2ORWA

Thermotoga maritima thymidine kinase 1 like enzyme in complex with tp4a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
171
Chain Sequence
b'SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKHSTMIVSGVEAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEIDVGGQEKYIAVCRDCYNTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidine kinase
publication title Binding of ATP to TK1-like Enzymes Is Associated with a Conformational Change in the Quaternary Structure.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 55
structure length 171
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2orwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2orwA01
2YOFA 3AV0B 3A6PC 4MRRA 4TT3D 4AI6A 1E2MA 1S8FA 2QAGC 4KJZA 3ZIAA 4DDWA 2YC4C 1OFTA 4NYIR 2A2ZA 2BKEA 4CVNA 2PJRA 2BCGY 3QKRA 4P4TA 1TQDA 2P0EA 3TLXA 4QKQA 1E69A 1SHZA 3GLIA 2Y8EA 3FHTA 3K09A 1E9EA 1XB2A 1NSFA 3A4MA 1E32A 2DWOA 4WZ6A 1YR9A 4AC9A 2R6AA 1G7RA 2Z6VA 5BQ5A 3B1XA 2IYWA 4GPTA 4KVGA 1IJFA 5LB4A 1N0VC 1II8B 4TL6A 2DFLA 3I61A 4TMZA 1W47A 3BAFA 1XX6A 5TARA 1YJ5A 3LBNA 2OSBA 1QHXA 1T8UA 3OEHA 4I81A 1GUAA 4AK9A 4TZ0A 4UKDA 3HYRA 2GJ8A 4UXHA 5BN3A 2JJ1A 3WMFA 1R4AA 4DLUA 4HAYA 2IS6A 4CF7A 2QM7A 4QGAA 4W5JA 2KB0A 4URVR 5AWFC 1ZMXA 3BH7A 4NH0A 2V54A 2GJ9A 2P2LA 3PENA 4FKDA 2C98A 2FG5A 2D2EA 2PX3A 2ZRNA 1KNXA 1MO6A 4TL9A 1NLYA 5A4JA 4XIGS 2QG6A 1MABB 1KO7A 2FX3A 3QKUA 3VTKA 4BGDA 1XJCA 2D4HA 1KOFA 5FTNA 1QHYA 2H16A 3ZH9B 1DG1G 3CPEA 5J5CA 4EJSC 2PZEA 5L3RA 5HPYB 1Q3HA 2QNRA 2J7KA 1T5IA 3NXSA 1IAQA 4K8OA 3IBYA 2UZIR 4IKEA 1XZPA 5AJYA 4H9GA 4NKRA 2IUSA 3SJBA 2ZRLA 5C1BA 4W5HA 2CL6X 1G7SA 3OIUA 3EA0A 2IL1A 5FPYA 1AM4D 2YOHA 1NBME 2ZU0C 3EZ7A 5CYOA 5FOSA 1WRBA 3AGPA 3KFXA 4IOKA 1YZTA 1ELOA 4AYWA 3ASZA 3BB3A 1JR3E 4HAZA 5G53C 1PLJA 4WXRA 4MRVA 2QSZA 5GADl 4TLAA 3EXAA 1VCNA 2O0JA 3QF4B 3JZAA 5FI0B 1M8PA 1XXHA 2ODWA 2ZROA 3A37A 1W48A 3ONWA 2QAGB 3CX7A 4US1R 1R8SA 4JSTA 5CM9C 1QHHA 4B6EA 5FR2A 5CM8B 2B21A 1N6PA 3BJIC 3EZ9A 4HDQB 4WA7A 2RKOA 1CBUA 4UXIA 3RSOA 2CNWA 4C0QC 3N2IA 4M1MA 2J9RA 1N6NA 1UJ2A 2HT6A 1M7GA 4MH0R 5BXQC 1VIAA 3NDBB 4Q4AA 5JRZA 4MITA 3TE6A 5KDOA 4Q5IA 4ZCIA 4IRUB 1W4AA 4Q7LA 2CL0X 2QBYA 5CITA 2ERYA 3EG5A 4MQBA 4WZAE 1LF0A 2A5FA 4TMWA 1KKLA 2I1QA 3B82A 3P26A 1WBBA 721PA 1OXTA 3EPHA 3M4YA 1X1SA 2CNWD 4EPTA 1ZM7A 1VDZA 1NNEA 3D7MA 4OHWA 5FUVA 3AP3A 4IFEA 5JI2E 1WF3A 4LX0A 1KK2A 4C0HA 2QRZA 5JLJA 2BBWA 4FWTA 2CMKA 3TNFA 2JLYA 3GCGA 3GQBA 3QSYA 1F5NA 2P5SA 1GTVA 4GMXA 2CLSA 1S0UA 3ZJYA 1FTNA 1D9ZA 1GL7A 3J81k 4A15A 2ZQ5A 4H1UA 1KO5A 2WKRA 3EAQA 1ZP6A 5JBQA 3ICEA 1Q20A 1RJ9A 4PO1A 4ERNA 4GSYA 4UNPA 1RW4A 3TR5A 2DY1A 3CNLA 3MG9A 1T0HB 1S1MA 3GJ6A 3A36A 4GI7A 1GNQA 2CE2X 5FFMA 4AYTA 1L2TA 4ZO4A 2WWYA 1B0UA 2IYRA 4BFZA 1U8YA 5J4YA 3B85A 1KDOA 1XA6A 3JZMA 4WVFA 2OAQ1 1G6HA 1OIVA 1GFIA 3LBHA 1XTSA 1OHHA 3VKHA 5K8LA 3K09C 4HB4A 1E98A 4XVRA 1G1MA 3C15C 3NH9A 4AKIA 4ZIRB 3W6PA 4RVCA 1ZD8A 4CEIB 1Q44A 1ZUHA 1E9CA 1NIJA 4IHQA 3TW4A 3H86A 5L3VA 2OAP1 2X8AA 4Q1BA 4QGGA 1GG2A 4X8MA 5FUYA 3QI2A 4IEIA 4DLYA 2IX3A 5DYIA 3LW7A 4AIIA 1QDEA 3TH5A 5GJBA 1CF4A 5AK0A 4QBFA 4Q9LA 1OE0A 4FMCB 4M1OA 4IVQA 1OHHD 1YVDA 2D3WA 2ZAOA 2VO1A 2ZITA 3EWAA 3MGCA 1TQ4A 2J41A 4XVQA 5KSOA 3R7WB 2R9VA 4MKGA 1KSHA 2PJZA 1XTKA 1BO6A 1LS1A 4KFTA 5KYKA 3L82B 3Q7QA 2OFXA 2YC2C 2BMFA 2IUTA 1J70A 2XB4A 2WTUA 2IYZA 5G41A 4RCYA 2SHKA 4JL5A 1N6IA 3MUFA 1YQTA 4OQFA 3DVLA 2JLZA 4C2TA 1ZUNB 1E3MA 4LCBA 2J46A 1S2MA 1QG2A 1UPTA 3U44A 1DARA 1DS6A 3CRMA 2BM0A 5ANRB 1CR2A 2O8BB 2RB4A 3CZQA 3BK7A 4TN1A 2NO1A 5F9FA 1ETUA 1GM5A 1E96A 2YVUA 5HZKA 4D6PA 2WMNB 1EXMA 3EIHA 4FW9A 4TZ6A 1X8JA 4KYUA 3DMDA 3MAAC 3AF3A 1Z2AA 1ZUIA 5EUQB 2GJAA 4TTQA 4CEJB 4Q1CA 1XD8A 2HJVA 3FVQA 3VX3A 2ZIAA 1KO1A 3PUZA 3A8TA 5DYGA 4NYMQ 3U5ZB 4RY2A 1D2MA 1TUIA 1SXJD 1P61B 4I99A 3OFNA 1LW7A 3EZ6A 2KWIA 4TYQA 2AXNA 2ZREA 4BUJA 4FN5A 1XU4A 1NF3A 4NHOA 4JLMA 4C7OB 1IY1A 4A9AA 2VEDA 2F1JA 5EXPA 2O8FA 5F98A 1RE0A 3B9QA 3B6EA 2HJGA 521PA 4S35A 2W0SA 4KITB 4DEYA 3QE0A 3V00A 1Z0JA 4LDJA 4XTRA 3OFND 3HYTA 1GKIA 2XJ4A 3EIEA 5L3QA 4RKFA 3CWQA 3FB4A 4AG6A 1XMJA 2W83A 3GLGA 1KYIA 1NVXQ 3I62A 2QTHA 1D9XA 2ZANA 1KAGA 5J4HA 1Z6XA 1H8HA 2ODEA 2FNAA 3QKSA 2O8EA 4TYNA 1VMAA 3CUEF 3TJZA 2IYXA 2VSFA 3I73A 4B3CA 4B73A 3VNVA 3THYB 3AKCA 1LB1B 3CF2A 3DO6A 3THXB 4BLRA 2EFGA 3TGPA 1G3RA 2KJQA 1VPLA 3L8YA 4TMVA 6Q21A 4M22A 4G01B 3AQ4A 4DSUA 2WZQA 4TLEA 3AKDA 3PIRA 4BZQA 3SYLA 1SZPA 1HE1C 1S3SA 1R5NA 2GVIA 1EGAA 2F43B 2R6FA 1FFHA 4D81A 3QUSA 2XOKA 5DIFA 3K70D 2EFEB 5DO9A 4I1VA 1N6KA 1OSNA 1XEWX 2WSSA 5FTMA 1H8HD 4OHYA 4JLJA 1VTKA 2X1VA 4MDEA 1KJWA 3KZ1E 1Z08A 1JALA 2FEOA 2GK6A 3GEHA 3KTAA 1ZCAA 3UFFA 3ZGXA 1AZSC 1Z5ZA 1G5PA 1JR6A 1NMZA 4XD7D 5KSYA 1AGPA 4Z1MA 5DHFA 4ZDJA 4OHVA 3C16C 4CYMA 4DLVA 3BGWA 3ADDA 4Q4HA 2CXXA 4ZPXA 3WHKA 3D6TB 3Q5DA 2B92A 4YLGA 3ZYCA 4CZ2A 3KFVA 2VSOA 2F9MA 4JLNA 1XCGB 1I4TD 2WSSD 5KNCA 4HB3A 2VL7A 2CBZA 1X3SA 2GXUA 2IYTA 3SJAA 2JLVA 4JT2A 4HLCA 1IN8A 1M2OB 1DAGA 2ZVPX 2DFNA 2YJTD 3V9PA 1DO2A 1T6NA 4FD2A 2UVQA 3FFBA 3PVSA 4FMDF 1XD2B 3MWKA 5SZIA 3RYTC 1O87A 3GFPA 2QENA 4Z1MD 1TBOA 2GNOA 4G5GA 1J90A 2O0HA 3HU1A 2B6HA 2HXYA 3P20A 3LY5A 4V0KA 3U3OA 1FUUA 1UBGA 1G291 1E4VA 1MRNA 3REFA 2QMUA 4WBSA 2EW1A 2BWJA 1RVDA 4HDCA 4PPFA 3LVRE 3B1ZA 3I4LA 4Q18A 2RGGA 3LBIA 1GL6A 2DB6A 3BOSA 5AUNB 1N6HA 1FTSA 1MH1A 2NGRA 3EARA 3QNUA 4RD4A 1E4YA 2MMCA 2PLRA 2VQSA 4OK6A 3NWJA 3BRWD 3Q8XB 4ZDWA 1SHKA 2WAYA 2QU8A 1G4UR 2CVHA 2LKCA 4DLXA 4B43A 3A1WA 4GP7A 3T1TA 1NBMA 1XTJA 3FHCB 1KK1A 1JR3A 1M1YE 1MRSA 4MRNA 2JLQA 3TBKA 5KNBA 3CPHA 2P6NA 3GLFB 1RRCA 2DFTA 1Q1QA 4A82A 1ZVQA 1Q1BA 4QHSA 3P32A 4NONA 3CB4A 4B44A 3A1UA 4Q4JB 1LTQA 2VH5R 3EA5A 3MD0A 3WNDA 1PLLA 3BE4A 1LFDB 1T3LA 1N6OA 2CLCX 3LH5A 4B3XA 5FOXA 4QFMA 1P2UA 1DAHA 4HI0E 1MR3F 2FV8A 1RFHA 2FH5B 2IXEA 4M9QA 4Q21A 4ZCLA 3ZDQA 5A5GA 3SQWA 5CLQA 1JR3D 4V0ME 3U3MA 2FPLA 1A4RA 1A2BA 4QNRA 4N3NA 1DTSA 4P4UA 4QHTA 4Q9KA 4DEXA 3P4YA 2F55A 1U99A 3KJHA 1YU9A 4MYTA 5LBIA 3DMNA 3TUZC 3CBQA 4URYR 1OIWA 1R79A 4QXAA 1Z29A 1P73A 3EWSA 2OBLA 2WWXA 1N0UA 4PO9A 4MYHA 1E2PA 3NC0C 2WOOA 1R7RA 4M0LA 3GLFE 4NCJA 4R71A 1JBKA 1Q12A 3EC2A 3T35A 5DI3B 1TAGA 2FF7A 4UNRA 2CE7A 2YKGA 2VF8A 1KK0A 2ZI7A 5JRJA 2RGBA 2IUUA 2V9PA 2B7CA 3X2SA 1GITA 3L0PA 4C4PA 4PQFA 1V5WA 5B30A 3K53A 2KBFA 2EQBA 4QJ3A 1ZNXA 2FSGA 2ZI3A 1E79D 4EDHA 3BH6A 2ZI4A 5JI3E 3VAAA 2JLXA 3I72A 2VHCA 1CJUC 1IXZA 3BB4A 3AEZA 1CR0A 4Q7KA 3UK6A 4EQ6A 4LY6A 2RGNA 3LFUA 2ROWA 3X1XA 4KFSA 1G7TA 3AVWA 1DVRA 1G8FA 1T91A 5DISB 2FNFX 2ZXUA 4NZYA 1PZNA 2ZR0A 4DWJA 1JXOA 1RKBA 1JPJA 3TMKA 4QBHA 1YZGA 5DGXA 5KSPA 4F38A 2GAAA 3CH5A 3EZ2A 4K81B 1GWNA 1SGWA 1VIYA 2BVNA 2FEMA 3NBYC 3U4QB 1FNNA 1XEWY 5JHHB 5F3WB 2ZVQX 1OYYA 1ZIPA 1QRAA 4LV8B 4ARZB 3KKOA 1T9HA 4W7SA 4JL6A 4Q47A 2AXPA 4BEBA 4A0HA 3V4RA 2GCOB 1PJRA 2YWEA 1U81A 4A2QA 2IHBA 1BS1A 3T12A 5KNDA 2GXAA 3T34A 5EZ5A 4PHFA 2LKDA 2R6GA 2NO9A 1HUQA 4M9SA 3RWOA 1US8A 2JLSA 1IN4A 2CK3A 4L8GA 3CRQA 2QSYA 1CULC 5D3QA 2HF8A 1KI3A 2H57A 1XBTA 2RHMA 5DE3A 1OFHA 2X19A 2OCPA 3U61B 3VNUA 3K0FB 1FX0B 4TWZA 3BB1A 2QPAA 4LYHA 4H1VA 2G9NA 5GVSA 3DEFA 3K1JA 1S1CA 3TUJC 1OXUA 1P4SA 2H18A 2REBA 2JLWA 1KK3A 1AZTA 4WXPA 5HKKA 4QJ4A 5JWOA 4URXR 2CK3D 1D8TA 2VIIA 3DKPA 2C9CA 2NPIA 3SJZA 2EYUA 2OHFA 1J8YF 2ZRCA 3EX7C 1YHNA 5JWRA 2DR3A 2VLIA 4I1UA 1IONA 1ZNYA 4KODA 3NKVA 3AVUA 1LY1A 1G3UA 1L4UA 3BFVA 1D2EA 1SULA 4Q1AA 2FMXA 2ZYVX 1T4GA 5JCPA 2FPMA 4LJ9A 3AVPA 1AK2A 5GJWC 4HYYA 3ZD7A 1UDXA 2P67A 2ASEA 4PAOA 2G83A 4IDHA 3T5DA 2BDTA 5HKKD 3K0AA 2ZEJA 3C5HA 1FPMA 4C0JA 2C96A 5L3SB 2BV3A 1VHTA 1FMLA 4OL0A 4AKEA 1KSFX 4CT4B 1QHNA 1NMYA 2D62A 3CO5A 1AS3A 4LHZA 2F1RA 3AVXA 4FWIB 1XTIA 3L43A 2ZS8A 2WHXA 1VYUA 4PC2A 4OQNA 1AKYA 4DVGA 1OH6A 2G0TA 3KXKA 4ZI3A 4DXAA 1E9AA 2VP5A 4HSEA 5E4FA 1GNPA 4LJ4A 4OHZA 3SU8A 4BFYA 5CDFE 3UANA 4PSKA 2AFIE 5D3MA 2QGNA 4AG5A 3WBKA 3IEUA 1E2KA 1G5TA 2GF0A 2A78A 1E1QA 3GJ8A 4JL8A 4KCGA 2C95A 1O3YA 1KI6A 3FMPB 2NZ8A 4IVPA 5EE5B 3ZVLA 1QHIA 3CR7A 4HZUB 1CJTC 1A2KC 3KJIA 5FBRB 2H7VA 2G6BA 1G17A 1W4BA 2RGDA 3RHFA 3X1ZA 4C0BA 2J5XA 2G1JA 1UKEA 2WIBA 3H84A 1II9A 3PCRB 4HATA 4BECA 5E3HA 4DCUA 3PEYA 3VFDA 1E0KA 3FKSA 2DBYA 5JFGA 2V1XA 1FMJA 3AVVA 3B1WA 1IXRC 1U0LA 1P2TA 2WWHA 1EWQA 1E2IA 1ZCBA 1E1QD 1FUKA 2GF9A 4RCZA 2HDNB 4WAUA 4XOIA 2FN4A 1N6RA 2VPPA 4CEHA 4A0FA 1ZM4A 3CX6A 3H1TA 2QP9X 2GJKA 4PC7A 1E2HA 1MOZA 2A5YB 4P4SA 4Z8XA 4DT1B 4F4IA 1RIFA 4NMMA 5K8IA 2F1IA 4HDOB 3TUIC 1Z0FA 2UZ3A 4AD8A 2BM1A 2O8DB 3I8XA 3FKSD 3VR6A 1FL9A 1U9IC 2RMKA 2RGNC 4I4LA 4DUGD 1RFLA 1NVWQ 1ESMA 3HR8A 4FIDA 1P9WA 2G88A 4ZKEA 4O2RA 1ZM2A 4B76A 4MA4A 2IA5A 3UGLA 1NN5A 2NZJA 3H0KA 1C4OA 3KKQA 2XTZA 3OEEA 4NYMR 4FMBB 4JLVA 3K0SA 2FGKA 4DB4A 4XSGA 3AVOA 4KXFB 5GVRA 2A30A 3OIWA 2CHQA 2FFAA 5HE9A 3ND8A 2IYYA 3UWKA 3GD7A 2WIAA 3K0CA 4OI4A 1DO0A 1TEXA 1JPNA 1WMSA 1TNDA 1W36B 1JECA 5TVKA 3THWB 3BWDD 2Q3FA 4DRZA 2DPXA 2FWRA 2W00A 3WNBA 1RYFA 3ZD6A 1UDWA 2A5JA 5KDDA 3W6NA 4IW3B 3PFIA 4JVNA 2QMHA 3OEED 4BPBA 1WQ1R 2PX0A 4JLBA 1UBFA 3LDAA 1D2NA 2VRWA 5DN6A 3FDIA 1KI2A 3B78A 4ITRC 1CLUA 2TMKA 4GMDA 2CHGA 1E94E 3PUXA 2OBMA 1ZNZA 3TQFA 2YWGA 2OEPA 3IHLA 1LVGA 1TPZA 2HEIA 1NJFA 3E5HA 5F2EA 4JLAA 2CJWB 4PSAA 1P5ZB 1IXSB 2XB2A 2XAUA 4MYCA 1E2NA 3IHWA 1PUJA 5FTKA 5K8UA 4DLTA 1Y8FA 1T3HA 5EP3A 4HUQA 2GWHA 1IM2A 1VG1A 3I8SA 5E7IA 5FBVB 5AJVB 1KMQA 1Z2CA 3WYFA 5DN6D 4KFUA 3LV8A 4BWYA 1GL9B 1U8AA 1KO4A 2AKAB 3IGFA 4HLQB 2GHIA 1DAKA 2VHQA 2VP9A 3QG1A 4PO8A 3RRMA 4BASA 4F4JA 2J0SA 1OJLA 3AB3A 1G20E 2XXAA 3VU9A 4TMXA 5EZ6B 1NN0A 5EJEA 4LZZA 2OV2A 3SFZA 3VHXA 2OILA 2Q3HA 4V0MA 5JSZA 2BEKA 2QT0A 4JZKA 1CS4C 2WICA 3DKVA 2BCJQ 4RJLA 2VP4A 2HF9A 3UATA 3QIAA 5AUOB 3ADKA 3U3KA 2HUPA 3S1AA 3IDQA 1II0A 4ZDIA 2R62A 3PEVA 3U7HB 3TSWA 1JQLB 4D25A 4NCHA 5ELXA 5TXGA 4RFSB 1F6BA 2FSIA 5DSZA 2CCKA 4OK3A 4TSFA 3LQQA 1W2GA 5IDVA 3KB2A 2BOVA 1SVOA 1X1RA 4QBIA 4Q7MB 1QHSA 5BW8A 3IPXA 4GDFA 4LK2A 1Z0AA 2GVZC 3MSXA 2OESA 1KDRA 4JLDA 3SN6A 4IOJA 4DLWA 2GKSA 4URUR 4AKHA 5GJVC 2V6JA 5H8WA 3GLHB 1F2TB 3B13B 1QG4A 3F0TA 3TQCA 3M6AA 3E2IA 4TSFD 1H8EA 5GJCA 4EJSB 5L8VA 4A8JA 5C2JB 1RRFA 4TLDA 4BZXA 3GJ3A 2ZYTX 4XH9B 3C41J 3SQXA 2QMOA 5AUPB 4O0MA 1ZYUA 2OCBA 2FE4A 4YMUA 1TQ6A 3K0EA 1W0KA 2OFWA 4URZR 1K6MA 1WB9A 2JCSA 4LV5B 2DYKA 5B2ZA 1XRJA 4V0LA 3X1WA 1EX6A 4ZCMA 1IY2A 5J4KA 2PMKA 2YOGA 2WSMA 1EFUA 4IFBA 1NL3A 1H8ED 4DIDA 1TU4A 3W3ZB 4OQMA 4OYHA 2AR7A 3R20A 4Q9IA 4CW7A 4P31A 3W90A 5AUQA 121PA 3WRXC 1S9HA 3IO5A 3KQHA 1J7KA 5H68A 1HH4A 3CF6R 4MGZR 3L0IB 1NVVQ 2FSHA 1W0KD 2W6ID 1SKYB 1WP9A 3HP1A 4D0NA 5KTYA 2OLJA 4TYYA 3TSOA 3TR0A 3X1DA 4R2IA 4B75A 2HYDA 2ZRAA 1QZXA 1Z8FA 2C8VA 4ZDKA 3UG6A 1FARA 2DWQA 1NKSA 2PCJA 4PPQA 4QOSA 2O8CA 1TEVA 2AL7A 1TF2A 1SXJA 1KTVA 4HAXA 3VR2A 3K0CC 4NTZA 4A0RA 1QVAA 2ZSBA 2ANCA 3ETLA 1AS0A 2BEJA 2LCFA 3ZS9A 2ODNA 1WCV1 5IRCD 1V43A 2D06A 4BLOA 2IS2A 1CRPA 1HYQA 5JMTA 4PANA 3CIOA 3O8CA 5LD2C 2ZS9A 4CGZA 3QXSA 3T15A 3LXXA 1W7AA 3VMFA 3QENA 4HAUA 3SYNA 5J40A 2GETA 3ZVRA 2DB3A 2IHYA 1CTQA 2Z0MA 2AN9A 2ORWA 1SKYE 1FQJA 3B8HA 2G3YA 1KY3A 5EXSA 1KNQA 3WP0A 5TV2A 3LAWA 1MO4A 2NO0A 4GOJA 4Q01A 3CF0A 3U2QA 1CJMA 3EPKA 3R9IA 2H5EA 1OT3A 4KAXA 5BYJA 1TL7C 2QMEA 5JJKA 2OXCA 5SZHB 2ZJZA 1GRQA 1IOZA 4HLDA 4OI1A 3W5IA 1OH8A 3PEWA 2J0VA 4Y0VA 3Q85A 1PVOA 3BS4A 3K9LA 4AKGA 3VKGA 1CKEA 3UMRA 2RHDA 3U3RA 1FZQA 1GVNB 3QKRB 4UNNA 3ZVNA 3CRW1 5B64A 4A2WA 1OPXA 2Z5FA 3MLEA 2VSXA 3O47A 3GLIB 2GTPA 1HTWA 1G3IA 1M34E 1SVSA 4XWAA 3WXMA 1A7JA 3RANA 4I1SA 4IJMA 4LJAA 1T0JB 1YR8A 3QVUA 3SJCA 5CDFA 3IIJA 2QORA 3MMPA 3QBTA 5FBQB 3WYAA 3TIFA 3ADCA 3NHBA 2XZOA 1P62B 1WE2A 2F7SA 1XPOA 1G41A 4HLUA 3AKYA 4B3FX 1E2EA 3TKLA 3BBPA 2J0UA 4XD7A 5SZJA 2NTYC 4D4LA 1UBCA 1DADA 4O3MA 1PLKA 3QXCA 5B58C 4JKIA 2ZUCA 4GNKA 2QTFA 1OKKA 1RRGA 1KMHA 1XZQA 1OF1A 1MV5A 2HCJB 2GA8A 4CT5A 2QL6A 4C30A 1F2UA 2J59A 1CIPA 4LBWA 3NBXX 3D8BA 4PQYA 3PQCA 3WY9A 2GEVA 3C14C 2ZPTX 1DAEA 2Q9CA 4B3GA 4WIAA 2JIZD 1CJKC 5TDHA 4OI2A 1XCMA 2N1BA 4PTLA 4D4KA 4E22A 4X8OA 1Z3IX 3IBGA 1XJQA 5CK4A 5EP2A 3RRYA 2AK2A 4HZIA 3PR1A 1Z06A 2OG2A 4EKDA 1Z6TA 2P6UA 3I92A 3NEJA 4LHVA 4G5SA 3IQXA 1OKKD 5TB5A 3PG5A 5CJPA 1OXVA 3FPAA 1XEXA 1NLFA 3FFAA 3ECCA 1VG0B 4LYAA 4FCTA 4A8JC 1E0SA 1KO8A 4BEJA 3RNLA 3UXMA 5JJLA 3QJYA 1YRAA 4UQOA 5BN5A 4B3DA 2IXFA 3B2EA 1YZQA 4GP6A 3QY0A 3KX2A 4IVRA 3HJNA 2NMVA 1WXQA 2BC9A 2VTKA 4ILEA 1YZKA 1EFHA 1TF5A 2BJWA 1OIXA 2GK7A 5AJWA 1OB5A 1IN6A 1NJGA 1NN1A 1SQ5A 2XSZA 4G5OA 2YINC 4BFSA 4QHYA 4XTCS 2W0MA 5DNYB 4MRSA 1G21E 2BMDA 5IT5A 2QY9A 2IS1A 1SKQA 1G16A 5CIWA 2N46A 3WBJA 4U02A 5JECA 1XXHB 4L9WA 4QNMA 1II8A 4P3YA 4P0TA 2GJSA 2OFOA 3W8NA 2ZRMA 1JAHA 3H2YA 2XEXA 3M0EA 4DLSA 1QHHB 3O8DA 4JLPA 4AYXA 3NHAA 5E7MA 2XSZD 3BFKA 3KKMA 1M7BA 1JEDA 1VCMA 5HR5A 1P3JA 4Q4AB 1UKVY 1SXJC 3CLVA 1BIFA 2H1LA 3D3QA 1AKEA 2QBYB 2BHRA 4OK5A 5JS8A 3KQKA 1MABA 4PXAA 2NO6A 4L4UA 3SOPA 2GESA 4QJ5A 1E9DA 4Q66C 1VCIA 2ZE6A 2OBNA 1S3GA 4L9MA 4W9MC 2G0NA 4PHHA 5FOUA 4US0R 1L4YA 3MFYA 1S9DA 1T3SA 1IHUA 1JI0A 3SNHA 1P7CA 1COWD 2OCAA 4LHYA 1C1YA 4PFSA 4YONB 2E1RA 4ASUA 4F91B 4PPNA 1P60A 2WJGA 2IK8A 1NY5A 2ZJ2A 1IN5A 3N5CA 4TQAA 3G82C 1TU3A 1HT2E 1XEFA 3QPWA 1LV7A 3DOFA 1YZUA 2QP3A 4EFNA 1E79A 1RJ9B 1Y3AA 1W36D 4F93B 4B47A 2MSCB 4FINA 2GXSA 2ZSAA 4KHZA 3QF4A 4E5UA 2Q21A 3SHWA 3PUVA 4ASUD 4B48A 2ZYWX 2C78A 3FTQA 1AA9A 2QAGA 1E9SA 1KZ7B 3RS0A 3LX5A 2GBLA 4A4DA 2WKPA 1FP6A 4RD6A 1SVMA 1HQYE 3KQNA 4Q9JA 3QVVA 2ZRJA 1GKYA 1XP8A 2GXQA 3SYKA 3FMOB 2GILA 3K70C 4ESVA 2Z4RA 4L16A 4GOKA 5EE1A 3VQTA 2OLKA 2BBOA 4RZ2A 4FMDB 1P9NA 1XMSA 1Z28A 5FTJA 2BMEA 4XWOA 4TYWA 1K5DA 5LB2A 4HLUC 2ZJ5A 2IWRA 2D7DA 1VECA 2YHSA 3UIEA 4MGYR 3UWOA 4ABYA 2XGJA 2GCPA 5BN4A 2PZFA 3W9YA 3GJ7A 4RD1A 2NG1A 1F60A 1E9BA 4M4SA 4ON9A 4DSNA 1AS2A 4NPHA 2DCUA 1NI3A 1XD9A 2V55B 3MJHA 2QGZA 1XNJA 1NRJB 3AVQA 1G18A 1S96A 1UM8A 3QPVA 1XMIA 1Z83A 3FKQA 3Q7PA 3OE7A 4RD3A 1CEEA 2JATA 2F3TA 4IOMA 3QXHA 4JSYA 3BFXA 2RCNA 5C18A 4S2EA 2V8OA 1KI8A 4GBMA 3HU3A 4XSHA 5KOYA 3KQUA 4B6DA 1HT1E 1L8QA 1EG7A 4TL7A 4EPVA 3D31A 3U44B 4LJ5A 5AR1A 3Q9LA 4BFTA 3MRSA 2DHRA 1A1VA 2ENNA 4M1YA 3OZXA 3CR8A 3W3AA 4KO8A 2A5DA 4JLOA 4IDQA 4PC1A 2NOAA 1G64A 1K8RA 1KBFA 2CCGA 3RC8A 3UPUA 3F3YA 2C2HA 3OE7D 1ESNA 1JQJC 2ZS7A 5E95A 5CYPA 3UEYA 2CL7X 2NO7A 3B5JA 4EJSA 4PC3A 1OV4A 5CJ2A 4L15A 1I2DA 2ZSFA 5HE8A 4OI0A 5CK5A 1XTQA 3VR4A 1GDDA 1OFUX 1AGRA 2BJVA 4G3XA 4D0LB 4LWZA 3KKNA 1Z0IA 2QP4A 4PAQA 5BWMA 2CHVA 2EVWX 4LC1A 4OQXA 2OZEA 4P32A 1KAOA 1M7HA 3A1VA 1EX7A 1AIPA 4PR0A 1GOTA 2VP6A 2RGAA 4ZIRA 1KKMA 2Z4SA 1C9KA 1OFIA 4CEIA 3TK1A 1KJZA 4PQRA 3AP2A 3KJGA 4FXPA 2O8FB 2J7PD 2C99A 1TTTA 2P3SA 3QOFA 4NCKA 2WMOB 3DPUA 2H92A 4V0OA 4ZI2A 2OCYC 1B23P 1GSIA 1OYWA 4JT4A 4B34A 1P9RA 1G8GA 4A1FA 2ZM5A 4HEJA 4DSTA 1P6XA 1UEJA 3R7WA 4B2PA 5L3QB 3BJIA 3B9PA 2WM9B 3HPRA 1Z0DA 1OB2A 3GLGB 4BFWA 3QXJA 2ZUBA 4OHXA 4C0KA 2IC5A 1JNYA 1Z47A 3BORA 3TAUA 3U6BA 3KJEA 1KSGA 3K70B 2REOA 1DAMA 3CONA 3QKSB 2KI5A 4M21A 2O8EB 4IDNA 2PT5A 2RAPA 4Q9HA 1GNRA 4PAMA 5P21A 4IOLA 3R8CA 1FQKA 4MGKR 3N70A 4EAQA 3G0HA 3ZLJA 4JYCA 4F4CA 5FUWA 4XWKA 3AVTA 3A4NA 5FTLA 3PJRA 3SZRA 1VYTA 2O8BA 3H4MA 1NMXA 3L8ZA 1MKYA 3NTUA 5EE9A 3RSLA 3KUDA 4TTPA 2AFHE 2YNMA 2FZLA 1R5OA 2FFBA 4CRWB 4PHGA 3GFTA 4N0DA 2PMDA 4KBFA 3UMFA 1XF9A 2WWFA 2ZRKA 5EP1A 4C0AC 4CEJA 3G5UA 2R8RA 1AJEA 2ZRPA 1W44A 1CU1A 3KTAB 5HCNA 2WWWA 1ZC4A 1EFTA 1NVVR 4GOXA 4BLSA 3E70C 5C4MA 1G3MA 2C04A 2BKUA 2WJVA 2GEUA 3KY9A 3QKTA 4YC7A 1CJVC 3OHMA 3SDZA 4Q4HB 3TAHA 3UGDA 5TMPA 1VCOA 2V6IA 2W58A 3B60A 4DSOA 1TMKA 221PA 2Q0HA 2JEOA 2HLDD 4C7OA 4DUGA 4MUBA 4LJ8A 1G3QA 4MRPA 1JB1A 4PZZA 4BRUA 1UADA 3ICQB 3C7KA 1XMVA 2C9OA 3RLFA 2FJUA 2GBLC 2JGNA 3HDTA 2A3RA 4KBGA 2C77A 4NP6A 1PTRA 3PEUA 5FPKA 3EW9A 4M1SA 1HA3A 2PEZA 3W34A 3HU2A 2ELIA 2B8TA 3KUCA 3NG1A 4JYBA 1U98A 4NDZA 2FZ4A 2OT3B 3KL4A 4EUNA 4V03A 4W5WA 2J1LA 1KI1A 1OH7A 4BZPA 5UKDA 3Q5EA 2HYIC 3NC1C 2QQ0A 2CLDX 2I3BA 4Q7JB 1YR6A 2RGXA 4Q02A 1IJEA 4PX9A 4E09A 3THYA 1GIAA 3GJXC 3NIBA 3ZIAD 2ZE7A 3THXA 5IK2A 4BQSA 1FNMA 3OESA 1HV8A 4IXNA 2RGCA 1G19A 2QEQA 3FYHA 1YKSA 3RABA 1RRPA 2QZ4A 1G5RA 4I1OA 1BKDR 2F43A 4KLNA 2GEDA 4B74A 2QPTA 4B3BA 1EESA 3MWYW 3OAAA 1X8KA 4UJ5A 1KGDA 1UKYA 5EQTA 3PV0A 1UEIA 3BD9A 3LW8A 4HB0A 3GP8A 1OLOA 2BBSA 3EPJA 3A1SA 1Y63A 4N1AA 5JJIA 5FPHA 4F7WA 2G1KA 2EFCB 3LX8A 5IK2D 2PBRA 2ZYUX 2AWOA 1E2DA 4ACAA 1JJVA 2PCLA 1OW3B 2Q6TA 2QI9C 3HWSA 1KI9A 3OEHD 3ZVMA 2JA1A 1P2VA 4M8NE 3TVDA 2DWPA 3ZS8A 1ZIOA 2JJ1D 3U6KA 1DAFA 2CVFA 1G6OA 2WBLC 3SS8A 1NG1A 3HPQA 1CXZA 4TQUS 5FR1A 5EE0A 3U7EB 1XTRA 2AHOA 4KI0A 3FMFA 3OAAD 1JAIA 2VA8A 5TY0A 2D7CA 1WBDA 1QVRA 2WV9A 1PUIA 1UF9A 3WMGA 5B57C 2IYSA 3KXIA 3BIFA 2V7QA 4CIDA 4A6XA 2B7BA 2UKDA 2XTMA 3NBZC 1XD2A 3MWJA 2AD1A 3UKDA 2ZI5A 3AF2A 4C0LA 5CB8A 3ZZTA 4Q19A 2EWVA 1DG3A 2QTVB 4DCSA 5FH9A 1DBSA 2R44A 3U3JA 3UGIA 2ECKA 4FMCF 1DEKA 1ZINA 5CIQA 4IEEA 2E73A 3DL0A 4NBSA 2GZHA 1GRNA 2A9KA 4MKIA 4DCVA 2ONKA 2V7QD 5KDLA 2ZSEA 5FBWB 3K8YA 1RYHA 3RS2A 4L9SA 1BYIA 1TQ2A 3C5CA 3GFOA 4UJ3A 3UMSA 1N5KA 2WOJA 3P1JA 1YRBA 4Q1EA 4RFVA 4PHTA 1QF9A 2H17A 1E2FA 4D2IA 4F92B 2P65A 3AF4A 4CDGA 4EQ6B 3GLFA 1DE0A 2QRNA 1XDBA 3BC1A 5JEEA 3NEYA 2ZRDA 5KU1A 3CZPA 4QBGB 2FA9A 3LRPA 1AQUA 4DLRA 1E2JA 2ZJYA 5LPNA 4Q4JA 2QN6A 3ZQ6A 1R5BA 4PZYA 4EPYA 3RS7A 4D26A 4NYJR 3RAPR 2QQEA 1CR1A 2K5UA 2ZUDA 5EP4A 1I2MA 4B32A 2ZRGA 5J4LA 5EUMA 1KDPA 4D4MA 1SVWA 2MSDB 5FOVA 4DCNA 2OXRA 5G3ZA 4OJKA 3X1YA 3B1YA 1KBEA 2N42A 1NIPA 2W2TA 4A6PA 1UKZA 1G8PA 4DZZA 4RZ3A 4JKYA 2IEZA 3RWMB 2F1HA 3GPLA 3IO3A 4DB2A 1X86B 2F9LA 2AWNA 3L0OA 5FUXA 4JBXA 1TX4B 4DDUA 3AUXA 3CPJB 1UBEA 4HAVA 2QT1A 4BLQA 3QF7A 1OH5A 2W6IA 3IUYA 4PZLA 4R98A 1N0WA 2GZDA 1HY3A 1E2LA 1NN3A 4ZV4A 1US8B 5FL7A 3SI7A 1Q57A 5DLQC 3IILA 3THOA 3DZ8A 5DI3A 4EPRA 2HV8A 4JMPA 1ODFA 2Q9BA 4EFMA 1F48A 4YDHB 4RD0A 2LWIA 4D0GA 2IW3A 4MDFA 4M9XA 2P6RA 1IY0A 3M1IA 2XNSA 4JVMA 2FOLA 3GLHE 1J8MF 5JCZA 2WPDA 3Q3JB 1XCPA 3Q72A 1T5LA 2JLRA 3FWYA 4YMTA 5FL7D 3GJ0A 3K9HA 2GCNA 4IDPA 2QPOA 1Q22A 1XFAA 1DPFA 2ZJBA 2G77B 4UNSA 3SFVA 4EPWA 2WWGA 4QC2A 2NIPA 3W5JA 4MKHA 1FP7A 1EK0A 1R10A 1Q3TA 1ZAKA 3LD9A 4Y0AA 4Q00A 4NYIQ 2QE7A 2ONJA 1G8YA 3L0SA 3LNCA 4J0QA 4QGHA 3U7FB 1AN0A 1D6JA 2ZRIA 2QUZA 2WPDD 1G9XA 1GRRA 2EFDB 2GDJA 2PT7A 1HE8B 1A82A 3U4QA 3F5FA 1YR7A 3W8RA 4XJXA 1W4RA 4ARZA 3K0AB 3DOEA 3W6OA 4YMVA 3AM1A 4GL2A 2PLFA 4EIWA 4TMTA 4C0SA 3KQLA 1SVIA 5FL3A 4GZLA 3IKJA 2AK3A 2GCOA 3SEAA 4QRHA 2CEAA 3FGNA 4TLCA 3ZZ0A 1U2RA 1Q1ZA 2ZU6A 1Z22A 3KDSE 4OKSA 1J2JA 2QE7D 3WP1B 3I5YA 2WAXA 2F3RA 1YZNA 3SHFA 4XVUA 2J87A 4DBLC 4UXJA 2D74A 2WJHA 4YQFA 2YYZA 1R0XA 3I1FA 1GZSA 2MSEB 4GT1A 4NE2A 4KSBA 3WYGA 4BE7B 3KKPA 3LXRA 5J4VA 2E87A 3O8BA 5D3MB 2ZTSA 2NPFA 3RDPA 1X8LA 4C2UA 1ZD1A 1W5SA 1P2SA 3ADBA 1DOAA 2GZAA 1QBKC 1U0HC 2JDIA 3TRFA 1KI6B 1MO3A 3K0FA 1FX0A 3SC3A 1N3BA 4Q1FA 4TQ9A 2JLUA 2KE5A 1YZLA 4US2R 2IEYA 3RS5A 4LBYA 4G0NA 4II7A 3O8RA 3L2OB 1DAIA 1GP2A 3ZZUA 4LUCA 4ZKDA 2YWHA 2HCBA 3KXLA 5A0FA 2EYQA 2FPKA 2WWIA 3CH4B 3A1TA 2ZRFA 2I1VB 4QL3A 2O52A 2JIZA 1R2QA 2YUUA 4QGFA 3SR0A 2JDID 4CEHB 5J47A 4QG7A 5K8TA 1BOFA 4IXMA 1ZD9A 4MUAA 1HEIA 4P4SB 4YMWA 2VP2A 3MCAA 2ZRHA 4E07A 1S4QA 3I32A 1GKUB 4TMKA 1E2QA 2O0KA 2OM2A 3IPYA 1ZBDA 3CX8A 1RPZA 1PV4A 5L3SA 1U8ZA 3DDCA 1N5JA 4LPKA 4E03A 2MMGA 2V3CC 1H65A 2KSQA 1TF7A 3ZQJA 1F3OA 1ZC3A 2ANBA 3LVQE 3C8UA 3GMTA 5JEDA 4X8HA 4V02A 1E99A 3GLIE 2ZR7A 4C3ZA 4BFUA 4LBZA 2FSFA 4URWR 4LI0A 4EPXA 1XPRA 1EFRA 3CNOA 1CR4A 5EXXA 1EFCA 4LSGA 3K9NA 1GILA 2ENZA 3R8FA 5DH9A 4JIMA 5EE3A 4LRWA 3IIMA 1WDTA 2O5VA 2ODBA 1VYVA 1VG8A 4HUTA 3OF5A 1I4LD 1N25A 3LLUA 5LD2B 1TBNA 2QA5A 3T5GA 4B6FA 2FU5C 2ZJOA 5EXTA 3RS4A 1NG9A 3WNCA 2QROA 2XTNA 2CCJA 3T1OA 1G8HA 2XX3A 4KFRA 3AP1A 2BBTA 5H70A 4A2PA 3SE0A 2VRWB 1I4DD 4HZUA 3RVBA 5SZKB 2IYVA 4G1UC 4NYJQ 1N6LA 1W46A 4U7DA 1EFRD 1IBRA 4M1WA 2VYFA 2VHUA 4UNQA 2KBEA 2XOKD 2YZ2A 5H1YA 1NVUQ 5JWHA 2OO7A 4LJ7A 2PZGA 4EFLA 2EFHB 4GRAA 4HUQB 1KY2A 3FMIA 2P5TB 2XNDA 3UEJA 2F6RA 4TTRA 4DLZA 4DT1A 2X2EA 1QHGA 1RZ3A 1R8QA 2QAJA 5FOWA 4QM6A 4LOAA 1E9FA 1N5IA 3CNNA 5FBLB 3REGA 4R2HA 5KUTA 3BH0A 1LS6A 3AF1A 5HZHA 3PUYA 2O8DA 3FOZA 4BFVA 1E0JA 4DHEA 3R9XA 2XXAB 1X6VA 4LJYA 2V1UA 3P4XA 3VU9B 2W6JA 1TUEA 1COWA 3T1QA 4LJ6A 3NH6A 4TYPA 4JVSB 4U00A 421PA 1D5CA 2VBCA 3FHOA 4LC0A 1PTQA 4MYUA 1NKTA 1P72A 5JSZB 4AY2A 4NU0A 2QM8A 2XNDD 3RS3A 2VHJA 3IEVA 2CDNA 1W1WA 4BFXA 3U60B 4DC9A 2HT1A 3MJRA 2OUKA 3S1AB 1CP2A 3CKLA 4AURA 2AKYA 2L0XA 2WKQA 2RGEA 1R0ZA 3E1SA 3GEEA 4X8LA 3T61A 4BRWA 1EWRA 4Z8YA 3THWA 1XXHE 2ERXA 1IN7A 2VF7A 3CRVA 4OBEA 2W6JD 1N2CE 1RC8A 2HXSA 4PSVA 4TLBA 3TW8B 3PITA 2ATVA 1J99A 4YDSA 4D4JA 4DIEA 2IF2A 3U7GA 1MO5A 4RZUA 3T06B 2ZI9A 2A5GA 1U0JA 2R6DA 5G3YA 2WJJA 4YXWA 1KDTA 1Q21A 2DFKB 2VP0A 2WJIA 3BERA 5JHGB 3A4LA 4KYIB 3VX4A 4AWXA 3NDPA 4N0EA 5CLLA 3UG7A 2BIFA 1U94A 5CB6A 3B1VA 1E2GA 1UAAA 1KSJA 4Q48A 1U90A 4M53A 4KVAA 3RRNA 3GEIA 4LPSA 2FFHA 3DM9B 1K5GA 1NBMD 3I5XA 821PA 4PPGA 4C9BA 4JBYA 5C46F 1SVLA 4GFDA 1WA5A 3PXGA 5F9HA 2CJWA 2VHTA 1CRQA 4A8JB 3RC3A 1P75A 1JJ7A 3HR7A 4YMSA 3GJ5A 4KSCA 5KSZA 5KO2A 1NLZA 1BYUA 4YXWD 3A58B 1OXXK 3EZFA 4NL4H 1ZNWA 1E1RA 4LHXA 2IF0A 5FI1B 4V0NA 2XITA 4A92A 3DZDA 1NP6A 2JAQA 3K9GA 1FW6A 2IWHA 4B71A 8OHMA 1GAJA 3QXXA 3LA6A 3LWNA 4R9UC 3AGQA 1OXSC 1Q1EA 4WZBE 2I4IA 5FOTA 2C9YA 1YE8A 4FCWA 2FGJA 3EIQA 3OIYA 2A7QA 3QPUA 2FDCA 5BYKA 2OE2A 2Q9AA 1ANKA 3V4FA 4P33A 3P27A 3ASYA 3LQRA 1VKJA 1Z0KA 3CW2A 2ZAMA 1ONBA 2H8KA 2NQ2C 1E1RD 5HTKA 4HB2A 1ZU4A 2R65A 3C4JA 4QM7A 2Q3MA 2W2VA 1HURA 4RFSA 1FOEB 2W2XA 5E7JA 2Z83A 4B2IA 4A36A 2J3EA 1U9IA 4B2LA 1ZRHA 2J45A 4L5BA 1A5TA 1BH2A 3AKEA 4Q03A 3TVTA 2O8CB 1W2HA 1TADA 2C03A 3TSZA 1JEEA 1R6BX 3VR3A 2AX4A 1MT0A 4DKXA 3EPLA 4JJZA 1SXJB 3QG5A 5DHAA 4HAWA 5KHOC 2ZETA 1Z6YA 3QEOA 4IDOA 2PL3A 4Z54A 4JS0A 3AVYA 3VR1A 4JJKA 1UFQA 1IQPA 1ZJ6A 3GLHA 4R7ZA 1F2TA 4GZMA 1LNZA 4OJQA 2IYLD 1ZU5A 4M1KA 1W0JA 4JVLA 1KI7A 4LHWA 2ORIA 2D2FA 2ZRBA 4O25A 1N5LA 3CWZA 4OQLA 4RKEA 2J7PA 2IBMA 3MWLA 1W4CA 3N2EA 1AQYA 3DHWC 1FAQA 2PEYA 3R9WA 2BMJA 2REXB 2EWWA 5FPSA 5AJZA 2RH5A 1G4AE 3KB1A 5JZVA 1KZGB 3EC1A 2ZR9A 4DJTA 1KHTA 3AUYA 5LDDC 2IS4A 3LLMA 2Z43A 1R0YA 4B35A 2J0QA 5IHPA 2JASA 1JXMA 1Z07A 3NVAA 2XZLA 4D80A 3AF0A 1W0JD 5FPTA 3B7GA 4Q1DA 4LV6A 1M6NA 1SXJE 3BXZA 1Z63A 1L7VC 3PUWA 4Z51A 2GRJA 2ZJAA 3IQWA 1VHLA 3RRZA 4DCTA 4RSGA 3CRRA 2FFQA 3T1VA 5JS7A 4BLTA 1SVKA 4KLZA 4D82A 4O2LA 1Z6GA 3WRYC 3WMEA 1NY6A 2R2AA 2B8WA 2ZI6A 1M74A 4K46A 4WOPA 4LYJA 1G7CA 1Q0UA 4TL8A 3QEJA 5KPDA 2R6CA 2X2FA 2AD5A 4G5QA 1NSTA 4RD2A 2EU8A 5DI9A 5G40A 3SBDA 4KU4A 2JJ8A 3VKWA 1W5TA 4G5RA 4M9ZA 1BMFA 1E9RA 3VHLB 4KV9A 2X77A 3ND9A 2GVDC 2J0UB 2XZPA 1W49A 2C5LA 3EASA 3WHLA 3NBFA 4ACBA 1R0WA 1ZM9A 4LBVA 3CXLA 1XJ0A 1ZW6A 2WVJA 4M2LA 4U5XA 1KMHB 1W36C 3FE2A 2PH1A 1KIMA 2GAOA 3IIKA 1E0AA 5KPJA 4RZXA 2WJYA 3F8TA 4DDTA 3I3SR 1T8TA 4JLKA 4JBWA 2V4ZA 2JJ2A 2ORVA 3JVVA 5HCIA 2HLDA 4FCVA 1F2UB 1LF5A 1KI4A 3SBEA 3JVUA 4WW0A 621PA 5AJXA 3QBVA 1HQCA 4TT3A 3OIVA 3VR5A 4BLPA 2IXGA 5C4GB 4DDVA 1Z6AA 3LO5A 2YWFA 3DM5A 5M04A 1BMFD 4FI3C 1XPUA 4M1TA 2ZE8A 4NCIA 4POAA 2ZE5A 2ZJ8A 5IF9A 4B33A 1KJYA 2IYQA 4A0GA 4PC6A 3GLGE 2E9SA 2ATXA 1XWIA 2IT1A 3CM0A 3AH8A 2IYUA 2ZSDA 4LYFA 1ZM3A 4NCNA 4MKFA 1DELA 2XJ9A 1XEXB 4MGIR 3QQ5A 1E6CA 3GJ4A 4ESHA 4Q4LA 2JJ2D 2YV5A 4LGMA 1VG9B
chains in the Genus database with same CATH superfamily
4FHEA 1QVWA 2OV3A 3H4IA 4TT3D 3UCXA 3GYBA 2W2LA 1C7FA 1FF9A 2GM3A 2QAGC 5C35A 3EGVA 2JZMA 1HYHA 2JLCA 2D7JA 3KQYA 1OFTA 2V98A 4NYIR 2PJRA 3EQ7A 2BCGY 1RTKA 2PZAA 1WTJA 2ZM6B 1H93A 1MBZA 1RRVA 3AFNA 5LMZA 1PGQA 1ABFA 1GQYA 4QKQA 4MV6A 1TRHA 4NBTA 3A9TA 3G8DA 4NV1A 4TTTS 4LDNA 3I5MA 1WY7A 4MCJA 1XB2A 2ZJFA 3KD3A 4EUFA 3DBHB 3JALA 3A4MA 3S1LA 2DWOA 1T10A 4OHBA 5EYPA 1G7RA 1Z5VA 3A1DA 3IOBA 5EIAA 3B1XA 2AH5A 2IYWA 4X1KA 1CT4I 4NU8X 4KVGA 4AL4A 4PBSA 1K7XB 1UXIA 5AMXA 1II8B 1CJSA 2IIBA 2O1XA 2CNLA 2DFLA 4JP5A 3SHVA 3WGHA 3KSBC 2O2GA 1CUSA 1K0UA 1W47A 2IQIA 4EZEA 3WRXA 3SEFA 1ISMA 1DP4A 1T1IA 4OKNA 3LBNA 5KYXB 3UW1A 3WNQA 3AHJA 1GUAA 1Z8NA 4TZ0A 1WVGA 4PZEA 5DWVA 4DLBA 4N76A 1JQKA 2GJ8A 3TWOA 4FFLA 3A1FA 4DLUA 1WEHA 4IUCS 4JWTA 2IS6A 3DTNA 4MUNA 3JVIA 1NX6A 3OF2A 1P3Y1 3OQJA 3W2TA 4NH0A 4ONEA 2J48A 2GJ9A 2XUAA 1AKUA 4DCJA 1MOPA 2FG5A 5E4JA 1CVIA 2R8XA 3V42A 1XNGA 2DUJA 2PX3A 5K3BA 4BFLA 4EGCB 5K0BA 3UAWA 1BTOA 1MO6A 5KOHB 4XIGS 5ICCA 2FY8A 2QG6A 3GAFA 2O50A 1P6QA 2C2XA 3K1YA 1PJZA 1VSTA 3FOFC 1TKRA 3Q7SA 4JWKA 4PPYA 3VTKA 4BGDA 1XJCA 4DLLA 3FM9A 4UM5A 1LLQA 4QARA 1D6NA 3U19A 5AHWA 3JPYA 2NU8B 3PRYA 3VOAA 3HSKA 2H16A 2JH9A 3DWGA 4H4DA 3H11A 3CPEA 2OQVA 2PZEA 4HH1A 4EG6A 3DPIA 3SBOA 3IV6A 1HKUA 1Z33A 3K1ZA 3LDUA 3ILVA 2J7KA 1C0EA 1Q0ZA 1T5IA 2P30A 2Z1MA 3K3PA 3IBYA 3NXSA 4Q15A 4FM9A 3LLVA 2WJWA 2IUSA 3SJBA 3GN1A 1F06A 1GNVA 3DDWA 4BCBA 2PGOA 2XCQA 2CL6X 4FQ8A 1EUCB 1G7SA 4DTCA 1JIJA 1YBHA 3EA0A 5TVGA 4EG4A 5EHZA 5FPYA 3EZ7A 1DXHA 3HBMA 1JDZA 1WRBA 1DUIA 3ASZA 1BXGA 1JR3E 5G53C 4H15A 4WXRA 3UMBA 3SHOA 4MAFA 1ZK1A 4ALJA 2QSZA 5GADl 4XCVA 1E60A 4PVDA 1Y6GA 4MIYA 3AUKA 4BVEA 3OJWA 5HFJA 2J3HA 3L18A 4F3NA 1XXHA 2GT1A 2ZROA 1LRLA 3FPLA 3RFVA 3N8DA 3CX7A 4JSTA 3S3TA 3PHJA 4II2A 1FTWA 1QHHA 4B6EA 1PJAA 1OI7A 4OLJA 5DN9A 3BJIC 4NG4A 4OHFA 4ZOLA 1N33B 2FP4B 2SGQI 5D5HA 2RKOA 4UATA 2YZKA 4IHJA 1ZD3A 1L5MA 1NQAO 2JIBA 1C7QA 2VHYA 4B6OA 1U2SA 1N6NA 1K3TA 2VJAA 1UJ2A 3NEPX 2BMVA 5C0OE 2C7RA 4RIIA 4E0BA 2QD1A 4Q4AA 3UTDA 4AUNA 3M7IA 5ENVA 3AEYA 3F6RA 2ZOSA 3V4OA 1MMFB 1RXCA 2CL0X 1RYZA 2ERYA 4G36A 3V3KA 4BVLA 4CKWB 4HT3B 1U2PA 5CITA 2PLWA 5DF1A 4ZVKA 4TMWA 3HZHA 3LPDA 4M7OA 1Q14A 1OXKB 1U2DA 3IXMA 1PE0A 4BQQA 1ECCA 1JF8A 3V32A 1CQXA 1JVSA 2EKPA 3G5AA 3R4VA 2FMIA 3B70A 1A9XB 2Y1OA 2PUDA 3AF6A 1LDNA 4KUEA 5JI2E 4LRXA 1NBEA 1UAGA 3MWGA 1PWYE 1D07A 2O2IA 4JB0A 4DMLA 5FUQA 3U9TA 3O7MA 4C0HA 1Z15A 2BBWA 2GN2A 4JOCA 4LE1A 4RKRA 3GCGA 3U7IA 4M87A 2HADA 4ZO6A 3QLTA 1EFKA 1GTVA 2P5SA 4IJQA 4ZU3A 4R31A 1QF6A 2CLSA 4TKUB 5JCXA 2R7LA 3H65A 1OXBB 1KO5A 3EVGA 2VK4A 1ZP6A 2JFXA 2NXWA 1NQXA 1Q20A 5CLGA 1AE1A 4ERNA 2A9RA 2UYOA 4GSYA 1ZN9A 3PJFA 3A0UA 3MG9A 1T0HB 1S1MA 3GJ6A 3A36A 3K32A 4AQ7A 3WZMA 4RK0A 4I46A 5THXA 5JHGB 3FVVA 2J6HA 3VSEA 4R7TA 4QYTA 1L2TA 1TQHA 1YE5A 4MV5A 1RPNA 3OY2A 1PQWA 3H9EO 3KT8A 4DL9A 1M1ZA 4X7BA 5ERXA 3HVRA 3JZMA 1NBHA 1OWLA 2J30A 1NXTA 1E5QA 4P92A 1OHHA 4P3KA 4LDAA 3F7TA 3H9CA 5CX4A 1KY4A 1X7ZB 5JS2A 4EVQA 2I78A 1JKXA 3MINB 2W4QA 3CVYA 3AJDA 1E98A 3E3AA 1CUHA 4KXMA 4UCWA 3REQA 1G1MA 4ISCA 4R8MA 3BF8A 3W6PA 5CDTA 1ZD8A 2J3KA 3GG2A 3LWDA 4D4IA 4OY3A 4IYJA 5EESA 1NIJA 4W9NA 3URKA 3J7TA 4D9JA 2CJXA 2QL9A 4FC7A 5JRDS 2R8OA 5KX5F 4CIXA 1QKKA 1YDFA 1CD5A 3FBGA 4RWEA 4DLYA 3CMCO 1N9GA 1EJ2A 2IX3A 3A7EA 1PX2A 2FSSA 3MD9A 1CDEA 3QJGA 3TH5A 2BGLA 2IDMA 5EIEA 3U7FB 1NR1A 1DZIA 1OE0A 4M1OA 4UAJA 2PGJA 2D3WA 1YVDA 2H1FA 2I7CA 3DDSA 1P81A 1BGWA 3EWAA 3K92A 4KIFA 4TRMA 3ZW8A 1NUUA 4XVQA 3FLAA 4EABA 2PGAA 5KSOA 4IILA 2PXHA 5C3UA 1XTKA 3BMOA 1H0ZA 3T3MB 3AHDA 3HY6A 3L4BA 4R0VA 5J63A 1FDSA 5AM4A 1QAOA 4I3GA 2VJOA 2XB4A 1J70A 4BN5A 3H5OA 4U8HA 4AECA 1P1BA 4YNBA 1RWWA 1SGYI 1F6DA 2W8ZA 5CFPA 1UJNA 1XK7A 2SHKA 2Q49A 3VU1A 4V0QA 1HSOA 4J0KA 2OD9A 4C2TA 2Q3EA 1RRMA 3IB6A 4I8DA 1XTZA 4UCXA 2IPXA 4CUZA 4US2R 1S2MA 1ORTA 4WHMA 1L7OA 3S8EA 4XJSA 1L7DA 1M8KA 5CDGA 1PO7A 1DS6A 2NAPA 4XFDA 2FPIB 1CR2A 2P90A 2RB4A 1J9EA 3BK7A 3CZQA 4FUQA 4OQZA 3E9RA 4U0JA 5GOZA 1ETUA 1A95A 1F4LA 3TRHA 3I0ZA 5HZKA 2IHZA 2AV6A 4P34A 1WCIA 1N1EA 1SPBS 3HB9A 2AUNA 1ZWLA 3K5IA 3L40A 5EGNA 4FW9A 4TZ6A 4CQMA 4IWYA 3AF3A 3MBOA 1Z2AA 2H4XA 2NO4A 3MTQA 5EUQB 5ILQA 3ZWAA 4CLXA 2E4YA 1S3FA 2V5UA 3PX2A 4Q1CA 5BNTA 1VA4A 5H3LA 2ZIAA 1KO1A 1JFVA 1QLJA 5KTKA 1OXMA 1O5IA 3UJPA 5H5JA 1HL3A 3QHAA 5CX1A 1E63A 1G8SA 4NMLA 1ZICA 1Y1BA 1XKLA 4Z53A 1A5ZA 4F4UA 4TYQA 3WI7A 2PG3A 1OBCA 4FYYA 1KMCA 2Z04A 1O5OA 3HO8A 4DFDA 4BNYA 4BUJA 2ZREA 1RXWA 1EJ0A 4JUDX 3D6JA 3C87A 3T5MA 4E6EA 4FN5A 4M98A 4Q4CA 4FEAA 3T9DA 4C7OB 3IIIA 4G8CA 2CJPA 2XXBA 4O4JB 4A9AA 2G5PA 3QVMA 1YJQA 4PSCA 3CO0S 2O8FA 1SUEA 4DCMA 5F98A 1XCJA 1NOJA 5U4XA 3BICA 4XEUA 3UKJA 4EY5A 4H4CA 4GXRA 4YAEA 521PA 2GPWA 4S35A 2W0SA 13PKA 4KPUA 3RWBA 1T9CA 4IL5A 5I9LA 1I2AA 1Z0JA 4LDJA 4Y67A 3H5VA 3G2HA 3UO8B 2EX4A 2FQYA 2HNKA 1MTZA 4BMXA 4BXOB 3JQFC 3I5UA 5J58A 1E9VA 2BSQA 3CWQA 1N5RA 5DK6A 1DTWA 1XMJA 3GLGA 2ZYRA 4LVCA 1KYIA 1OLXB 3FWHA 1NVXQ 1D9XA 2ABWA 1KAGA 3TRJA 1Z6XA 3QUTA 5CB4F 2NYVA 4MV3A 1H8HA 5ISMA 4YP1A 1A9ZA 1JG6A 3QX8A 4GX5A 3VZDA 1W75A 1JHDA 2J3QA 5E4YA 4B73A 3THYB 1I4EB 3F7OA 3P9YA 4XQ0A 4BLRA 1UH5A 5ED4A 1A69A 2R5WA 4S1VA 3Q1LA 2G09A 6Q21A 1VIVA 2BT4A 1VOTA 3OVMA 4J1NA 1UK7A 5CNJA 4DSUA 1FYVA 2HSZA 5DASA 1RYNA 2DC1A 1HE1C 2DH5A 3SYLA 3VZCA 5JXGA 2R6HA 1FFHA 3MAGA 4BYGA 1QANA 2OG1A 1RMTA 3KJNA 4I1VA 2R85A 4YP0A 4RHUA 5I8PA 4OHYA 4KQMA 1VMKA 1FDVA 2OO5C 3H5AA 2GZSA 3O2NA 3CSDA 3TMAA 4WZZA 1JALA 4PN7A 4TVKA 3A0RB 1Z5ZA 4FYHA 2JAPA 3IPLA 4MAAA 4OIFA 1JR6A 2DR0A 4XPIB 4WX2B 3LQYA 3KOWA 2EWMA 1OFVA 2QM3A 4ZYYA 4UMVA 8AT1A 4UREA 2J5BA 2CYAA 2VZ9A 4G0WA 3E84A 3H75A 3EIUA 3TI7A 4I5GA 4F7DA 3D6TB 3EFHA 2B92A 4YLGA 3ZYCA 3I2GA 3GX1A 4G4GA 4JLNA 4OA5A 2WSSD 1A76A 1X7YB 2XI4A 1FFCA 3IL2A 3HYLA 4QUEA 3HXMA 1X3SA 2IYTA 3VYUB 5AVRA 1UXOA 3QTLD 2MINB 5LIPA 1XZ8A 1H69A 4GOLD 2ZVPX 2AGVA 4FP9A 1ID1A 2DFNA 3WR5A 2DR2A 1DO2A 1T6NA 1K89A 2UVQA 3D3NA 3FYCA 3MWKA 4FMDF 1OH8A 2UAGA 3NTXA 1O87A 2SGPI 2QWXA 4Z1MD 2OZPA 2ETXA 3C3WA 3I6YA 2JZOA 1O8BA 3STXA 3VKFA 2B6HA 3KQOA 4NULA 3IMKA 3KQTA 3EGIA 1VLZA 2RI1A 4TZKA 1UWKA 4LAFA 3DCIA 3U3OA 3KAQA 4KVFA 5BPFA 3H83A 1QYDA 1Q2XA 3L7JA 4X6LA 4FSHA 3NALA 4GSKA 3UJ9A 3KRTA 4N5DA 2X0RA 1EB9A 3B1ZA 3FH0A 3I4LA 3R75A 3CJQA 4ZRDA 3LBIA 4F4HA 1YDWA 4XPZA 1U8EA 5AUNB 3BOSA 4GWLA 4WJKB 3EGWA 1FTSA 1MH1A 4DBLE 1Z2IA 3QWPA 1TCVA 4IIUA 4BDTA 3ISTA 1GZ6A 3FMGA 2W4IA 2P2YA 4JGIA 4L95C 4U3JA 3N2GB 2PLRA 3KJZA 3QIVA 3MWEA 4MDHA 4XGNA 2ZT6A 2GAIA 3PA6A 2QU8A 1HLPA 1SC6A 3IBCA 1G4UR 4GP7A 1PIWA 2GOYA 4JYMA 4F60A 2QW1A 2V96A 4MVJA 4V0RA 5GZ3A 4D9BA 2A0FA 2EJUA 3K8QA 3NYQA 3CPHA 1OGYA 3DBVO 4FYWA 1S2GA 2P6NA 2XWPA 4N82A 1Q1QA 1XVAA 4IWNA 5EVCA 1ZVQA 2VQFB 3G8AA 1Q1BA 3QVKA 4QHSA 4F5DA 3E18A 4NONA 3BG5A 4P80A 4XGRA 5BVHB 4Q4JB 1D0IA 1F7UA 3FZQA 2VH5R 3M8KA 5FORA 5TS3A 1OPRA 3SZ3A 5JNSA 4PV7A 5HUQA 2CLCX 3RTCA 4B3XA 4ES6A 1DAHA 4AO6A 1MB4A 2EBHX 2EL9A 4PCAA 1RFHA 4C4AA 1ISGA 1ZLYA 1FFXB 4G37A 3UA4A 1XDWA 1VZ2A 1ZJYA 1A2BA 1DTSA 1W5AA 3KB6A 4QHTA 1NUSA 3KJHA 4MYTA 4R1PA 2Z8XA 5E0KB 1NNI1 3UHFA 3DMNA 5IAJA 1LPMA 3DXZA 1XRQA 3K1TA 4UM9B 2CVZA 1PNOA 1UFRA 5DULA 3UK2A 2NV6A 1SN7A 2XUIA 1Z29A 2Q1SA 2A67A 3EWSA 2QAIA 2QTVA 3M9XA 4R5HA 4FE3A 5FD8A 1N0UA 1I01A 1M6VB 2OGZA 1UAYA 1BQ4A 1ULSA 4MYHA 4PO9A 1ZJWA 1V6CA 2VPQA 5ITZA 1ZN7A 2UUBB 5DI3B 4PG8A 5JHWC 2FF7A 1JE1A 1OX4A 1XT6A 1YQXA 4L4ZA 3WHIA 4E21A 1BD3A 5T8KC 2YKGA 1KK0A 2ZKIA 3IEMA 1YAHA 5AHRA 1TUSA 3F9IA 1CFJA 3BJMA 4XLZA 1WSBA 5JRJA 4FNOA 1MA0A 3E7PA 1GITA 2DE0X 3L0PA 4NV0A 2RBEA 3ZD8A 5B30A 3OJCA 1JTEA 4WMLA 3DTVB 1J1ZA 2EF0A 4W8OA 3T3IA 4RJTA 2EQBA 2FUKA 5AVWA 1XVLA 1SU4A 2HWYA 1ZOSA 2FZVA 1E79D 4EDHA 4B4UA 2B69A 1HRDA 1KZ6A 1W87A 2GSDA 2PSDA 1BMDA 1C1DB 2ZI4A 1YBMA 3HLTA 3R0VA 4L57A 2FX5A 3TJQA 3I72A 3AUTA 2JLXA 2XT6A 3CLUC 6PFKA 1CB7A 1MC8A 2XCSB 3AEZA 2HA0A 4ZRNA 2NSJA 1Y8QA 2NZ2A 3HG7A 3ZHUA 3ZU6A 3JSAA 4F6LA 2Q41A 2A9QA 5A5DA 3H05A 1WVMA 1RMYA 3VGPA 4JI2B 1CFZA 3DVQX 3G9TA 4MUGA 3TMKA 2YHAA 1YZGA 5DGXA 2OFPA 2P4EA 3ECAA 4XFJA 2E48A 2GAAA 1DJNA 1GU1A 3EZ2A 3GRUA 1GWNA 4KAAA 3ET4A 3P4UA 4GR5A 4QX6A 1MFPA 2CMFA 3KQWA 1NULA 5IM5A 5F3WB 2ZVQX 3NVDA 4O02B 3W5CA 3SWWA 1XZGA 1Y3IA 1JFSA 3U9SA 3KFLA 4ARZB 1QU3A 4KG7A 1T9HA 3FWKA 4CMGA 4G9BA 3V4SA 2EBWA 4DJAA 5DTIA 4A0HA 2JNWA 4UUAA 2AZDA 2R5FA 3C1UA 2B94A 4A2QA 2RAVA 1H1TA 3T12A 2Q5JA 2AE1A 1Z2DA 3FPGA 3HYSA 5KNDA 4KPYA 1IY6A 1F8YA 4R6WA 3T34A 5EZ5A 3CLRD 4TXNA 1EMDA 1F8FA 2NO9A 1HUQA 2P75A 3IT2A 3RTGA 1NJ1A 2JLSA 3U7QB 4GI3C 1IN4A 2C4UA 5ALSA 1A3CA 1PJUA 3T9BA 3B7WA 3LUJA 2P1DA 3U4IA 1CULC 1ZHFA 3HACA 1NRXA 2HF8A 4M89A 4QUHA 4EVSA 3JW8A 1XBTA 4BIIA 1V1RB 4PSUA 1BFKA 2X19A 3I2FA 1UM9B 3K0FB 3E7FA 1XQWA 1P3DA 3BB1A 4LXHA 1NJSA 3AR6A 3EMKA 1L3CA 5GVSA 4R2WA 1MT3A 2IUEA 4JU9A 4ZZ0A 3MTIA 5IYZF 3WK9A 1KK3A 2JFNA 2ESRA 3I2YX 4CTNA 4DXHA 2JLWA 1Y1PA 2XV1A 3PDCA 4KGXA 1VI6A 4MA0A 4WXPA 1KJNA 2I54A 4F3YA 2PANA 6GPBA 5IZ4A 2C9CA 2G4LA 3AYZB 4MQ6A 4F6RA 2IHJA 2EYUA 2OHFA 3SSMA 4BJ3A 2YHBA 1YHNA 3L49A 1A8SA 2AFHB 2VLIA 3MC1A 1CY0A 4QUKA 1I5OA 4EFKA 2Q5HA 4M36A 3BFVA 1G3UA 1L4UA 4Q7EA 2GHQA 2Z2JA 4Q1AA 3Q4GA 5ELMA 2FMXA 4SGBI 1PNQA 4IUDS 4JXJA 2FPMA 4HVTA 4LNUA 3ICPA 4QO7A 2EATA 3L7BA 1MXHA 3NNNA 1UDXA 1XFDA 4M0EA 1DKOA 1VE1A 5I7RA 5FTWA 3MT9A 3FYUB 3F96A 2MIIA 4IOKA 2XQIA 3K0AA 3ZVKA 3MQFA 4IIJA 2P27A 4C4TA 5BSHA 1MORA 2J5RA 1VHTA 1NKVA 3HI4A 1IBLB 3PC3A 4WKNA 3FWPA 4CT4B 1NMYA 2V9ZA 2F1RA 1WB5A 2GYVA 1WPRA 3HZRA 3OC0A 4Q9AA 3KVVA 2C57A 2CNDA 3R44A 3ROTA 2B1RA 1M1UA 1XRSB 4EHHA 3WV5A 4R16A 4P4LA 1ZCZA 4YQZA 1ZN2A 4HSEA 5ER6A 3ZQUA 2Y9MB 2AX3A 1EQ2A 9GPBA 4RTPA 3Q15C 5LP6C 4LFBB 5LBTA 4N7RA 4ENTA 2BGTA 3W8DA 3PRHA 3QX7A 4HQRA 1T8WA 5JNWA 2QGNA 4AG5A 4KTTE 5G4LA 4EO9A 1GA4A 5E3PA 1G5TA 1LNSA 3TLJA 4DWVA 2JGDA 1H2ZA 4CU2A 1Y9ZA 3H9UA 4JL8A 2XMCA 1Y89A 3VJLA 1O3YA 1KI6A 2QTCA 3A7DA 2PWPA 2VQ6A 2YXDA 3G17A 1XQXA 1UT6A 3H1GA 1N57A 4HDSB 1U3WA 5IN5A 1T8YA 5SY6A 1E7MA 3OF3A 3IDFA 3NP9A 1GADO 3TAXA 2QKYA 4CM7A 1HNXB 3AFOA 4JASB 4MPIA 1IJBA 4MUIA 5BORA 3DOHA 4IIDA 1T2DA 1F4VA 1R37A 1RLMA 4YLEA 1Q74A 4JT9A 5A03A 1B0PA 1GPDG 3PD0A 1EVIA 5JFGA 4Z3OA 2YRXA 1IB6A 1JHRA 3B1WA 3QX3A 2ZUEA 1POXA 2WWHA 3ESZA 1GZ5A 1TUBB 1RI4A 1MTOA 1RJWA 1E1QD 1FUKA 2C4VA 2G4CA 1Z82A 1LK5A 4PRZA 5IUJC 4I1YA 3P9CA 2CC2A 1O0CA 3W1VA 3LC0A 2GJ4A 3KSAC 1ZM4A 3GFGA 3DOJA 1K97A 1KPIA 3H1TA 4IH1A 2HW8A 3QPDA 2GJKA 4PC7A 1E2HA 1LR7A 1RSZA 1SK8A 4P4SA 5C1IA 1N13A 2JVIA 4J3FA 1E7SA 3NANA 3WMRA 4AD8A 1F1JA 3E3OA 4IZHA 2GS9A 1RP1A 3CEAA 3LDFA 4LCJA 1PG5A 1NMQA 3AI7A 4PZ0A 3R9XB 3VR6A 3KLNA 3SICE 3WQHA 2RGNC 3WIEA 4C87A 2EZ4A 3FF1A 1ESMA 3DQPA 3HR8A 4FHFA 2G88A 4UHFA 1FBNA 1ZM2A 4IV5A 2NTJA 3IVCA 1MGPA 1NN5A 2IA5A 3SQLA 3DOCA 3LT0A 2C2OA 4KXFB 1I3CA 1P19A 2P0AA 5E6RA 5GVRA 3TFOA 1ML3A 3OJEA 2OCKA 3ND8A 1XEAA 3LRTA 4B8YA 5ADWA 2WFAA 4DCOA 4DVJA 2JBWA 3UAOA 1MC5A 4AMUA 1RABA 2F3CI 4B6RA 1DJPA 3S8MA 1U9CA 3N2YA 3ZI4A 4CKEB 1W36B 1OY1A 4WI1A 3VJMA 3THWB 3H5NA 2Q3FA 3PKIA 3ZJVA 1QZ3A 2FWRA 3KKZA 1SBHA 2YXNA 4MVYA 4Y2TA 3UEOA 5A02A 2HHAA 3KM0A 5HXAA 3GFBA 1UDWA 4LF9B 2PQ2A 1MQSA 4G5HA 3SFTA 4D8TA 2QMHA 4NARA 2GHRA 2QLLA 4BPBA 1RXEA 3NHWA 3DVAB 2GUGA 1Z4QA 2H2AA 4MWTA 3TXAA 1W8DA 3E4CA 1YVRA 3FDIA 1SCNE 2PXCA 4UTRA 1VBNA 1Z68A 1MX3A 1CLUA 2TMKA 1PL6A 4GMDA 3C3PA 4YUAA 3ZDCA 3KQMA 3AZPA 4AJLA 5ERGB 2F9FA 1USIA 2OBMA 4PRLA 4LN1A 3TQFA 4BGUA 2YWGA 1VE5A 1MA3A 2HV9A 1FJHA 1VP9A 4GE0A 1NW8A 4XKJA 2HEIA 4PTYA 2YQZA 3QYFA 1DU4A 1JQ3A 1IXSB 2DHDA 1FXWF 1OWNA 1E2NA 1HK7A 3IHWA 4UTZA 5GOTA 3T95A 3WLLA 5CLFA 5AYVA 1Z4JA 8MHTA 4HUQA 4MZDA 2VPYA 1VG1A 4M1EA 3FTFA 4FOSA 3EIWA 3LXMA 3DWIA 2D3TA 2WF7A 4GD3Q 3H9BA 3ISJA 5AJVB 4BWVA 4GBED 4B83A 5JNRA 2FMKA 1Q5PA 1RJGA 1UODA 2C5FA 2OK7A 4W1PA 4EUKA 3HWWA 1U8AA 2WD8A 3MB5A 4CR8A 3IGFA 1RRKA 4GLFA 4HLQB 5JJKA 4BASA 3AW9A 3VOSA 3AR3A 3PZRA 2P0YA 1YB2A 1QP0A 3ZX5A 1NN0A 4Y2SA 2I3ZA 3N86A 4D8WA 4QFBA 4LZZA 1SGQI 3GFFA 3R40A 3SFZA 3K4QA 5JDCA 1Y8RB 4G24A 5M2QA 1J09A 2DG2A 2ISSD 2QT0A 1ZL2A 4JZKA 3DKVA 1DIGA 1CT9A 2EGGA 2FPPA 2WIDA 1EXWA 3FPJA 5CMLA 4ZEXA 4BATA 5JY1A 3J80A 3UATA 5AUOB 3TG8A 1YB1A 1FPQA 2HUPA 2HOQA 3IDQA 5FHQA 3WBFA 4ZDIA 5C53B 1YA6A 4WLOA 5SYNA 3E82A 2R62A 4RMHA 4NFHA 1QFXA 3TFQA 1BDMA 2AG0A 1JQLB 4RF5A 4NCHA 1QUEA 2Z2ZA 3AR4A 3MS2A 1F6BA 4HSGA 1YI0A 2BISA 3GG9A 4KOAA 4F8JA 4OK3A 1NPDA 2I8AA 1Z25A 1V9LA 5A1JA 1SVOA 2W48A 4MUYA 1QHSA 1DX9A 3IPXA 1EFAA 1UJBA 3SSNA 4WPGA 4QQFA 2A1IA 1NOKA 1CQJB 3GOQA 1D2RA 3LUDA 4L3WA 5GWXA 3DB1A 1KDRA 2V97A 3QLUC 1YHZA 4JLDA 4LDRA 4OA8A 1OBOA 1XLTC 2HPVA 1WXXA 2VT6A 4NAHA 5NLLA 3C85A 5BW5A 4D98A 5H8WA 1O0SA 3GLHB 2NU0I 3D3KA 5ICMA 3MMXA 1XPUA 1MEOA 2P1RA 3GNLA 3VPDA 5KOJB 1EP9A 1P18A 2C9DA 3PDNA 2WUDA 3M6AA 3COYA 3PF8A 2ZYAA 3A9RA 4M7RA 4BLWA 4YAGA 5IJ9B 1DRWA 2W93A 3GLSA 4MW4A 4UHJA 3K20A 5IBCA 2D0PB 4QEKA 5C2JB 1DKRA 4BZXA 2SCUB 2OP1A 4UFPA 2JRLA 5CCMA 1UC8A 5J1SB 4O0MA 1QYVA 4XJTA 4NF2A 1V7PC 2RK6A 5HG0A 1I6KA 2GPYA 4KO1S 2WJ4A 3K0EA 4A10A 2HIAA 2MTBA 4URZR 4E5PA 3EZYA 4YYZA 1UHAA 3ZTYA 1K6MA 3GWGA 4LV5B 2X0NA 2DYKA 5CA1F 3KOZA 4GC9A 2B78A 3IE1A 3BWVA 4ZCMA 9ATCA 2RGRA 1UBHS 1UBOS 2PMKA 3ABOB 1PGNA 1QH1B 2YHIA 1EFUA 3FDXA 1WPQA 4K8RB 3K9FC 1XWWA 3L6BA 3QNWA 1H8ED 4DIDA 4TX1A 3V34A 3CVVA 1Y9AA 4QPCA 4JI5B 3EVZA 2RHWA 3PE3A 3I37X 5AUQA 5D2CA 1KYWA 4CTKA 1H9CA 3WRXC 2Y67A 3N59A 4MGZR 2GK4A 5HS4A 4N0MA 4OBXA 3QU4A 2OB1A 1N1MA 5LQSA 1DLIA 1JAXA 1RQRA 1SKYB 2P2CA 2XUZA 1X77A 2BZGA 2Q07A 3D6UA 1SUFA 4DANA 3RADC 5JLAA 2IU6A 2XVAA 4D0NA 3NASA 5KTYA 3E7DA 4MLZA 3MERA 3IQGX 1JNXX 3E9ZA 1UP6A 1P2DA 1AQNA 3D2LA 1N78A 3TKYA 5DNVA 2YN2A 5HOEA 2ZRAA 3GUZA 1NBWB 4ZDKA 1RBZA 3UG6A 1FARA 4QOSA 1AF7A 2O8CA 2AOUA 1PEAA 5IABA 1DIRA 1TEVA 2BLNA 3H6GA 3BL5A 3R5TA 4JHLA 3MNFA 3WGVA 3DFMA 4MR8B 2A1TS 4OXIA 2G28A 2HTFA 3FOBA 4LSZA 4I0WB 3VR2A 2LDXA 2JFYA 4H6VA 4A1OA 3BMCA 1AS0A 3F6CA 2W6MA 2LCFA 2G06A 4V0SA 3UH0A 3LRXA 4I4NA 3NGXA 5JMTA 5LD2C 4PANA 4CGZA 2PZBA 4MLCA 1T24A 3RJTA 1EB8A 4DSAA 4GVXA 3FPEA 1EEHA 2NTNA 5FWXB 2Y76A 4EY3A 1N2BA 4HAUA 4DABA 2AMJA 3ZVRA 2BGNA 3OQMA 5B7GA 1CTQA 4H7IA 5K8CA 4KXNA 1Z73A 5KJ6A 2E1PA 2AF4C 1CY7A 1LC0A 3MLAA 2XMBA 4UBOA 1SKYE 3QA3E 1CZNA 2JPDA 3TLYA 2G3YA 3S2IA 1ZKMA 2COUA 3NDRA 4F84A 2PT9A 1SQSA 5EXSA 2XIJA 1Y80A 3LAWA 3OCXA 4TRJA 4WUTA 3SCZA 3RR2A 3HKCA 5AKYA 3JQ9A 3RVLA 2XUFA 1Y1TA 5B5SA 1V1JA 2PKWA 3FD8A 3OWHA 4KNYA 1OX5A 4KAXA 1B15A 3A2MA 4RANA 1L7BA 2QMEA 1EVEA 3JY6A 2ZJZA 1RKUA 1T2UA 2OC9A 2TRSB 4HLDA 1QQ5A 1VCHA 4PLFA 5KVQA 2XEDA 3DL7A 1TJPB 3I1JA 4RE5A 3K9LA 4NBVA 2I2FA 4L0MA 4AKGA 1SGDI 1U7ZA 2XGGA 1FYXA 1GVNB 3BGIA 4G81A 3AEKA 3ADOA 3K0KA 3H3XA 5HMMA 3ZX4A 5BR1A 1ONPA 2A1UA 2E55A 3A6HA 4H6XA 1BVHA 1L9XA 2GTPA 2PS0A 2XNHA 5CFMA 3SHTA 1QX3A 4FFVA 3RVKA 3S5JA 1G8MA 2XBMA 5EJFA 3SJCA 1KBZA 3PL1A 2GKTI 2AEJA 4N0PA 3F5DA 4RMNA 5FBQB 2RARA 3D8HA 3MOIA 1Y48E 4OSEA 3W8EA 2W8BA 3TF5A 3HY3A 3OCZA 2O19A 1RBMA 3C6QA 1L5WA 2JZNA 4HJXA 3COSA 2QT9A 5LZ7A 1CNMA 1G41A 5DX0A 3PWTA 5FNVB 2X3FA 1PVDA 3LUAA 3TKLA 1ZBQA 3OZCA 5SZJA 3CVUA 1J9GA 2D0IA 2QTRA 1PLKA 3QXCA 5B58C 1DUVG 1PL7A 2QTFA 2P6MA 3ZWNA 4AMVA 1OKKA 2QG4A 1KMHA 2X3UA 4O4IA 2O8VA 2BFEB 1U2DC 4ZOEA 2LP4Y 3I2KA 4ZHQF 1WGCA 5CA0F 5HF6A 2CWGA 1PWEA 2A4KA 2BPOA 2QL6A 3ENWA 4HH4A 4RVUA 1CIPA 4C30A 2BEUA 4FFRA 4WD3A 1GTMA 2XB9A 2GEVA 2IHNA 3C14C 4ARSA 5BV2P 3ZGOA 3M49A 2JIZD 5ARDA 2N1BA 1LBSA 4X8OA 1Z3IX 3MSCA 4TWAA 5EP2A 3ZLTA 1DMRA 4HZIA 4UDOA 1Z2OX 2A0UA 3FB1A 2G63A 5L3ZA 4MW6A 1Z6TA 2WG0A 2I6XA 3M6FA 4KC0A 4RHTA 1W25A 2NU9A 3NEJA 2BFBA 2QUHA 4G5SA 1ZNQO 4KB5A 3AHIA 2WVGA 3VZBA 3KV1A 4HNUA 1UBTS 2RAFA 3EIFA 3FPAA 1CW2B 4PLHA 4XWTA 3DP9A 1TAUA 5LLSA 3FHLA 3MQ2A 3IA2A 1YULA 3SSOA 5TQ2B 2QW0X 3GJZA 5K6AA 1N2HA 4PWZA 3WGJA 5JJLA 3HHPA 3I01M 1W93A 4UAVA 5HQTA 4B3DA 1IQUA 1I24A 4RM3A 4XWWA 4D6YA 2XMQA 3KX2A 2C3YA 5EWLB 5HILA 1WXQA 3ITNA 4I50B 2W7TA 3RIYA 2CDBA 4ID3A 1TF5A 2GK7A 1LQUA 2ON6A 4MCIA 3E9EA 2XCOA 1KOLA 3FOWA 3ITEA 4BFSA 3MMNA 5LOVF 4QHYA 5E2BA 1VKHA 2XCRB 3F78A 3T5CA 3TG2A 5C9ZA 2QX9A 2KMRA 4ZC1A 2IS1A 1G16A 4M7WA 2HBYA 4W9NC 5ICSA 2JBHA 3WBJA 1L7MA 1BQEA 3OM9A 1T36B 1G5IA 1IJKA 4P3YA 5LDHA 4P0TA 2ZIXB 3R24A 4MQMA 4PS1A 2CV1A 5LYJB 5FQNA 4PCUA 4I55B 2ZRMA 3MW8A 1JAHA 5EEGA 2V7TA 4GPEA 3SVLA 3FZEA 3M0EA 3DOOA 3H5IA 1AB5A 4LRTB 5LYJF 4LA4A 2WT8A 3ORFA 3KR9A 1SCKA 1YR1A 2DFPA 1VLMA 5BSMA 3L4BC 1OLUB 4AM8A 4AROA 1QOZA 1ZKDA 3PKZA 1DEOA 1I94B 2PBFA 4DJDC 3CU5A 2X8JB 5HR5A 4BX2A 4O59O 4ZQBA 2AJDA 1L1EA 5C1OA 2QZ9A 1H0RA 4K05A 2N3ZA 1W96A 1HFJA 3X2FA 2HWUA 3OTIA 3SKYA 4HGNA 4ZQHA 1UKVY 4L76A 1AN1I 1BIFA 3KETA 1EDOA 3UJ7A 4O4LB 2BTOA 2RI6A 3FCXA 4MI9A 2TSYB 1XNQB 1E5XA 1GXSA 2NO6A 3LBYA 2JLAA 3D7SA 4P2BA 2R97A 3OBBA 3UVEA 1VCIA 1L5HA 2OBNA 2WAAA 4L9MA 1W2WB 4HWSA 4MR7B 5C5DA 5K99A 4W9MC 5FOUA 4UOEA 4XDGA 2AOWA 1S9DA 1HFKA 4HWTA 1H22A 1IHUA 1JI0A 1TYZA 3BCHA 1P7CA 3FOCA 4LHYA 5IBQA 1ZAYA 4PYMA 4L9AA 3OKCA 1BE0A 4F91B 5D85A 3STVA 2WJGA 4BB9A 2FRDC 1NY5A 3OU2A 2JIQA 1IN5A 1PFGA 2J09A 3HL4A 3G82C 3R1IA 3TB6A 1HT2E 1Z4PX 3MTAA 4KVZA 3CFYA 1NVFA 4N0QA 4NY1A 1BKSB 3O4RA 5HM6A 4BKQA 5KINB 1FMCA 5KTSA 3DBLA 4WXYB 3AG5A 4XR4A 4G0PA 2QP3A 4EFNA 2HJRA 4ZT7A 1RJ9B 4D9IA 3JQDA 3IR5A 5HGXA 3DHVA 2W6NA 3I05A 1YZYA 5HKAA 4XZ3A 4B47A 4B8WA 4FINA 2HSWA 4Z9FA 1QIFA 1AA6A 2DFDA 2F2TA 1ODJA 2ZSAA 5IT4A 1U8CB 2EGUA 3QF4A 3GZNA 1X15A 3KHTA 3TQIA 4ZJYA 3KHSA 3O5AA 1NQOA 3SHWA 4ASUD 2MSWA 1ZK4A 2C78A 3AFMA 3FTQA 3OPYB 4YBZA 3WYEA 4BMDA 3COVA 3NKLA 3A3NA 1CUVA 3VDRA 1IULA 1A9QA 1O6GA 2WKPA 1FP6A 2VXOA 2WD7A 3OLCX 5E6SB 4CM4B 5ESDA 2TECE 3L7KA 3LCCA 2HCRA 2QRKA 3PDHA 4JCCA