4R0VA 2HSZA 3UKJA 3T5MA 3UOAB 4BN0A 4BP9A 4MUFA 2Z2JA 5JCJA 3DH0A 2D1QA 1U80A 5LXTF 3VSEA 2QVCA 3OQIA 4O4IB 2OO7A 1B0ZA 3N0VA 5CFMA 5LJLA 1JXOA 2BPOA 1SY7A 2H65A 1CR6A 4R3WA 3F5QA 4G07A 3JX9A 3WY9A 4CQMB 1XTUA 2AN1A 4JHXA 7AT1A 2PGAA 4OHWA 1VPVA 5K3EA 1MNAA 2FUG1 3EA4A 1EHIA 2J85A 4TYPA 1PGOA 3V5NA 4ZZIA 1NXXA 1U3WA 3LLSA 4I3FA 1BJTA 1N13A 4TLMB 5EJFA 3TB6A 4UNIA 3PD1A 3MWYW 1ABFA 1OW3B 2VWGA 1QQ5A 1N1MA 3G68A 2EYUA 1GPYA 4FJ0A 4XIFA 4EQ6B 5K3DA 4DBLE 1U3CA 2FMKA 1T0HB 3EIWA 3HVJA 5IJXA 4ENTA 2QZPA 3PDIA 4IRMA 3U37A 4AJNA 3U6KA 5CFLA 5JI2E 4K88A 1ZGJA 2NZ2A 3A25A 2PMCA 2YASA 2WZDA 3N2GA 3Q7TA 3HZRA 4M7PA 4GOND 5JLAA 3QPVA 3QMWA 3WV4A 1GTL1 1SIBE 3Q8MA 3C4VA 4HBZA 3WIDA 4D4IA 1TIKA 1DTWB 1VJCA 1MGPA 4JIMA 4CM6A 4A2QA 3KZCA 1LH0A 1B76A 5FWNA 2AOVA 2IS1A 1JXAA 3DCYA 1SXQA 1RQGA 1Y34E 4JEHA 3T4UA 4M1ZA 3DVAA 4YRRA 1N6IA 3OU6A 4D5EA 1ZMTA 1E5QA 2V97A 1E1LA 1XZBA 1XBTA 2WG0A 4UULA 1GGMA 2P67A 5K2OA 1HYBA 3WTCA 1KYXA 2NVUB 5JBQA 2GHTA 3PF9A 4OSPA 4CF3A 4RIFA 4X7BA 3LZDA 4NF2A 1DUVG 3M49A 4XFDA 1P7YA 3NBAA 3ZWQA 2ZTUA 3K0CA 2Q5CA 4X20A 4E51A 1SC9A 2B5WA 5FV4A 1Z0FA 1NV8A 2UUCB 3GRPA 1Z12A 2C2ZA 4OUDB 4EUFA 2IUUA 2XEXA 1QP7A 4MGHA 1OYOA 2VDKB 4EJSB 5F4ZA 4TV9F 5BWNA 5FX2A 1ND5A 1YK1A 4HRAA 1QG2A 4K9QA 5F35A 4ZI5A 4E88A 5G41A 3PQEA 3W7AA 1R8SA 1UAGA 1L1EA 4HX5A 1K66A 3V2IA 3QKRB 2PUBA 2LEOA 3DBRA 3ZXSA 3GRYA 1IEWA 2AT1A 5A71A 1QTNA 3S3TA 2WWYA 4LS3A 1JR2A 1Y82A 4NYIR 3VKGA 2EEPA 2R9VA 3R3SA 1UKVY 3TTSA 1OOEA 5CA0A 1GA1A 4YJFA 1A2QA 3P0EA 2WJAA 1QHGA 1SA0A 3T1QA 1REQB 3T7DA 3HS3A 1M9NA 3O95A 5BUZA 5MGBA 2G82A 3H2HA 4PYMA 1X14A 1G20E 1CUBA 2IY7A 3D6AA 3VR2D 3SE0A 4L0DA 1NVVR 3NFRA 1I2CA 2PX8A 4IX1A 3IAM6 1Z2CA 4UHFA 3IPRA 4BB9A 2BGWA 1XTVA 5ARDA 5FUXA 1H94A 1N5LA 4I0WB 4B3SB 4FSDA 1LXCA 1O94D 4GVLA 4DLBA 4U2EA 1LDNA 1TA0A 3QHQA 3GRVA 3PR3A 4IF6A 3RW9A 2TECE 3QE2A 3OXGA 4MPJA 1WDLA 4O2LA 1LFDB 4YRMA 3C6XA 4IG9A 5DOVA 2QN9A 4KWTA 3KXKA 3AJRA 4YP5A 1WB5A 4A7PA 2PL9A 4KLNA 4PG6A 3HCDA 4E2XA 2DFLA 1TMKA 3C3MA 1HDXA 3UA4A 4L3VA 1CWUA 1D9ZA 2J3JA 4XX0B 3F6YA 1JILA 1WZEA 4IDNA 4WT7A 1I2MA 4BO8A 4GOKA 4FCWA 1CF4A 1IXSB 4JGIA 2FPWA 1B3RA 1PQPA 2B37A 2FP4A 4OHUA 3A4TA 1R8QA 3MT0A 3D4LA 3PNMA 5G0SA 5HR5A 2G0TA 2NNWB 1LBQA 1LJLA 2QTVA 4EARA 4FYHA 3FPFA 5CFZA 1MXHA 1BMFD 1KC1A 3M2TA 5BSHA 2F55A 2C42A 2PBFA 3E35A 3E8XA 1KJWA 3OCZA 2N1BA 4M53A 3DDSA 3RS8A 5BN4A 3PXCX 1GG9A 3F7TA 1ZEMA 2ZRCA 1KBFA 5CDYA 4RV4A 4PNEA 4CM4A 2QQ0A 3I58A 3KPVA 4K0KB 4AJHA 3U7GA 4Z1MA 4N3AA 4A6PA 3DFIA 3SXPA 5CCBA 4DVJA 3X1KA 1JFRA 2GFIA 4MITA 4COKA 1HNZB 4MHTA 1M7BA 4PLTA 3VNSA 5AVRA 1THTA 3SHOA 3UV7A 3DV0A 2RIPA 4WECA 3FOEC 2JH8A 1WAMA 2EP7A 2FUNB 4XB6B 5IKOA 3T95A 3EC7A 4NSNA 3P97A 3PC7A 1HDYA 4C89A 5B3JC 2PJZA 1AT1A 4AS3A 4YLYA 1E1QA 1UAYA 1GZUA 4GR5A 4P22A 1M54A 2R97A 4RFVA 5TPWA 5JLJA 4D0SA 3LX8A 1JDNA 1UDAA 2X3FA 4IVNA 1AGPA 4XM0A 1THGA 1NVEA 3ED1A 3GLSA 1KMHB 3LXMA 5DWVA 1E2FA 1MC5A 1E98A 2A86A 4M0FA 4OBWA 4P54A 1EVLA 1K7CA 1I1NA 5AJTA 1QGZA 3N2NA 4G9BA 5ALYA 4B17A 2P77A 4MHOA 1SG9A 4HN9A 3S2GA 1X7ZB 2AUTA 1OGJA 2UZAA 4PZ9A 5AK3A 1JFVA 5LC1A 4Q9AA 4CI0B 2OFXA 1SBTA 4G67A 4QDUA 2W43A 2F3SA 1ZN2A 3ZE0B 3A31A 5T4BA 2Y66A 2GVDC 1V7PC 5DT2A 3AF0A 1C2YA 1WXXA 3IXQA 1GPDG 1WGTA 1T3LA 2AK3A 3K0SA 1G8AA 2FPIB 2IHYA 3PGKA 1OXMA 1P1HA 3JD0A 3IJPA 3KLNA 5LZ9A 1GM5A 4YCSA 4ZV9A 3ITNA 4D2IA 1R7RA 4HAXA 4EECA 2HUNA 3K70C 3L4BC 2PRYA 2VWHA 4H1HA 3UJNA 5E9WA 4G81A 3RJZA 2VNJA 2IIQA 1SUCA 2WGCA 2DBRA 2XUKA 3MWLA 4MUHA 1RHMA 4C6TB 4CMCA 3NKFA 1G1AA 4KBGA 3TM5A 3PEYA 1ZJYA 3S2ZA 2GZ1A 4YJ3F 1LPAB 4Y9RA 3H9BA 2YXEA 3BRQA 4NARA 1XK6A 4HQFA 5F12A 5A0FA 5AYVA 2QM8A 2PSHA 4PO9A 4DM4A 1LUAA 3W79A 3O7WA 1N0VC 4EF6A 2GEUA 3T5PA 1BS2A 4PZCA 4B09A 3MJRA 3T6KA 2AJLI 3VAAA 1U9ZA 3EZ6A 4DW8A 2EZ8A 4BNTA 4G84A 3L4KA 2Q5EA 4GX1A 3IIJA 4EPYA 3NHLA 2H4ZA 5C32A 4QO7A 3B1VA 1JHVA 4QUIA 1V16B 2MU1A 1FY7A 4FZVA 3NGLA 3I5YA 3FHTA 5KZMB 5K03A 3ETLA 3HM2A 4YUWA 2QU8A 1PFQA 4XFKA 3K8YA 4J0EA 5L4NA 3B6ZA 3F98A 3LWDA 1FYWA 4UDXX 4TT8A 4TMFA 4C7KA 3CEPB 1CP3A 2WJGA 4CL8A 1E6CA 4EHDA 1UMDA 3DDHA 1QKJA 1HBJA 1K63A 2JFHA 2PRKA 1YAJA 2R00C 3N8IA 3RABA 2XMPA 5C35A 1J06A 3NBFA 1NXWA 5DBHX 4DQUA 3G1TA 5E7QA 1Q95A 4BJ3A 4QFBA 3WP0A 4C4AA 2MTBA 1JDUA 2N9UA 4CJXA 4YMGA 2DQSA 1L7QA 2G4VA 1JLKA 1U2TA 1ZM2A 4PYQA 1F2TA 1NV9A 1NX6A 5BNIA 5EKSA 2FFRA 4Q1VA 5LU9A 4DMRA 2JAHA 4DA9A 4EUSA 1CERA 3TVTA 1MPTA 4UARA 3EW9A 3R7BA 3I32A 1JJBA 1G4AE 3O90A 2ODPA 3T8YA 1D5WA 2A1TR 1EBBA 2CFRA 2XUQA 2QAJA 4HXFB 3H0KA 1V2GA 1J5EB 4IOLA 3GYBA 4HPWA 4ZYXA 5KOIA 2WDZA 1WVIA 3G0CA 4M7OA 3ZDCA 3WNCA 1E4EB 4B8WA 2D1SA 2I4IA 1GYQA 1EUCB 1U1EA 1IG3A 1NVUQ 1ZX1A 1FMTA 3KTDA 3I1YA 4NNOA 3E18A 4EBFA 1T5HX 1Z75A 1II9A 4O4IA 1BE6A 4OCZA 4QIHA 3SCZA 3V48A 2OO5C 2X5XA 4QICA 1BCRB 1UFKA 3KX2A 3WP1B 1CHNA 1XA0A 1PBNA 3KFXA 4EYQA 1IHUA 3IUQA 1Z5ZA 3AFIA 3DL2A 3JQPA 1SCBA 1EBFA 4MEBA 2GXSA 3SXUB 4IBOA 4ZN6A 2CWHA 1Z36A 2LRHA 1RQLA 4PS0A 4WZ6A 4HQRA 5GOTA 2Y77A 4R01A 4B7ZA 5KWJA 4IIUA 1QTRA 3SOZA 1B1CA 4AJKA 3TAXA 3N74A 4PONA 3CISA 1P1FA 5AK5A 4G1BA 4QYTA 2VA9A 3QVSA 2DFPA 5FQOA 3P5BA 3VKUA 3OO1A 5F2KA 2P41A 4K9NA 4M1MA 2OXCA 2ZDQA 1ST3A 2GD2A 2P27A 2XJ9A 1U7UA 3BWVA 4IDFA 4ER0A 3TUZC 1XE3A 4EW6A 3VPHA 1WVGA 4F12A 3D59A 1VCOA 4QYIA 5AM4A 4OHYA 3K1TA 3DYIA 3EEBA 3NR2A 2PN1A 3FM9A 4N9QA 4MVJE 4P3KA 4X90A 4CG0A 4E1BA 4IS3A 1GGFA 4DIDA 1VLHA 3CVWA 4N47A 1P9WA 1YRQA 2OUKA 2DQYA 3I8OA 4Q21A 5C2JB 1GNQA 1H8HA 1HE3A 1Y5MA 2QRUA 3JR7A 4Z0TA 4P0QB 2A94A 4MQMA 4BMXA 4B6QA 3G6KA 2A9OA 3UIEA 1F51E 3HCFA 4MUJA 1JG6A 4OB6A 2AUMA 4HLUC 3IXMA 4FKDA 5IKXA 1R64A 3J81k 1IPEA 4W1QA 2VDJA 5ALRA 1PUJA 3Q8LA 1I14A 2WA1A 1FDIA 3F71A 5EPEA 5FPPA 1GPKA 1CQZA 3CPJB 4PPNA 2H18A 3ZU5A 3DBVO 3I9V1 3KVVA 3UUGA 2J07A 3QVKA 2L82A 3C97A 3OI7A 5ADVA 1YL5A 2KB0A 4K9RA 1G1MA 1N1GA 3R23A 4FMCB 4H0CA 4M1TA 5JS2A 1SGDI 1Q7BA 3TAHA 1DIBA 2OBNA 4BVEA 3VSCA 5IBRA 3NBQA 2P4HX 3NNNA 3OIVA 1CZKA 2P9TA 3TW8B 2QQGA 3JQ6A 1RADA 4BNIA 5ALQA 5BSEA 4IUYA 2NQ2C 4JMPA 1E2BA 5EP1A 2D5LA 5AXCA 2G72A 4GYYA 4CHTA 3RUIA 5JVDB 5CA0F 2HHHB 3PC8A 3X1WA 3QX3A 1WHTA 1XTSA 3K15A 1AC5A 4RH3A 1Z7EA 1OBCA 1JFFB 1SQ5A 4IFBA 5AD1A 5HXAA 5JVDA 3PI6A 4MI6A 5PGMA 4D8UA 2IVFA 3LX5A 3RREA 3AQ4A 3OZEA 1Q14A 1U9IC 1VE3A 2XMDA 3GLUA 2UKDA 2PX4A 3G9TA 1JAZA 2QDKA 4N5MA 2QRVA 2MYPA 4N8DA 1UBNA 5DCLA 2O19A 2VPIA 3IBSA 4NU5A 1M8KA 3L6BA 2VH1A 4B5LA 4HWSA 3Q0IA 4MCAA 1T9AA 4OPMA 4UDOA 3DP9A 2O3QA 4ZANA 5FA5A 1MAHA 3K1AB 3E0QA 4JVLA 3EAFA 2VJQA 4L8GA 3IR6A 5DZSA 2IYQA 4LYGA 4HXGA 1PUIA 2GOYA 4YK7A 4ZOBA 4DLVA 5KTKA 5CT6A 2P7IA 3I64A 1XVTA 3B1KA 2PQMA 1EYZA 3A9UA 2LBPA 3ZDEA 4HGRA 5DYGA 3BD6A 3FSRA 2W0SA 3CLUC 3T1NA 1UIMA 3HRKA 2EIXA 1IZ8A 2AKAB 2FV8A 2YWGA 4WEQA 4RH0A 3UV6A 3BIXA 4UATA 1HETA 3GJZA 3BXEA 1PV4A 4IHKA 1V3VA 2IPOA 1DKOA 1XV5A 4OFXA 4OXYA 4Q3BA 2H1VA 4UTVA 2ZJ6A 4V1CB 5JQWA 3AFOA 4C5AA 2EKPA 1FLDA 2D0OB 2ZPAA 3GZTB 3QE0A