2ORWA

Thermotoga maritima thymidine kinase 1 like enzyme in complex with tp4a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
171
Chain Sequence
SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKHSTMIVSGVEAHVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEIDVGGQEKYIAVCRDCYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidine kinase
publication title Binding of ATP to TK1-like Enzymes Is Associated with a Conformational Change in the Quaternary Structure.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 55
structure length 171
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2orwA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2orwA01
4M21A 1W0JD 4XD7D 3SR0A 2PJZA 3HU1A 4C2UA 4M9XA 1S2MA 3IBGA 4A2QA 2D4HA 3I61A 2HF9A 1Q0UA 3RS7A 4XOIA 3TNFA 2CVFA 1G291 3UG7A 3T06B 1ESMA 3NH9A 5FBVB 4D0NA 2QPTA 4M9QA 2WJYA 2FSIA 1KBFA 4HAZA 2VYFA 3LLMA 4V0ME 5IDVA 3K9GA 3MJHA 4JT2A 4ACAA 1IN8A 4KVGA 3FFAA 2KSQA 3MGCA 5GJBA 2WJJA 1SXJB 1UDWA 3L0PA 4DBLC 4LJ6A 4NBSA 3WMEA 2FFBA 2W83A 5CYPA 3W6OA 5JJIA 3EASA 4JS0A 4P4SB 2LKCA 4BLOA 4PQYA 2DWOA 2WVJA 3D7MA 5FOVA 5FUYA 3CNLA 4DC9A 2XZOA 1WB9A 3A1UA 4XTCS 2NG1A 3SQXA 1UEJA 1MABB 2QL6A 4EJSC 1FOEB 2C2HA 4A9AA 2LCFA 3ZYCA 2AD1A 1NSTA 3X1YA 1W4BA 3RWMB 1E4VA 1G3QA 1CS4C 2DWQA 3EXAA 4LY6A 1TU4A 5JJLA 1R6BX 1W1WA 4EKDA 2YUUA 1YZKA 4NYMQ 1OH8A 1W49A 1S4QA 4PHTA 2OUKA 4ZDIA 1YZNA 3CUEF 3KXKA 4FMCB 4LX0A 4BUJA 3K70B 4QBIA 1UJ2A 3UIEA 2A7QA 4CEJA 4UNQA 4ZPXA 5IT5A 2WJGA 2ZUCA 2N1BA 3LX8A 1XZQA 2WOJA 1G7RA 1FNMA 2HXYA 1K8RA 5KDLA 4B48A 2ZJ8A 5JRJA 1EXMA 3MWYW 5FI1B 5TY0A 3P4XA 4RZ3A 1ZD1A 2ECKA 1E2QA 4ABYA 4X8LA 1E96A 1XEWX 1TF2A 5GVRA 2H1LA 2ZREA 3NDBB 2JIZD 4C2TA 2OCAA 3GJ5A 5B57C 3SQWA 2C96A 4M4SA 1VHTA 1OFTA 1R10A 1FP6A 3CF6R 4WOPA 2J87A 2B21A 2BM0A 4HAYA 1OHHA 1NY5A 3K09A 4P4UA 5DSZA 1QG4A 5FTMA 2V1UA 4M9SA 2ZRPA 5SZIA 4EPWA 4YXWA 3CWZA 4M1MA 4G5QA 5B58C 2D62A 2Z43A 2F1IA 3B13B 2ZU0C 5KSYA 1Q12A 4RFVA 4I4LA 3O8BA 2GEUA 5BN3A 4QL3A 1AKEA 2DHRA 4FMDF 3TUIC 1IJEA 2RMKA 5B30A 1DS6A 4IDHA 3BFKA 2F3TA 5E7MA 1P2UA 1VIAA 4U7DA 1CJUC 3GLFE 1NBME 4LUCA 3FGNA 2CMKA 1FZQA 1KJYA 4ZDJA 4Q4HB 4F92B 1OXSC 4B3BA 1GRQA 2Q3HA 3LVQE 3AGQA 1P9RA 2I1QA 2ZPTX 4S2EA 4D81A 3GLGB 1KHTA 3GPLA 3DMNA 3BB4A 5JBQA 1YZQA 4HDOB 3T1OA 3T35A 5EE3A 1SVMA 1G3IA 1ZM7A 4PQRA 4DDUA 2FFAA 4HZIA 2D7DA 3HR8A 2YOGA 1R5NA 2QRZA 2HLDA 3NEJA 4A0RA 1FP7A 1J8YF 1FMLA 1JEEA 3SU8A 3K70C 4ZKDA 4LBWA 2RGNC 1U0JA 5HCIA 1JEDA 3C7KA 4DUGD 2VHJA 1XD2B 4KYUA 4OKSA 3LXRA 1R0YA 3EA5A 2EFDB 4WXRA 3VR4A 4XVRA 1W46A 3ZVNA 5G41A 1M7BA 1E0KA 2BEKA 1S1MA 2D2FA 2DPXA 2GDJA 3IEUA 3BIFA 3MWJA 3NBYC 3AF1A 1NP6A 3HU3A 2ZIAA 2HV8A 2ZE5A 2ODBA 2ZAOA 5EXXA 1FL9A 1QHSA 4TYQA 2IF2A 1AQYA 1OW3B 1AZTA 4RFSA 1PV4A 1T6NA 2XXAB 2JJ1D 2XJ4A 3E1SA 4FWTA 4TYWA 4M0LA 4GOXA 2XOKD 4HLQB 2GCPA 3GEIA 1VG0B 4E03A 4IJMA 4RZUA 4WW0A 4TMTA 3T61A 3VX4A 5H8WA 1XA6A 5EE9A 3VKWA 2EFHB 4O3MA 2QI9C 3DM9B 2RGGA 1EWRA 2GXQA 1RRGA 1Z2CA 1N2CE 4FXPA 2EU8A 4DSNA 4NCHA 2WTUA 3PENA 4KAXA 4TMVA 2V8OA 3NKVA 4BFTA 1OJLA 2ZI9A 3IBYA 3U3OA 1OIXA 5J4VA 1NI3A 3KQUA 2C03A 3K1JA 3ZZUA 1VTKA 3CF2A 1ZUIA 3L2OB 2NO7A 5A5GA 4PO8A 3C16C 3EPHA 1GVNB 2ZVQX 4MRVA 1KO1A 1RFHA 1TBOA 4F4CA 2Q9BA 3DKVA 1CRQA 5DI9A 3GFOA 3CRW1 2O8DA 4R9UC 2BMFA 4OI2A 1OYWA 3TVDA 1BKDR 2NO0A 4DEXA 5FL7D 4LI0A 5L3QA 2CLCX 2XTZA 3KTAB 5F3WB 3THYB 2FFQA 3KB1A 4I99A 4LRWA 5EE5B 4LHVA 2R6CA 1H65A 1R79A 1T9HA 1ELOA 1W4AA 2C9CA 3K9HA 2ZS8A 1J2JA 1II0A 1TF7A 4ASUA 1RVDA 1E6CA 4IHQA 3FPAA 3N2EA 3REFA 1NMZA 2ZSAA 1M6NA 1Z2AA 3QY0A 3PUXA 4DCSA 1YZUA 1KK2A 1G7SA 3U7GA 1GZSA 1X1RA 5DE3A 3BK7A 1OYYA 1KY3A 1ETUA 3JZAA 4JBWA 4ERNA 2CE2X 3GJ6A 1KI8A 2ATXA 2ZI6A 1VDZA 5LBIA 2XNDA 1SZPA 4LJYA 1C4OA 4D4LA 4XWOA 4E22A 4HB0A 4IVQA 1RIFA 1E2FA 2RAPA 1DG3A 2RGCA 1W4RA 2ZJOA 1XEXA 2IUTA 1XTQA 4W5JA 1OH7A 4N0DA 1FFHA 1XXHA 4NYIR 3HDTA 1U0HC 4LYAA 4KITB 2NMVA 4RCZA 1A2BA 3LVRE 2A3RA 2ZSBA 3K0AA 4AD8A 4B6EA 2G77B 2GJ8A 1ZUHA 2ZRCA 1KTVA 2VRWB 2OE2A 2JLRA 1YZLA 4LHYA 4MYHA 3ZH9B 1KI1A 3RS3A 3WBKA 3GLFB 1R5OA 4JSYA 4BLRA 4DCVA 4GRAA 2W6JD 1ESNA 2QP9X 2JGNA 1OV4A 2FOLA 2QROA 4NE2A 3PV0A 1AJEA 3THXA 5J4HA 1KO5A 3FWYA 3UEJA 1X6VA 2F1RA 1E9CA 2QGZA 2R6DA 1NKTA 3W6PA 3AKEA 3TJZA 4PC3A 1MKYA 3RRNA 5FTJA 2HEIA 5GVSA 2CJWA 3FKSA 1NF3A 3DKPA 2GXSA 5E7JA 4GI7A 5SZHB 3H2YA 4MUBA 1X86B 2OV2A 3P20A 3UMSA 1XF9A 5KHOC 1XD8A 4AK9A 3TSOA 1COWA 4FMBB 3T5GA 4C7OB 2IK8A 2HJVA 2UVQA 5C2JB 2YNMA 4FW9A 4DVGA 2CK3A 3CPJB 3V4RA 2JEOA 3CR7A 2IBMA 3OFND 4R98A 1QRAA 4BZQA 4D0LB 2FU5C 4GFDA 3B78A 5E95A 4B6DA 4L9SA 2W0MA 1KI6B 1YRAA 1IN7A 4TTQA 1U90A 1SKYE 4NH0A 5FOUA 3R8CA 3GJ0A 2AX4A 4OQXA 4LBZA 2DB6A 1IONA 1N6LA 5CDFE 1CP2A 2Z6VA 4NYIQ 2RH5A 1QHNA 1E98A 2CHGA 1FTSA 4PAMA 1BH2A 4BZXA 1QDEA 1G64A 2FPLA 5JCZA 1LFDB 3OEED 4KBFA 3RANA 2J41A 1SXJA 4WBSA 2FNFX 4HSEA 4RCYA 3B1YA 1BMFA 4AKEA 1J90A 2NTYC 2Z4RA 1IN4A 2ZE7A 2YJTD 4P4SA 1G5TA 4KLZA 3SDZA 1U8YA 3T1VA 1EESA 4CZ2A 2UKDA 5J4LA 4CF7A 2VHUA 5CYOA 1ZINA 4GOJA 4JBYA 4URVR 2ZRAA 3KJHA 4RKFA 5KSOA 1MABA 3CONA 3ZGXA 2ONKA 3VX3A 4ZIRB 1CR1A 3AUXA 4B6FA 1EFRA 3NIBA 1S9DA 4KSBA 1ZW6A 4BLTA 1G6OA 2FWRA 2VSXA 3AUYA 2QAGC 2QM7A 4KVAA 1CJTC 3T34A 3NH6A 4LV6A 3S1AB 1TF5A 4UNSA 3LD9A 1XJQA 3BJIC 1CJVC 4KSCA 4LCBA 1UADA 2X8AA 3I32A 2VPPA 2ZJZA 2ZRNA 4V0OA 1AQUA 2YHSA 2IS2A 3HU2A 2REOA 4JLOA 1SVLA 3I72A 4A15A 5BN5A 3CRMA 5CLLA 4W9MC 4HAXA 1DO2A 4HI0E 1W0KD 1YR6A 3TH5A 4C0QC 5HR5A 3PXGA 1QHYA 1TNDA 4RKEA 2B7CA 5JEDA 3EPKA 3P32A 4F38A 3AF4A 4ITRC 2EYQA 2YOFA 2JDIA 2V4ZA 4Q1EA 2R6GA 2XSZA 3IO3A 2FF7A 1ZNWA 3QBTA 4R2HA 5AJVB 4A0FA 3PEYA 1G18A 3X1DA 2FE4A 2ERXA 4A92A 4Q7KA 1JR3E 3PVSA 4LZZA 4YMTA 2IUSA 4AKHA 2KBEA 4PZLA 4Q4LA 5LD2B 2IS4A 2OCBA 1Q1ZA 4IOMA 1Z0DA 3BE4A 2F1HA 1KNQA 4Q9KA 3BS4A 1TQ4A 2C8VA 3GQBA 2QSYA 2YWEA 2ZYUX 2FSFA 1GAJA 3BB1A 5FUXA 3AF2A 1B23P 4G5OA 4OHYA 1KDOA 3A58B 3OEHA 4HAVA 3ADKA 3LV8A 2ZRBA 4M1SA 3BH7A 3IIMA 2J45A 2OFWA 3C4JA 2Z83A 1S0UA 2OLJA 4QHSA 3GD7A 5EP2A 4JZKA 4DLSA 4Q4HA 1ODFA 3BH0A 5BYKA 4Z1MA 3D3QA 2IA5A 2OM2A 3GLGA 4JBXA 1F2UB 2QP3A 3CIOA 5AUPB 1XTSA 2AXPA 4IDNA 2OBLA 2QORA 4UKDA 4DZZA 3QEJA 1P9NA 1KK3A 2JCSA 2FGKA 3BRWD 3CBQA 4TLEA 2ZUBA 3QVUA 3QG1A 4QBFA 3R7WA 4QJ3A 3E2IA 2BWJA 3IHWA 1P2SA 2X1VA 4Q47A 1QF9A 1R0WA 1M34E 4Q1CA 4JSTA 3ZIAA 3X1XA 4L15A 1XD2A 3AEZA 3K09C 4JLVA 5CITA 4LSGA 4LJ7A 4ZO4A 3EA0A 5FL3A 5HZHA 3NBXX 1QZXA 1VCNA 3O8RA 3IHLA 4JL8A 2YOHA 1VCMA 1WCV1 1XP8A 4CIDA 2ENZA 2ZRDA 1R0ZA 4V0NA 5EE1A 4LPSA 1E3MA 2CL0X 1XWIA 2WHXA 2OCPA 4U00A 2A2ZA 3K8YA 3FHTA 1XZPA 2FH5B 4M1OA 3CZPA 2XXAA 4L8GA 5IF9A 3QUSA 2JLUA 1SKYB 4B2IA 1AIPA 2GJ9A 1GNPA 3RHFA 2WWGA 3K9NA 1TBNA 4CEHB 3CM0A 2V9PA 1E1QA 3AP3A 1KYIA 4Q9JA 2IUUA 4PSVA 3QKSB 4PSAA 1OB2A 3FYHA 4G5SA 4BWYA 1GSIA 1KO4A 4GZLA 5EP4A 1KNXA 3FMPB 1DE0A 3VHLB 4ZCIA 1OXXK 2FZLA 3TW4A 1E2JA 4MYTA 4YC7A 3TSWA 2PT7A 3QEOA 1ONBA 4DCNA 4KV9A 4BEJA 2P6RA 2CXXA 3VHXA 4JMPA 4Q4AB 2QE7D 3B2EA 4NPHA 3WNBA 2ANCA 3ZVRA 5KUTA 1IY1A 1R2QA 5CK4A 1X1SA 1DAFA 4Q4JB 4IDOA 5JRZA 5KO2A 1UKVY 2MMGA 2Q3FA 4JVSB 3B5JA 3AKYA 4RD3A 2O8BB 1U9IC 1DARA 5B2ZA 2WV9A 1X8JA 1UM8A 1XEFA 1D6JA 3DDCA 3KTAA 3KKQA 1GRRA 5DISB 1LVGA 3KQHA 3THYA 4P0TA 1ZAKA 2AHOA 4LV8B 1E2KA 4ZCLA 4N0EA 2GAOA 3LY5A 2GK6A 2FPKA 2C99A 2WWXA 5BN4A 1N0UA 2GJKA 3NC1C 3OIUA 1E79D 2AL7A 1DPFA 2G0TA 2KE5A 4QNMA 1P2VA 4BFSA 3Q5EA 1GM5A 2REXB 5JJKA 2IC5A 3BGWA 3ICEA 1FMJA 5EE0A 2HYDA 3D31A 2ZRGA 2ENNA 2IL1A 2WSSA 1CRPA 1MO3A 1DAKA 3EZ6A 3AKCA 2OBNA 2IYXA 1XMIA 4OBEA 4II7A 1PUIA 5JS8A 5BYJA 2QM8A 3CNNA 4TLCA 3GLGE 2GJAA 4OYHA 4TMXA 2ORWA 3SHWA 1Z6GA 4JYCA 2WMOB 2CHVA 4FWIB 4WA7A 2V3CC 3ZJYA 3VMFA 4CEIB 2Q21A 4JLPA 1ZBDA 3AQ4A 1QVAA 4IW3B 1NJGA 3QQ5A 3ZQJA 1NSFA 5CIQA 3TVTA 2J9RA 1P72A 4D82A 4EUNA 621PA 1GFIA 2Q9CA 3EIQA 4JVMA 5J4KA 2J0UB 2VRWA 1KI3A 2XTMA 1IHUA 3GLFA 2W2XA 421PA 2ELIA 3RLFA 1K5GA 3ZD6A 2O0JA 1OFIA 1G7TA 1PLLA 1DEKA 2L0XA 2IWHA 4A2PA 4QM6A 1M8PA 5G3YA 1SKQA 1XNJA 1Q21A 3EWAA 3PUYA 4GOKA 2GAAA 1ZJ6A 1ZP6A 1YVDA 3F8TA 4Q21A 3N2IA 3PFIA 3GP8A 4XVUA 3RS5A 4EPXA 1ZCBA 2FSHA 3C8UA 4QRHA 4PO9A 3T5DA 5KYKA 1HTWA 2QAGA 1CKEA 1W4CA 1YZTA 4JLBA 2GCOB 2JJ2D 5A4JA 1JECA 3UGLA 1E2IA 1R8QA 1XD9A 4B3FX 4I1OA 3GFTA 2CK3D 3Q5DA 5AUOB 3BJIA 1F3OA 4YONB 3AF0A 4JLAA 1V5WA 4PX9A 4C7OA 2XZLA 1VMAA 2E73A 1NLYA 4MQBA 2R6FA 4B76A 1B0UA 3P26A 4IDQA 3SBDA 3KKPA 4YQFA 3BERA 3EAQA 5IK2A 2BMEA 5FBWB 5FUWA 1KI6A 4P32A 5UKDA 1D2MA 2ODWA 4EPTA 4US2R 1N5KA 5ELXA 2OEPA 3ZQ6A 4WZAE 1XU4A 3Q8XB 3CF0A 1XX6A 3ND9A 4A8JB 3BFXA 1P61B 5FBRB 2EFGA 3EC2A 3OIVA 1Z6YA 3CH5A 4NONA 5KTYA 2QN6A 3DL0A 2J0SA 5DN6A 1U81A 2ZVPX 4JLKA 4DDWA 4NL4H 1NG9A 4O2LA 5TARA 2A5JA 4Q1FA 5L3RA 2ZSDA 3WP0A 2H18A 2PH1A 4GSYA 4Q9LA 4WZBE 3WMFA 3CW2A 2HT1A 3K53A 3SJZA 1TPZA 2MSEB 1VG9B 3H1TA 2QTHA 2P5SA 4KFSA 4QGAA 2CBZA 2ZRKA 1AS2A 4DLRA 4AG6A 5GADl 3LO5A 3TBKA 1RW4A 2ROWA 3LH5A 1IXRC 3VKHA 1KSHA 3NBZC 4AKGA 3IGFA 3SJAA 3WYGA 1T5IA 4TLBA 4ZIRA 4DWJA 1PTQA 2N42A 3U7FB 2A5YB 1W44A 2F43B 4Q18A 1M7GA 2J0VA 3FOZA 4C0HA 3UATA 3K70D 4L9MA 3C41J 1Z8FA 4ARZB 3IPXA 4AWXA 2AFIE 2KB0A 5DYIA 3QXXA 3G0HA 3B6EA 4IRUB 3S1AA 3FMIA 4DSUA 4MGKR 1H8HD 2VBCA 3W9YA 4DT1B 1D8TA 4HB4A 1KDPA 1CR0A 1Z47A 1GILA 1K6MA 2WKRA 5HKKD 3I5XA 1DOAA 2R9VA 3A1TA 4Q1DA 4KI0A 1WF3A 1SXJC 2B92A 4IFBA 5J40A 2G88A 4RD1A 1W2GA 3THWB 4C0BA 1GL6A 3GEHA 4JVLA 3LW7A 4GMXA 4PPGA 4XTRA 2ZITA 3R9XA 5DIFA 5DI3A 1KI7A 4JKYA 4PC7A 4W5HA 2GA8A 4GDFA 3GLIE 2C95A 1N6OA 2IYTA 1W5SA 2V6JA 1ZM3A 3FE2A 2EFEB 5H70A 2Q6TA 2RKOA 2CNWA 2RGBA 1RKBA 4F4JA 1T3SA 3B1VA 1CR2A 3NTUA 4YDHB 4DRZA 1HV8A 2CCJA 3QSYA 2A5GA 4TTRA 3X1WA 5AJYA 1T3LA 3AV0B 2V7QA 1N6IA 2ZM5A 4TMZA 1E2MA 2J7PA 2JLQA 3NDPA 1VKJA 4K81B 4TSFD 5TDHA 4KODA 2H57A 3PITA 3TQFA 1VECA 4US1R 3C14C 4XJXA 2G1JA 3RS2A 3DVLA 4D0GA 3AVTA 2H5EA 2UZ3A 1F2UA 1G3UA 2Q0HA 1Z0IA 1OSNA 5GJVC 3QF4B 5LB4A 2BVNA 1HY3A 3AP2A 1G20E 2WICA 1E2LA 2REBA 4IVPA 2YC2C 2R8RA 2QP4A 2V54A 3KJEA 3GJXC 5BWMA 1J99A 2FDCA 1G17A 1U9IA 4G3XA 2YWGA 5CK5A 121PA 1PVOA 1G5PA 4LYFA 3FMOB 4TLAA 1RE0A 4WVFA 2ZJ2A 3QXCA 1S9HA 2WJVA 2IXEA 4R71A 2C78A 5IHPA 2AXNA 4B3XA 2JA1A 1NVVR 1YJ5A 2QQ0A 1AS3A 2AWNA 4TMWA 3AVPA 5FR1A 2BBWA 2BHRA 2GZAA 3B85A 3TUJC 3UXMA 2ZE8A 2AKAB 4G5RA 4P4TA 2O8FA 3UG6A 2A78A 2DYKA 1PTRA 2VP9A 4KBGA 1WP9A 3SFVA 1XPOA 4YMVA 3QG5A 1EX7A 1F60A 2KWIA 1XB2A 3RAPR 2DFKB 3OE7A 2OG2A 1WRBA 2QBYB 3W3ZB 1SGWA 3AF3A 2VF8A 3SYKA 4OI1A 3B60A 721PA 5KDOA 1KI2A 3H4MA 3MJRA 1WMSA 2RHDA 5CDFA 4CEHA 2AK3A 3CRQA 3RABA 4DKXA 2ASEA 2ZJBA 4HB3A 3QKSA 4U5XA 2BV3A 4UNPA 4BRWA 4OQMA 4LJ9A 5JHHB 3EZ7A 2EW1A 2VQSA 3BXZA 1E9EA 1IOZA 2QMEA 2O5VA 3EWSA 4OK5A 1ZUNB 4IOKA 1H8ED 3GFPA 4AIIA 2GF0A 2ZQ5A 4HUTA 3W6NA 4AI6A 4Q4AA 2E9SA 3UK6A 4C3ZA 2VP2A 3SJCA 3E5HA 5JS7A 1G8FA 3CR8A 4Q4JA 5F98A 2P0EA 1DTSA 5H1YA 4UNRA 8OHMA 1MV5A 4IEEA 2MSCB 4PHHA 4Y0VA 4Q9HA 2ZR9A 5FPYA 2O8BA 1E2GA 2A5FA 2PZEA 1NJFA 3TW8B 4FMCF 4CW7A 3ZS9A 4FI3C 2PZGA 2WPDD 3WHKA 3OAAA 1P4SA 2VO1A 1NVVQ 4D80A 1KMHA 4L9WA 3MSXA 3ZLJA 4EAQA 4TZ0A 1OKKD 3OESA 4ZKEA 1TQDA 4TT3A 1FUUA 2H92A 4MYUA 4EFNA 1V43A 1NKSA 3ADDA 4N1AA 1XMJA 1W36B 2WSSD 5EXTA 2WMNB 3Q72A 3H0KA 3W3AA 4JVNA 5JFGA 4FKDA 1UBFA 1Z08A 5H68A 4A2WA 5JI3E 3I8XA 4GMDA 1YE8A 5JWHA 4J0QA 3TE6A 4BQSA 4AY2A 1KAOA 5CJ2A 1T8UA 1II8B 1NMXA 2VHQA 3QPWA 2GBLC 3VTKA 1KIMA 3O47A 2CHQA 3GLIB 2W6IA 5G53C 2J3EA 1P5ZB 3V9PA 3X2SA 2GZDA 1AKYA 2YYZA 4Q02A 1JR3A 1M74A 1Q44A 4LYJA 1CEEA 4AKIA 4BE7B 1OXTA 2HF8A 3KL4A 5DNYB 3FVQA 3IILA 2ZI5A 3V00A 3MFYA 4MYCA 3WYAA 4CEIA 821PA 3TK1A 4DB2A 2RCNA 5EP3A 2WM9B 2FSGA 1NBMD 5JECA 3LW8A 3WRYC 4UJ5A 4EFMA 5JI2E 3BH6A 1R0XA 1UKYA 2J0UA 1YHNA 4EPRA 2WWIA 2QMHA 1E2HA 4RD4A 2FJUA 2QPAA 4Q9IA 1JAIA 5CLQA 2R2AA 2O0KA 4CT5A 4CRWB 3PCRB 4Q1AA 3QF7A 1VHLA 2Z5FA 2OAQ1 3IKJA 2VLIA 4QBHA 2RGAA 3TKLA 3U3RA 4DDVA 4FINA 2YINC 1Z0FA 3DOFA 1W0JA 4XD7A 1T4GA 1C1YA 2IYUA 4Y0AA 4AYXA 1D2NA 3BBPA 4HLUC 2GCOA 1SVSA 4QM7A 3MLEA 1TADA 1WXQA 1ZU4A 2Y8EA 1W36C 3LBHA 5AK0A 1OB5A 4AURA 5TB5A 1LY1A 3A4MA 2ANBA 2ZU6A 5IK2D 1P73A 4HZUB 4QOSA 2RB4A 3H86A 1P75A 3DHWC 4NZYA 2BC9A 2FEMA 2GESA 1XBTA 1JR6A 3QNUA 2G0NA 1T3HA 4I1VA 1G5RA 3FFBA 4LGMA 2ORVA 1EFHA 1FTNA 1Y63A 1Z07A 1KZGB 3BWDD 4BGDA 1UDXA 1VIYA 4XIGS 4I1UA 3KJGA 4LPKA 4Z8XA 5FI0B 5JWOA 5DN6D 1XTRA 2FA9A 3MMPA 5FPTA 1HQYE 4A8JA 1RFLA 4A1FA 3O8CA 2V6IA 3GJ3A 1Z6AA 4HDCA 5JSZB 2ZJYA 3KB2A 3P1JA 4LC1A 3WNCA 3PG5A 2IEYA 1NRJB 3AVVA 5FOTA 1KMQA 3ASYA 1E2NA 3TRFA 3U4QB 1XEWY 3B82A 2IEZA 1G4AE 1ZIOA 3VU9B 2C9YA 4M53A 4MGIR 1L4YA 4BLSA 4IKEA 1JALA 3BB3A 3LWNA 4TMKA 3Q7PA 4W5WA 1UBCA 2UZIR 3BFVA 2NZJA 1N6PA 1XCGB 4LJ5A 2F43A 1VCIA 4QHYA 3CWQA 4BFWA 4MRRA 2WWYA 1CULC 1DADA 2QQEA 2QMOA 4LV5B 4ARZA 1SHKA 2NGRA 5TVKA 3DMDA 1KDTA 1MRSA 3HR7A 1DVRA 1CJMA 1D9XA 1OHHD 1N3BA 2ZTSA 3C5CA 5FUVA 4I1SA 1ZD9A 1Z28A 2GTPA 1ZD8A 4DT1A 4O0MA 1LNZA 1E9SA 1SVWA 3K0CA 4YXWD 3UEYA 5AJWA 1ZRHA 4TLDA 4Z8YA 1BOFA 5SZKB 5SZJA 1VPLA 2LWIA 4GZMA 2F7SA 4ACBA 3UMRA 3THWA 4A4DA 1GRNA 2J59A 2QTFA 1Y3AA 3UGIA 3GJ8A 4GT1A 1ZVQA 5AR1A 5KPDA 2F9MA 1Q1QA 4OHXA 4Q19A 1G8PA 1GKIA 2BKUA 1NLFA 1Z6XA 4MRSA 1AZSC 4M1WA 1RRFA 1TTTA 3WMGA 2OXCA 2OSBA 4LDJA 1I4LD 2PX0A 5HE9A 2O52A 5KDDA 2K5UA 1XMVA 2ZRMA 4DLVA 2QAJA 3SE0A 5CB8A 1Q22A 3SZRA 2HLDD 3EPLA 3KKNA 1J70A 1FX0B 1I4TD 3BORA 3HJNA 1RRPA 3HWSA 4X8HA 3WYFA 1QHIA 3NVAA 1NN1A 1XDBA 5CIWA 5EUMA 3PUWA 4IOLA 4C9BA 3IQWA 3W34A 4QBGB 4XVQA 2A5DA 3BD9A 3DZDA 4IXMA 1AGPA 2P3SA 1OFHA 1A7JA 5EP1A 1EK0A 3P4YA 1XCMA 2BJVA 2PBRA 2YV5A 3RSLA 4DUGA 3ICQB 2O8CB 4BASA 1CXZA 3QF4A 1OH5A 1Z3IX 3RSOA 2ZJAA 3AM1A 4OJQA 1SULA 1F48A 4PPFA 4BPBA 4IDPA 3B9QA 5HCNA 3M6AA 4NP6A 1E4YA 3ZVLA 3LDAA 4D4JA 4BLQA 4Z51A 2O8EB 1NVXQ 2IYLD 3D6TB 2DFNA 2VP6A 2FX3A 4UXIA 2P6UA 3FKQA 1AS0A 3GLHE 1XJ0A 1OFUX 3M4YA 3MWKA 4QHTA 1M7HA 2PEYA 1P60A 2ZE6A 2GVDC 2E1RA 3EZFA 4URYR 2R44A 5DLQC 5LD2C 4G0NA 3TQCA 3KY9A 3QXJA 4JKIA 2D3WA 1ZCAA 1RC8A 2JJ1A 4V0LA 3W8RA 5FOSA 2IT1A 5F9FA 1GDDA 1Q57A 1EWQA 3SNHA 3NEYA 3FB4A 1UBGA 2P67A 3IO5A 2XOKA 4LHZA 3B9PA 3THOA 3U44B 1ZU5A 2ODNA 1KKMA 4GL2A 3KQKA 1W2HA 3LFUA 3CX7A 4F93B 1Y8FA 4KFUA 2C98A 4OK6A 4TYPA 5FOXA 1HE1C 5EXSA 3TAHA 4B2PA 4KYIB 4M1YA 4D2IA 5TV2A 5K8LA 3M1IA 5GJWC 2JJ8A 3CPEA 3HYRA 2A9KA 2GBLA 2QBYA 2WIBA 4C0AC 4OQFA 3QPUA 2JLVA 1T8TA 1E9RA 1G7CA 2HYIC 4MITA 1LS1A 1E0AA 3TUZC 5EZ5A 2VIIA 1E0SA 2IWRA 4B44A 3ZZTA 2JLXA 1RJ9B 1IN6A 5J4YA 1DAHA 4C0KA 3T15A 4M22A 2BCJQ 4PC2A 4TTPA 2IXGA 4YMSA 2WSMA 3LRPA 4ASUD 2RGEA 3VFDA 2PEZA 5AJXA 1US8B 5FL7A 3F0TA 2ZS9A 4JIMA 2I3BA 2IYVA 2NPIA 3MWLA 4M8NE 4DEYA 4QGHA 5F2EA 1G4UR 4QGGA 2IW3A 1L8QA 3Q3JB 3RVBA 4AG5A 3OIYA 2BEJA 2R6AA 2GK7A 3ADBA 4LHXA 1XPUA 1Q3HA 4EPVA 2AD5A 1MO6A 4MKHA 4OHZA 3TSZA 1BS1A 2FN4A 2P2LA 3GJ4A 4PQFA 4UQOA 4QJ4A 3TR0A 3UWOA 1YQTA 2PL3A 2XNDD 1GTVA 4XWAA 4B73A 3VNVA 3RS4A 3I3SR 4UXHA 5FBLB 3KQLA 1HT2E 1X8LA 3F5FA 2IYRA 4NU0A 4P31A 3U61B 4A0HA 4HLDA 2JATA 2AFHE 2F3RA 3NC0C 1VG8A 1ZM2A 4DLUA 4H9GA 3WHLA 2FZ4A 4C0LA 3FMFA 3JVVA 1N0VC 4HLUA 4TQ9A 2F55A 4FMDB 3A4NA 4D6PA 2VP4A 3N5CA 1KK1A 4GBMA 1XJCA 4PO1A 5FFMA 4A6PA 2W00A 1XXHB 2G3YA 4NCKA 1GKUB 2ZETA 3EARA 2HXSA 4F4IA 1IM2A 1LS6A 4BFZA 4Z54A 3AGPA 4DIEA 2BOVA 4OJKA 1JQLB 1Z0JA 2PCLA 3CX8A 3Q85A 5LB2A 3QBVA 1X3SA 1II8A 4ZDKA 3A37A 3R8FA 4TYYA 3PQCA 3SFZA 1M2OB 2IHBA 3DEFA 5FPSA 1JR3D 5HPYB 4CYMA 3GLIA 4HLCA 4GNKA 1W48A 3OF5A 3PUVA 3QIAA 4Q48A 1MR3F 3QI2A 4NCNA 1QVRA 4DB4A 2ZI3A 4KCGA 3OZXA 4JLNA 4EJSB 1U8AA 5LPNA 3PIRA 1A2KC 3THXB 4AYWA 3UKDA 3TLXA 3TR5A 2W6JA 2NQ2C 3FKSD 1Z0KA 3VR5A 1FNNA 5EJEA 2PJRA 4R2IA 2ZRHA 1N6HA 2XB4A 2VP0A 1O87A 3QJYA 2VP5A 2ZROA 5KPJA 3A1WA 4CDGA 2CCKA 5FTNA 1JPJA 3SBEA 3SYLA 4NYMR 3QVVA 3ZD7A 2DB3A 1COWD 4TL7A 2J0QA 3KXIA 1E9FA 5TMPA 1E69A 3NHAA 3UFFA 2LKDA 1FW6A 3HYTA 2OLKA 2DFLA 1NMYA 3PEUA 3R9WA 1Q1EA 3FDIA 4L5BA 1E2PA 1ANKA 3L8YA 2CL7X 3SN6A 1Z22A 1AK2A 3VR2A 3L0OA 4MH0R 5L8VA 2CCGA 1LB1B 1YKSA 4HYYA 2NO9A 4Q7LA 1F2TB 5C46F 3AVOA 2NO1A 2GZHA 4QJ5A 2BDTA 1IN5A 3WBJA 6Q21A 1NN3A 3PUZA 221PA 4OL0A 2GJSA 3L0SA 1JJVA 1PZNA 1NL3A 2B8WA 2WJHA 3B1XA 1NVWQ 4K8OA 3OFNA 4URXR 3CPHA 2GKSA 5KNCA 2JLWA 1GP2A 1GITA 3GLHB 4FCWA 1L7VC 1AA9A 3ETLA 3I1FA 4TQAA 4DXAA 1SXJD 3QE0A 1Q1BA 2ZJ5A 3WY9A 1T5LA 1TU3A 1KO8A 1BMFD 3I73A 4IVRA 2GVZC 1JXMA 3IIJA 1PLJA 2GRJA 4HZUA 2FG5A 2QSZA 5IRCD 1M1YE 4MKIA 2FGJA 3O8DA 1JAHA 1NN5A 2QEQA 1DELA 3OEEA 4QFMA 2OXRA 3L82B 5BQ5A 2YZ2A 3KX2A 2ZRLA 1KSJA 2FNAA 1R4AA 3BC1A 4DLTA 2C5LA 3EPJA 2H17A 2PX3A 2PLRA 1EFRD 4DLXA 1E94E 1YU9A 2IYWA 3QOFA 5JSZA 1CTQA 5J5CA 3PEWA 1II9A 1Q20A 3VKGA 1IXZA 1Z5ZA 4MRPA 1KAGA 3WP1B 3LA6A 2H7VA 2B8TA 3U4QA 2QGNA 1N6NA 1HUQA 2OCYC 4FCTA 5G40A 1NY6A 1A5TA 3VU9A 1RYHA 1G8YA 3U3JA 5FTLA 1DO0A 1S96A 1OH6A 1TUIA 1E99A 2ZR0A 1XRJA 4LJ4A 1XTKA 2CL6X 2WWFA 1CBUA 5KNBA 1AN0A 2E87A 1EGAA 3RRYA 3SOPA 3NHBA 3SC3A 3QKUA 1UEIA 1R5BA 3AVXA 3PJRA 2JDID 4OHVA 3BAFA 2DBYA 1FAQA 2XSZD 4QC2A 3AH8A 3KUDA 1TX4B 5BW8A 5G3ZA 2Q3MA 2AWOA 2HJGA 1W0KA 4NKRA 3EIHA 4HUQB 4A8JC 4RSGA 1KSFX 2TMKA 4Q01A 4HAUA 1UAAA 2V1XA 4D25A 1KY2A 1T91A 2DWPA 2H8KA 1D2EA 3I5YA 2N46A 3V4FA 3VNUA 4JLDA 2W2TA 4B74A 3U6KA 1HA3A 1N6RA 2OAP1 1EG7A 3IDQA 4PAQA 1IQPA 1XTIA 3IIKA 1DAMA 2JLSA 2NZ8A 2CLDX 3X1ZA 3ZZ0A 3CO5A 4JLJA 3OEHD 4MDEA 3UPUA 4XSHA 1A4RA 1HT1E 1T0JB 4D4MA 1EX6A 3J81k 2ZYVX 2A30A 1DAIA 4KJZA 4PTLA 4KU4A 1VYTA 3LX5A 4MKFA 2QNRA 4Q7JB 4Z1MD 4DSOA 4URZR 1Z83A 2D74A 3B8HA 4NMMA 4QGFA 4QNRA 3W5JA 2EFCB 2ZYTX 5E4FA 1S8FA 4LBYA 2R65A 1F6BA 2OFOA 4JJZA 2YKGA 4WAUA 1N0WA 3AVUA 3QKRB 3IUYA 1GUAA 1FX0A 1G3RA 1KJWA 1U2RA 3CLVA 3EC1A 4PPQA 5C4MA 4NHOA 1XPRA 3R9IA 5J47A 4DSTA 3ZIAD 2ZRJA 4RD6A 2QT1A 2DFTA 2WZQA 3EZ2A 3R7WB 5AJZA 1U99A 3U5ZB 3K9LA 4BFXA 5EUQB 2QTVB 5AUNB 1QHXA 3L8ZA 3K0CC 2VL7A 4Q7MB 1LTQA 2ONJA 1R7RA 5C1BA 2FMXA 1G3MA 5P21A 3RS0A 2BIFA 2BMDA 4NTZA 2G1KA 1I2DA 3D8BA 2O8CA 5FPKA 3R20A 1OXVA 2BM1A 4QXAA 2IYZA 2J1LA 3EIEA 1RZ3A 2ZI7A 3I92A 1ZIPA 4C30A 1GIAA 1YR7A 4KO8A 2IF0A 3N70A 2XTNA 1ZM4A 2BKEA 1G16A 3U3MA 1AM4D 1Z0AA 4TL8A 2WKQA 1XTJA 2PMKA 2O8EA 2W58A 1JB1A 4PANA 2PCJA 1DG1G 3EG5A 1E1QD 2MSDB 2OBMA 1DAEA 3WNDA 4B47A 1VG1A 3QXSA 1I2MA 4RD0A 1ZM9A 3DOEA 4DDTA 1G21E 2GF9A 4O2RA 2G9NA 3ZDQA 1ZC4A 3U44A 1OXUA 3LAWA 4X8MA 4FIDA 2GCNA 1MO4A 2AN9A 5DO9A 5K8TA 4YMWA 5KU1A 4N3NA 4B3CA 4IOJA 3ADCA 3TMKA 1DAGA 3KFXA 4FD2A 3CX6A 3H84A 5KSPA 1UKZA 4A0GA 4IXNA 4NYJR 2BCGY 2WAYA 1SVOA 3T1TA 1QHHB 3A8TA 1FARA 3DO6A 1CF4A 1KJZA 4Q00A 2HUPA 1KZ7B 2ZRIA 3VR1A 4MKGA 4B34A 5ANRB 2QE7A 1P7CA 4EQ6B 1MH1A 2VTKA 1RJ9A 4JYBA 4A6XA 4H1VA 4RY2A 3LLUA 5DHAA 2J7KA 1CU1A 3A4LA 1HE8B 1US8A 1QG2A 3MD0A 3MUFA 4KLNA 2XEXA 4JJKA 4ZI2A 4Q5IA 5JMTA 5JZVA 1SVIA 3QPVA 5D3MB 2XAUA 3OIWA 1E9BA 3EZ9A 1Z6TA 4OI4A 1JJ7A 4JL5A 4IEIA 1GWNA 1Q3TA 1E79A 4BECA 2MMCA 4DLWA 4V0KA 3RYTC 2XITA 3T1QA 1NLZA 2I4IA 1WE2A 5AUQA 5FPHA 3M0EA 2WAXA 3AVWA 5FTKA 2C04A 1MT0A 5L3SB 1D9ZA 2OO7A 5DHFA 4BRUA 1QHGA 4FN5A 4HATA 4YDSA 1N5JA 1L4UA 1GNRA 1LF5A 4ZI3A 1W36D 2XNSA 3K0FB 1TAGA 4NCIA 4IFEA 5GJCA 2HT6A 5E7IA 1E32A 4E5UA 4UXJA 1JI0A 3KDSE 4LHWA 5HTKA 2I1VB 3VR3A 3K0EA 1YRBA 2P5TB 4GPTA 4D26A 2XJ9A 2OILA 3I62A 2XB2A 1FQKA 2YC4C 4TL6A 4NYJQ 3VR6A 2SHKA 5FOWA 2O0HA 4K46A 1E1RA 4WIAA 2AR7A 3W90A 3ND8A 4R7ZA 1C9KA 4OHWA 4OK3A 1S1CA 1G8GA 3PEVA 2NO6A 5KOYA 1N6KA 2QG6A 2ZYWX 5TXGA 4A36A 1E9AA 2FFHA 4LK2A 2QY9A 2ZAMA 2Q9AA 4G01B 4HAWA 4LOAA 4C0JA 4EJSA 1Z06A 3RC8A 4MGYR 4XH9B 1JPNA 2CDNA 2QA5A 2HCJB 4GP7A 4C4PA 1BIFA 3BOSA 5EXPA 4GP6A 4XWKA 3L43A 1E2DA 2X19A 2IYQA 2JLYA 5EQTA 2NOAA 4PAOA 3TAUA 1I4DD 3NBFA 1IAQA 3RNLA 2CE7A 4ZV4A 1J7KA 1WDTA 2FPMA 2D2EA 2VHTA 4PHFA 3RDPA 2F9LA 3LQQA 3OHMA 3U2QA 1JQJC 4Q66C 2VEDA 3RC3A 5KNDA 4O25A 1U0LA 2QAGB 4W7SA 2KBFA 3HPRA 1G41A 1NVUQ 1PUJA 2KI5A 2CVHA 4PSKA 2HCBA 4DCTA 2X77A 3UMFA 1MRNA 3CH4B 3NG1A 1IJFA 1S3SA 2JJ2A 2VHCA 3MCAA 1KK0A 4US0R 2JAQA 1L2TA 2B7BA 1MOZA 2XGJA 2GNOA 1F2TA 1NIJA 1RRCA 1TUEA 3A6PC 5C4GB 5D3QA 1HURA 1S3GA 2ORIA 4M9ZA 4F91B 3GMTA 1UF9A 1JXOA 4LJAA 2WBLC 4B43A 3WRXC 4RZ2A 1RYFA 3AP1A 3KXLA 3GLHA 3U3KA 2WWWA 2ZSFA 2P65A 3RRZA 1TEVA 5K8IA 3B1ZA 2CLSA 1Z29A 3FHOA 3ONWA 1P6XA 2IS6A 3C15C 2RGDA 3LQRA 2Z0MA 2EQBA 5F9HA 4RVCA 3A1SA 4HB2A 1WBBA 2NIPA 1K5DA 4JT4A 4PC1A 1N5LA 2GVIA 1TQ6A 4DIDA 5L3VA 4ESVA 4AYTA 3G82C 4PXAA 1Z63A 5FH9A 4CEJB 1WA5A 2ZI4A 1OT3A 1YR8A 4ZDWA 3U7EB 3EW9A 2OFXA 2C77A 3JZMA 3I8SA 4B33A 1T0HB 1BYUA 3G5UA 2IS1A 1P2TA 1E2EA 1EFUA 4G1UC 1D5CA 3CKLA 3CXLA 3RRMA 2J46A 4LWZA 2DCUA 3P27A 1CJKC 2V55B 5C18A 4ILEA 4BZPA 4PR0A 3LNCA 2D7CA 3LBIA 1FPMA 3UANA 4M1KA 2PLFA 1PLKA 3NWJA 4ON9A 2JIZA 3VAAA 4MA4A 2RGNA 2ZR7A 2G6BA 2AKYA 1XFAA 2Z4SA 4UNNA 2EWVA 1XXHE 1H8HA 3T12A 3CNOA 4I81A 1A82A 1W47A 2QUZA 3EX7C 3GJ7A 4PPNA 1LV7A 4B3DA 2WOOA 1N25A 1QBKC 2QPOA 1PJRA 3MRSA 5DH9A 4PZZA 5HKKA 1OLOA 2AK2A 1WBDA 3TGPA 5DI3B 2R62A 4CGZA 4CT4B 5LDDC 2H16A 4EDHA 4URUR 1GNQA 5JWRA 1TQ2A 4DLYA 2CNWD 3KQNA 4P33A 2IYYA 2RHMA 4HUQA 1CR4A 4B35A 1UPTA 1FQJA 2VA8A 2GEDA 4FCVA 1KI4A 1MO5A 3KJIA 4NDZA 3SJBA 3SYNA 1GG2A 2EVWX 5K8UA 1R8SA 1IXSB 2BBSA 2BMJA 2OT3B 2W2VA 4UJ3A 4BFYA 2V7QD 3ZS8A 3PR1A 4C0SA 2J7PD 3ASZA 4B32A 1ZNZA 2IX3A 1OF1A 3SS8A 1EFTA 4TWZA 4OQNA 4M1TA 3AVYA 2ODEA 5HE8A 2QT0A 3SHFA 1O3YA 4JL6A 4EFLA 5B64A 2OESA 1P62B 5JCPA 4WXPA 1G19A 1YR9A 2JASA 1KBEA 4AC9A 2KJQA 1DBSA 1CLUA 2ZEJA 4TSFA 5JEEA 3QKRA 3GCGA 3DZ8A 3Q9LA 3SEAA 1XCPA 1A1VA 3HP1A 2F6RA 4JLMA 2VSOA 3RWOA 4Q03A 1G8HA 4EPYA 1JNYA 3AVQA 5CJPA 2ERYA 1BYIA 3CZQA 3AB3A 3DM5A 4L16A 4RFSB 2YWFA 1CIPA 4A82A 2QRNA 2WWHA 3L0IB 2GHIA 1JBKA 2ZSEA 1GL7A 2GETA 1KI9A 2ZRFA 3Q7QA 4LYHA 3IEVA 4CVNA 5A0FA 5JHGB 3KKMA 3LBNA 4YLGA 4LJ8A 3W5IA 4BFUA 2IXFA 3FHCB 1SXJE 3E70C 3B7GA 4PFSA 4OI0A 3K0SA 2O8FB 4B71A 3W8NA 3TIFA 4BFVA 1OIVA 4RZXA 4DHEA 1U8ZA 2ZANA 3NXSA 5CM8B 3OE7D 3QXHA 1NN0A 2PMDA 5FR2A 4TZ6A 2XZPA 4OQLA 2VSFA 4V02A 4KHZA 4V03A 4HDQB 3IPYA 1ZYUA 1VYVA 4LC0A 1VCOA 2GXUA 1W5TA 1SVKA 1E0JA 4B75A 3IQXA 1OPXA 1BO6A 2B6HA 1NG1A 2CEAA 4P3YA 2YWHA 2FV8A 2QENA 1KDRA 1ZMXA 4G5GA 4V0MA 2ZXUA 1EFCA 1TEXA 1LW7A 1E9DA 3CRRA 2O8DB 4S35A 4B3GA 3I4LA 2ATVA 4DCUA 5HZKA 4TQUS 5L3QB 1GKYA 1IBRA 3KUCA 1KGDA 3ECCA 2NPFA 1LF0A 2QMUA 3A36A 4E07A 1P9WA 1IY2A 1NIPA 1OIWA 1TL7C 2BBTA 2C9OA 4KFRA 3DPUA 3REGA 1J8MF 2J5XA 4MUAA 1KO7A 1QHHA 1H8EA 4Q1BA 4PZYA 3CRVA 2X2FA 1NNEA 2FEOA 2OHFA 3MAAC 1KKLA 3A1VA 3UGDA 1N5IA 1IY0A 4EQ6A 4X8OA 1GL9B 2GEVA 1UBEA 3JVUA 3HPQA 1RPZA 3VQTA 3OAAD 1HYQA 1HEIA 4MGZR 4RD2A 3F3YA 3AKDA 1G9XA 4TL9A 1WQ1R 4TT3D 2QU8A 2QZ4A 3ZVMA 1SHZA 2IYSA 4H1UA 4TYNA 2WKPA 1KMHB 3MG9A 5CM9C 3KFVA 3C5HA 2D06A 1UFQA 5D3MA 4XSGA 2WPDA 3CB4A 3WXMA 5KSZA 5DGXA 4NCJA 2GXAA 2VF7A 1XEXB 1ZC3A 1OKKA 3GEEA 3UWKA 1G1MA 2P6NA 5JLJA 3KKOA 1VYUA 4HEJA 3K0AB 4PC6A 4BLPA 3SI7A 4MRNA 1U98A 4KXFB 2GILA 4QKQA 4B2LA 2BJWA 2W6ID 5L3SA 2ZUDA 1ZNXA 5AWFC 5M04A 1TMKA 2GWHA 521PA 4D4KA 4U02A 1OE0A 5E3HA 2DY1A 5CB6A 3K0FA 2X2EA 4M2LA 1W7AA 2HDNB 1U94A 2PZFA 1F5NA 4MDFA 1X8KA 4DLZA 4WZ6A 5BXQC 4EIWA 4DJTA 2G83A 3U6BA 1P3JA 4L4UA 2F1JA 1SQ5A 2JLZA 1E1RD 4ESHA 5EZ6B 1FUKA 4URWR 4PHGA 4KFTA 2W0SA 2EYUA 3QENA 1ZNYA 1YZGA 2YVUA 4YMUA 3B1WA 5DYGA 2RGXA 2CJWB 1UKEA 2OZEA 3LXXA 2ZS7A 4BEBA 2WIAA 2BBOA 1HQCA 4LBVA 4POAA 4ZCMA 3QKTA 1G6HA 4QG7A 1NBMA 4F7WA 4RJLA 5FBQB 3U7HB 2IHYA 2PT5A 3FTQA 3U60B 2WJIA 2EWWA 1HH4A 1AGRA 1KOFA 1XMSA 2DR3A 3KZ1E 4TN1A 1GOTA 1KSGA 4E09A 2VH5R 2XX3A
chains in the Genus database with same CATH superfamily
4M21A 4XD7D 5AVTA 1N2XA 4FSHA 4M9XA 3UJ6A 1BFKA 3EGIA 2XDQB 5KNDD 5TPZD 4BQOA 3WZ2A 5KHLB 1S2MA 2FG7C 3ON5A 2HF9A 2N0SA 1FJHA 4LHEA 1X7XA 5M2QA 3O2NA 3TNFA 1UAYA 1V41E 1G291 4L6AA 3WLMA 3WGKA 1ESMA 1LRLA 2CUKA 3NH9A 3A0RB 4GO1A 3Q7IA 4OSOA 5FV4A 1M34B 2OZLA 1SUEA 1ZA1A 2B9EA 3ANXA 4M9QA 4CWAA 2NU0I 2AI2A 2A86A 1KBFA 3L6RA 4MPIA 4HDRB 4UUMA 1M2VA 5BSUA 2V98A 2VYFA 5REQA 5ICEA 2V5UA 3HCNA 3HB4X 1IN8A 3A3YA 1Y42X 3FFAA 4KN9S 3UMCA 4A1OA 2KSQA 3BMQB 4HNVA 1NM5A 3I0MA 5ED4A 5GJBA 4J0FA 1UDWA 4UBMA 1H93A 4X1YA 1Z3CA 1UZMA 2AG5A 5I8WA 3L7AA 2WUEA 2Z95A 1O94D 3PNYA 4O4JA 2SNIE 1DINA 2GZSA 4TLLB 1ZISA 5JCOA 1A9TA 2DUWA 2PQ0A 2PRZA 2XQKA 2EHJA 2OCDA 3A6ZA 3V8PA 4BLOA 5KYTA 2DWOA 4DQUA 2XZOA 1U2EA 4K6OA 5FUYA 3CNLA 3EYAA 1UBLS 1WB9A 5JW6A 4XTCS 3OG9A 2YTZA 5AM2A 1MABB 2D6FA 1FEZA 3M6UA 1K6XA 2GFHA 4FSXA 1FDRA 3FRHA 2WIDA 3E9YA 1ZR4A 3COZA 3E0QA 3I2FA 2Z57A 4D0SA 1D0SA 2QRVB 1P1HA 4BL5A 4ZOLB 3S44A 1T9KA 4I3GA 5T7BA 4TWAA 2C4HA 4QYIB 4JUCA 2NXCA 1SUIA 2R7LA 2YDXA 5IH3A 4QZVA 1GV1A 2Z2KA 5EVCA 2OUKA 3GPCA 3O26A 1RHUA 2ZIEA 1SVNA 3HFJA 2QYTA 3LJKA 4NWIA 2A67A 1FSGA 4FMCB 4MCIA 1RXWA 2TS1A 4F5DA 2I71A 3K70B 3HN6A 1UJ2A 5D85A 2CVZA 4AF7A 2H08A 4ZPXA 3IKTA 1FUYB 1N2JA 3D3WA 4PZAA 4Z9YA 1XZQA 2WOJA 4Y2VA 1K8RA 4B48A 1QWOA 5KKNB 2ZJ8A 5JRJA 1EXMA 2E4UA 3MWYW 5CFMA 1E6MA 5COBA 5TY0A 4Z4IA 4YIHA 4RZ3A 5BN5B 2ECKA 1E2QA 4X8LA 1XP5A 4BGIA 4Z0PA 5GVRA 4HF7A 1X15A 4BTEA 4E31A 2OXTA 1DS2I 3RK0A 1XNRB 3OZEA 2O6HA 3F9CA 1VGRA 4MV8A 2NYRA 1B8OA 4PZPA 3RM3A 3OF2A 1F12A 3GJ5A 4RU1A 3X1KA 1TKCA 3D8HA 3HHPA 4QTUB 4Q7QA 3GVHA 3SQWA 2R1TB 3CF6R 1ZITA 2J87A 2B21A 4E2WA 2WT4A 1NY5A 4P4UA 1X7DA 4OYRA 4EHAA 2V1UA 1IVNA 3RT7A 1XZDA 2YZ7A 3CO0S 4M9SA 2VBGA 3L02A 4M7WA 2OY0A 3VTZA 5BV2P 4E1BA 4ZYYA 4YXWA 1Y9AA 2BYTA 4G5QA 4BTVA 3B13B 1AK9A 1WPGA 2HA7A 1FFXA 1Y98A 3N7UA 5I7FA 5DXJA 4DPLA 3BBLA 4EMUA 5JTTA 4OQDA 3O8BA 1I13A 1AKEA 1K8XB 4FMDF 3TUIC 2PTGA 4IDHA 1EQAA 4HWKA 2XKKA 4U7DA 3HYLA 3PLNA 4B31A 4EVSA 1XZBA 2I62A 4RF3A 2XCIA 1TJNA 1AUVA 1EEHA 2J07A 3AFGA 3N2GA 4HMPA 4HUJA 1KJYA 2BDUA 3CNHA 3P0HA 4KDFA 4CL3A 4ZDJA 4B3BA 3S2EA 3U3XA 1TIKA 1JKJB 1RQ7A 4WOJA 5JY1A 3EVBA 4S2EA 5FWXB 4QECA 4IMIB 1X92A 5E8JA 1CUJA 1YZQA 1YTLA 3FTPA 4NEHB 1SVMA 1T1EA 3U81A 4KPFC 3MTQA 5KMGB 2ES4A 3VKVA 2YOGA 3NEJA 2HLDA 3HNOA 1H1LB 5U1PA 1J8YF 1G63A 1P8JA 3G5LA 1QRSA 1FMLA 1JEEA 2QLFA 4ZALA 1GKLA 2GCIA 3QX3A 3H42B 4ZVSA 3N9IA 3TI9A 3FPSA 5HCIA 3RREA 4DUGD 1J49A 1KJIA 1Q1AA 1SCBA 2NUBA 1XD2B 2VHJA 1XPJA 2PBFA 4OKSA 4X95A 1R0YA 4Z49A 3DPSA 1HFJA 4XVRA 1IQUA 2BFDB 4Y6GB 2NQTA 4L4XA 2D2FA 2DPXA 3KOXA 4MEBA 5LA6B 3VISA 4B83A 5DGIA 4X1IB 3SSMA 3BIFA 3MWJA 1J4AA 4Y30A 4NMWA 1U8TA 1TVKB 4PFJA 4BHTA 4JJEA 2EX0A 3IYLW 3FZYA 4JU8A 1CVRA 1ECBA 5DLDA 3FWKA 5E6RA 5A2QA 1EZZA 2RSLA 1N1EA 3PKJA 1FL9A 5GM2A 4FBGA 3ZDYB 4EGAA 3IMFA 4RKYA 4TYQA 1OW3B 4LDZA 4XYLA 5JOQA 4FJ1A 1PV4A 1U28C 2Z8YA 1P1JA 4OEHA 3RBZA 1TM1E 5I9NA 4BP9A 1ZESA 4DMKA 4F1KA 1THZA 4HQFA 2DPMA 3GIWA 1I4WA 3HXMA 3HDHA 1UVFA 3GEIA 2FRVA 3IRVA 1SGEI 1VG0B 1S2IA 4WW0A 1T1IA 1MC5A 4ZT3A 1VRVA 3OFVA 1HYEA 1PEYA 4NBWA 4JBHA 4YV2A 4B8ZA 9ABPA 1SCUB 2W6QA 1YVPA 2GXQA 3WQBA 2H9AA 1O54A 2WTUA 3PRJA 3HVHA 4CV2A 2GMWA 3E3NA 3HEAA 3L04A 4TMVA 4HTFA 4AX8A 2WYOA 5HGJA 1DT5A 5DSXA 4IBOA 3K1JA 2FEPA 3L2OB 3CF2A 3CSUA 2NO7A 1Y8RB 1JWBB 4MZXA 2ZVQX 4EY8A 5HUHA 1FQWA 1TBOA 1KO1A 5HZMA 3LX4A 2JGIA 3DKVA 3PGMA 4P7JA 4ZJYA 5JUWA 2C57A 3GFOA 4H2DA 3CRW1 4RQUA 5FJJA 4F85A 2BMFA 3UMBA 3KLOA 4OI2A 4MEJA 1J9EA 5AKGA 4OFXA 3TVDA 1T13A 2WDZA 1ZIDA 2CB9A 1H2HA 1NDHA 1C0LA 3N2LA 4FQ7A 4X6UA 2XTZA 1K7TA 1K2VN 2C61A 2BY4A 1ZCFA 5KJEA 4DV0B 3KB1A 4I99A 3OX2A 2HJWA 5EE5B 3OL0A 1KGSA 2VYCA 4I36A 1IY6A 1IUOA 2XGMA 3RFFA 1W4AA 2F8LA 3N6XA 4OGKA 1HE5A 1OAKA 2Q6LA 3UCFA 5HX7A 3WX0A 1TF7A 1YUBA 4OB7A 5EOVA 1NXSA 3G85A 3BM5A 3FPAA 4KAJA 1TZ2A 2FOXA 2JFPA 3N2EA 3VSAA 1U80A 4DCSA 2JGDA 1P6UA 2BEUB 3TZKA 4F2HA 4JC0A 4TWJA 5LUBA 1G7SA 1E20A 3KKEA 1I3NA 1E2BA 4MS4B 4PLWA 3L1VA 1MF7A 3QXGA 1X1RA 2BF4A 1FRFS 2QYSA 4Z2YA 4PZCA 3T9AA 1ETUA 4DQDA 1FU4A 3ZDZB 2VDWA 1OFUA 2EKDA 4DR5B 1NULA 4ZQHA 1KI8A 3WYCA 4A8TA 2E4ZA 1BMOA 1VDZA 2Y99A 4HGNA 2XNDA 5LKRA 1C4OA 4XWOA 4X91A 3DOJA 3RVKA 3QWHA 3OOEA 3C6ZA 4M60A 4PZEA 5LL6P 5IH7A 5D00A 3DLCA 3RR2A 1W4RA 2ZJOA 3IB6A 2EV9A 2O1EA 3JQ7A 3EXHB 1EB9A 1NJ5A 2F90A 1RWBA 1T0PA 2RBKA 1YB6A 4W5JA 4IHJF 4YMLA 1EFVB 2XMZA 1X8XA 3WSWA 3DUFB 3L1HA 2DKNA 2NMVA 3IJPA 3DBVO 1XLWA 3PP8A 3RKUA 3ZLTA 3K0AA 1LSUA 5ES4B 5KWJA 2EBHX 4GLBA 4NZPA 3CFYA 1G59A 4I0WB 2QTBA 2J5BA 3VHQA 2A59A 5B6JA 4QNNA 5ALJA 3ZHOA 2E85A 2GAJA 4ZYVA 1F20A 5KKCA 1O6GA 2HSJA 3M4XA 4MKXA 4HS9A 2OE2A 4JUAA 4BJ6A 3ZH9B 3S99A 4BX9A 1KI1A 1QS0A 4LI3X 4F6LA 3DE4X 2OMKA 2FEKA 4DCVA 2DECA 3FX2A 4FU0A 2G1AA 4GRAA 3U31A 5TSDA 4PQGA 4OHBA 1AJEA 4PX3A 1N2OA 3B3GA 4KWTA 2E5WA 2QI9F 3BDIA 3KEFA 3OFJA 3IDFA 3RHSA 5T41A 3ZV5A 2GPTA 3EE6A 3OICA 5ALDA 2QGZA 5DIZA 1DMSA 2R6DA 1NKTA 5ALOA 5K99A 3KR1A 3NS7A 3AKEA 4X90A 3FUXA 4H6PA 3RRNA 2WC1A 3H5OA 3N39C 3NGXA 5TGTA 3TM4A 4UDXX 4Y6RA 1LX6A 1XNQB 2HEIA 5I9SA 1SUBA 3QUCA 3DKPA 3TQTA 1O5TA 2ODPA 4KUGA 4C6TA 1AA6A 2HF2A 3ZVKA 4FDAA 1ZJYA 2RE8A 4MUBA 1X86B 2G9UA 1CCWA 4DMRA 2II6A 1M5UA 5AOCA 5KHOC 2C07A 3MA0A 2QTNA 3GDHA 3HY3A 1XD8A 4YT5A 4AK9A 4S3MA 3RC2A 2WI8A 3LUPA 4PGFA 2IK8A 5EGSA 5K3BA 4EP1A 5C2JB 4J7CA 4QQKA 4FOTA 2VSNA 4FW9A 3UAYA 5K6AC 2CK3A 2XDQA 1PWHA 1BEUB 3FD8A 1CSOI 1QRAA 4AP6A 3F97A 1A04A 1Z5PA 3KKZA 4RZQA 4QLAA 2IIBA 3HB1A 1USVA 4BQNA 1SQSA 1YRAA 1IN7A 3MCUA 2ZR8A 2C9DA 3OUTA 3QQPA 2XDWA 3RVJA 4H7JA 3TCNA 1S3FA 3PEEA 3U9SA 4DNFA 1M34A 5GINE 4LBZA 5T3UA 3LL4A 1N6LA 4HDRA 1RBQA 4HH3C 4M0CA 5G1PA 1P1FA 5ADWA 1GPUA 4PAMA 4YP1A 1JTEA 2R5FA 4AJ4A 1SBZA 3NHLA 3OLYA 2JAPA 1A8HA 1DQZA 1EM6A 3H4IA 3QIVA 3U4IA 4WFQA 3BMQA 3ZBTA 4BUZA 3RANA 3OPXA 1RWKA 2FNFX 1D03A 2EG5A 1LC3A 4HSEA 1L5RA 2WUWE 3B1YA 1P7YA 1E3TA 2JA2A 2SGDI 1BMFA 4L7VA 3TEMA 4DM3A 3O0TA 4MPDA 4S1NA 3L7BA 3PDWA 1N2CB 3AHCA 4DNCA 1PNTA 3QE2A 2BTOA 4KLZA 2ZAIA 3RIHA 3SDZA 4YCLA 4LSMA 2HJSA 4CZ2A 4DPKA 5F33A 1O5OA 2H07A 2VN8A 1MOPA 3KJHA 4RKFA 4YQYA 5FB3A 4GL4A 1MABA 5KYGA 2R68A 2VOJA 3Q3HA 5DF1A 3LOQA 1VSTA 2VG8A 4XB2A 4PCAA 4ZIRB 1Q7EA 1CR1A 3M6LA 5IBRA 4LECA 5IF3A 1CHNA 2QRVA 4WKBA 4P58A 2XA9A 1I0IA 4ZOLA 1ZW6A 4LF9B 4QBKA 3D6HA 2XEDA 1YU6A 4FFSA 4L7QA 4QYIA 4DJEC 1G0NA 2C31A 3ACDA 1FDWA 1YACA 3L1JA 4AIRA 4CDRA 4E32A 4NCXA 4EQZA 2JCVA 2VOEA 3S1AB 1TF5A 1N7GA 3H17A 5DM70 3K4PA 1UWVA 1XJQA 5IWCA 3RTCA 1CJVC 1AHPA 4KSCA 1O97C 4V1CB 1KTIA 4RHCA 1TBQR 1ULZA 2IDZA 1QORA 5CXXA 5GY7A 5IMBA 4DIBA 1RZVA 2XCQA 3HU2A 2WVAA 2REOA 1JZSA 1IC6A 3ZWVA 4FILA 1NW6A 2BR3A 5BN5A 1SFRA 3FFWA 4W9MC 1ZH6A 3VVLA 4DWWA 2XODA 4OL9A 1JA0A 1AT1A 2W4IA 3JV7A 3K8OE 3O31A 1Y7LA 3PNBA 4HI0E 2PUCA 4F84A 3R9XB 2I99A 4DRYA 4YAIA 5JEDA 2CZGA 4BTLA 1A88A 1RP1A 2JC3A 5HDBB 3WKDA 2EYQA 4G26A 3FCSB 1S2OA 1DC5A 2IOQA 3O8LA 4LQDA 5PGMA 5GZ3A 4X9XA 8LDHA 4F45A 1FS5A 2RHBA 1UT5A 5A05A 4F60A 5KQGA 3QBTA 4R2HA 3IP5A 1ZK4A 2R1TA 3ICCA 3QH4A 4WADA 2AW5A 2FE4A 3X1DA 4A92A 4YMTA 2C5GA 3UHFA 1CD5A 1REQB 4Q4LA 4AJKA 4TTVA 4BNYA 3D1LA 2PZKA 3KOZA 4HRAA 4YJHB 2P90A 3RVNA 3J81A 4E5DA 1Q0SA 1Z0DA 5FADA 4MW1A 1XNGA 2FZVA 5C9ZA 2ZYHA 1P7VA 4OGLA 1QP0A 1NPDA 2PANA 2YWEA 4PS1A 4DLPA 3K4QA 5E2AA 4C0WA 1COZA 2IITA 1YVUA 4BE4A 3CZRA 4BLVA 1QH9A 1EK1A 1GQ2A 4CMEA 3KAKA 3RRXA 5JCJA 4OHYA 3OEHA 4HAVA 2VS1A 3D4NA 3MTJA 4I50F 4M1SA 4R8SA 2QJRA 2Z3ZA 1YQ9A 2Z83A 3C4JA 4GBED 4QHSA 3SHVA 4LMAA 4BAZA 3D8UA 1ID1A 1ODFA 2QRLA 3WZLA 1KQFA 2VJMB 1GD1O 1QO0D 2EP8A 1JKJA 2IA5A 2ZPUA 3ITDA 4XIIA 5FWXA 4EYOA 1F2UB 2HDHA 1EWVA 1MEEA 4E33A 3CIOA 3BWYA 5AUPB 4DSAA 1XK6A 2B7LA 3CNBA 1T9AA 1P2FA 1YUMA 3A9WA 4NAVA 1JDZA 3GUVA 1X38A 5IEJA 5KMGA 4BN4A 3GLTA 3ZGZA 1C8LA 2GFQA 5TQJA 1H1LA 3CBQA 4TLEA 4UTOA 2V7EA 3KPJA 4QJ3A 1Q0RA 1GUBA 3PGJA 5BQPA 2BWJA 3IQGX 2X1VA 4PYRA 1M34E 1D6SA 1LSSA 1OASA 4JA2A 3X1XA 4G4SP 1JA9A 2Y9PB 4UM5A 1IG3A 1XD2A 2O9JA 3R3VA 2HA4A 4YI5A 5EIOA 3NFRA 4LSGA 2HREA 5FPQA 1VJTA 4WPGA 2BFDA 2SKCA 4KO4S 3OJEA 1QZXA 1BMQA 1J20A 5LA6A 2I5PO 4QAJA 4X1IA 3O8RA 3VSBA 5JDIC 1D2RA 2YOHA 4MCAA 1TVKA 1U1IA 2Y05A 4YV7A 2ZWIA 3E3LA 3BSFA 5A5FA 4LPSA 4D4IA 2CL0X 1Z7EA 3L4BC 4CR7A 2V3VA 4U00A 4G0QA 4QULA 4F3TA 1S89A 3LY7A 1C2TA 2ZQYA 4QQRA 2PUEA 3SVTA 3CZPA 5ESWA 5IF9A 2JLUA 2XLBA 2ZBEA 3IAM1 5AW5A 2WB4A 4HEA1 2XLCA 5K0GA 3CTMA 2XMPA 3MCTA 1GN9A 4G81A 1AF7A 3PBKA 3PYLA 1A5BB 1Z73A 1JA1A 1ZUD1 3INRA 4C20A 1E1QA 2J6HA 1KYIA 4Q9JA 2IUUA 4HMOA 3QKSB 4PSVA 4PSAA 4G5SA 4BWYA 4BO1A 4Y2GA 2PWBA 5F77A 5JALA 1LDGA 1TUBB 1GSIA 1SCUA 2VAPA 3PPIA 1P6QA 2HAEA 2HFJA 3FMPB 3IHTA 1FVFA 3QPDA 5LVAA 1DSSG 5K2OA 4EFDA 3KEGA 3S8EA 2C7QA 1DBQA 4JZYA 3DGEC 1WZIA 3R7AA 2ZOSA 4RZIA 3W7AA 1VJDA 4UFOA 4AQDA 3OKPA 5F3RA 1Y8RA 1THMA 5I45A 1TGYA 4Q4AB 3D1VA 2A9PA 2CWHA 2BP7B 2VDQB 3IMCA 2VZ9A 4MWSA 4NPHA 2Y4OA 4KXNA 5MFPA 2IYEA 5EJ7A 3FCAA 1GADO 1DQSA 1X1SA 4MJ3A 4YT2A 2HWYA 3VAZA 4Q4JB 2NU3I 2J9GA 2P27A 4O1HA 4JVSB 3AKYA 2PY6A 2O8BB 3H87A 4IQFA 5JS1A 1WZ2A 4KGDA 1WXIA 1XEFA 3DTVB 3N58A 4RS4A 1LVGA 4E5YA 2GI4A 1DXYA 3WWDA 3S27A 3CUSA 1E2KA 4FDTA 4ZCLA 2XAAA 3UT0A 3WRYA 1WKBA 2GAIA 2WAAA 2FPKA 3BCRA 3O38A 4F2DA 4IDEA 5AI5A 2IU3A 4RH1A 2WWXA 2X3YA 5H0IA 2O7RA 2YN4A 2C3UA 5CCMA 3NC1C 1TD1A 1DRKA 3OIUA 1DPFA 4J6FA 2KE5A 1HNWB 2FDXA 2DFVA 1GM5A 2REXB 3VO9A 2IC5A 3BGWA 1K2WA 2JFHA 1U2GA 1FMJA 3WS7A 2BEUA 4Q16A 3W2FA 1J24A 4QLBA 5JZOA 2XF2A 1RWMA 4MS4A 2FW7A 3D31A 4OB6A 2ENNA 2QU7A 2QX4A 4ITVA 3ROQA 3NAZA 4OJYA 2LUOA 1NOJA 1NF9A 1ZL2A 2GZ2A 5EG5A 2Q7DA 3AKCA 3R5FA 3SHTA 2RONA 4KDRA 4YJKA 1QC5B 4F71A 3AOEC 1OLXB 2JGEA 1BVRA 3FF4A 2QM8A 5FUQA 4MVYA 5T64A 2FKNA 2V03A 1AMOA 2GJAA 1WG8A 3EXHA 2A88A 4K6KA 2ORWA 1E60A 3QTLA 1E1LA 3SHWA 3WLIA 3GH1A 2WMOB 2CHVA 2C2OA 3PXXA 1F17A 3OQMA 1EFVA 1Y4ZA 4OHKA 2VUHB 4QARA 4RF5A 2EZ9A 3DUFA 4WA7A 3WGHA 4CBVA 2V3CC 3R6TA 3ZJYA 3VMFA 4E15A 4MUIA 3VPGA 2HWWA 2JD1A 2QLTA 4NV3A 1O6BA 3ZCPA 1NJGA 3QOXA 2ETVA 2LCIA 3R77A 3LFTA 3UF0A 3B9BA 4UMFA 4BMZA 1Y1KE 4NEGA 2GKGA 1BXKA 3DBIA 4I6EA 3TVTA 4A6DA 2BW0A 4EUNA 4Z7JA 3G8CA 5CNIA 1OFVA 1CIJA 3B89A 4QOFA 1K5GA 1MT3A 1G7TA 4BVBA 1DEKA 2L0XA 4A2PA 4ENTA 4C7MA 2GX6A 8ATCA 1GFZA 1B8UA 3KTOA 2UYHA 4QM6A 4B4OA 1F8XA 1Q21A 3H8VA 1TVCA 3JYHA 4F4UA 2CT8A 1PS8A 2BHNA 2FUNB 3JQ9C 2GAAA 3ZX5A 1RKVA 2FXVA 3RF7A 2ZB4A 3GD5A 1ZZEA 3SQDA 1NHGA 3PFIA 4YR9A 4AF6A 3NVMB 4BX2A 2QW8A 2C7GA 2Q3EA 3EGWA 4PO9A 3T5DA 2ZTMA 3AY3A 2PD3A 1XRRA 1BX3A 2GCOB 2JJ2D 4FGKA 4AZ0B 1KFEB 5THKA 4CIAA 4KR3A 3Q4GA 4AZWA 1TGSI 1QKKA 5C7LO 1NJ1A 3ME5A 1C7JA 3TSYA 1UK7A 3BJIA 3UJBA 3V3KA 4YONB 2I33A 3E7WA 4BB6A 3S8YA 2WIKA 1C7ZA 2WHYA 4BO9A 3HFRA 4UUBA 2BUCA 1GAQA 2E73A 2YQ4A 4BKMA 3NWPA 3IEPA 3LWDA 1B0UA 4RF4A 4I6GA 3C6KA 3G68A 1KJ8A 2C4TA 2Y6UA 3PGKA 3T9FA 3LF1A 4TXNA 1E3DA 1JU9A 4BRZA 1O9BA 1QJCA 3DFFA 2M6LA 4P32A 3WYDA 4BKOA 1D2MA 5K0BA 3U13A 4B7UA 4QG3A 2IVZA 4US2R 4OV6B 5HDQA 4CLDA 2OEPA 1VE9A 4LMRA 4YH1A 3ZQ6A 2Y0MA 1XU4A 1IRIA 2ZT7A 4LNUB 3CUVA 2FSPA 1GY8A 5MGNA 2EFGA 1QIMA 3CH5A 5KTYA 3ZWAA 5JAUA 2P6MA 1TU0A 1A9PA 5DN6A 1U81A 1G55A 2X15A 4JLKA 4JENA 4RIIA 4DDWA 4NL4H 4O2LA 2J9ZB 2MR5A 3HI6A 2R7AA 1NBIA 2QF7A 1H66A 2WIJA 2Y1GA 4LY0A 5LU9A 3U9TA 4IZOA 4M8IA 4KYVA 3G2QA 3CW2A 2HT1A 2MR6A 1UWKA 1N2CA 4FOPA 1VSVA 2QRJA 3BGVA 4DY4A 1T8RA 1MHPA 4KO1S 5K01A 1K68A 2ZRKA 3L5KA 4QICA 1QRUA 2A9QA 3HN2A 3AX6A 1O9GA 2XUHA 3LO5A 1NW5A 4LN1A 3WIDA 1KSHA 2JANA 1C1XB 3OLCX 3MSCA 2YRWA 3MT0A 4ZIRA 1PTQA 4RENA 5JSKA 2CJFA 3WQHA 3L3BA 3IUPA 3M4ZA 4QDXA 4RVNA 3SCZA 5BMOA 2IRWA 3UTDA 4EF4A 4QU0A 1AX9A 3UUWA 3ESYA 3UATA 1UOEA 1QP7A 4QPCA 1T29A 4R4JA 4L9MA 3C41J 4DIFA 3IPXA 3C3AA 4AWXA 1FK8A 2ZYRA 1JLHA 4MMZB 3TCKA 4G56A 1T2FA 4QE3A 3URMA 5K4GA 1P2BA 4CPDA 2UVPB 3S1AA 3FMIA 5FEMA 5T5QA 1ORHA 4DSUA 1WUYA 4DT1B 4IF6A 5IKEA 2ORED 5HMMA 4V1CA 4X5OA 4E2XA 5FNVB 3I4CA 4KIJA 4RSMA 4DIOA 4YCSA 1CUVA 4KI0A 4IFBA 3KDPA 1YFKA 2VDJA 4GX5A 1FFEA 3N7TA 2H1WA 3DXZA 1NWHA 1PG0A 3QFFA 3R9XA 3HA3A 1C7EA 2XI4A 4I55B 5DTJA 2D7JA 5DIFA 1KI7A 1U2DA 4JKYA 5IC4A 2I7TA 2YY7A 4BRSA 5CTAA 1JKXA 3PWZA 2I03A 1UBOS 1CT4I 2C95A 3ZTTA 8ADHA 2NZXA 1T34A 3UWSA 1W5SA 4FYKA 3RVMA 3JASB 4IHKA 1RAFA 5EGNA 5PNTA 1ZM3A 1K8QA 3P96A 2OUIA 3LZCA 2YV2A 5DNDA 1REQA 2VT2A 1BOOA 4RJKA 2RKOA 4BQPA 3DH0A 4BQEA 1YRQA 1ZSNA 3D02A 4R8KA 1ECJA 3HCOA 4TRNA 3FNRA 1NI5A 1HV8A 1CYDA 4LDPA 4FT4A 2CCJA 4MULA 4TTRA 4YUWA 3DMTA 3E4CA 5AJYA 3AV0B 2ZM5A 3L4KA 3DPIA 3S28A 2PYZA 1YS7A 4K81B 4MSUA 4R83A 4Z9XA 1KQPA 5TDHA 3CVYA 3K9BA 2H57A 4OLBA 4QDZA 2OOSA 4KUEA 5CCLA 3LDGA 4J0EA 3C14C 4XJXA 2GK3A 2VJMA 1GZVA 3AY0A 3DVLA 4L5IA 3ROGA 3AVTA 3SX0A 2UZ3A 1F2UA 2GO7A 1Z0IA 4HQ0A 3EF3A 2BVNA 3AP2A 4OXQA 4KXQA 1N7IA 2WICA 1BKYA 1EDEA 3AJRA 1KFJB 1I7SB 3O1LA 5B3AA 2G71A 2G8LA 2IYNA 1PCEA 4G1CA 3IH5A 3QBDA 4IS3A 5CM2Z 1G17A 4B85A 2ZBGA 4R8MA 2Z04A 3W6ZA 1A9XB 2EJVA 3KOMA 3C3DA 4TVKA 4LYFA 4TLAA 4U2GA 3KG2A 4LXQA 5DM4A 2OPHA 3QXCA 3AZQA 2GKVA 1XVVA 1CT2I 1JAZA 2JGJA 2C78A 2HK6A 5IHPA 2R4UA 3BPSA 3L4EA 1D3AA 1TAHA 3L6EA 1QRDA 1WXWA 2UVDA 3PD7A 4B3XA 1A8QA 3KSZO 5LZ4A 3TNDA 2Z2JA 4QOJA 3NCTA 3R0QA 2NU1I 5I7OA 5FR1A 3TLEA 3UXMA 3B85A 2BSAA 3TUJC 1PVDA 2AKAB 5ILOA 2O8FA 1PTRA 3PT9A 3M7IA 4KBGA 2CLOB 1WP9A 4DNPA 1ARZA 5JBIA 2FB9A 1M8BA 4HFMA 3JS5A 3FVVA 4GMGA 5TMBA 3WOVA 3LC0A 3ZE1B 3RAPR 1J5PA 5SYAA 1ZN8A 3COYA 2ZP1A 4EATA 2DE0X 3FPEA 3LLCA 1ISRA 1B7GO 4OI1A 3H4MA 4WZAB 3WLKX 2P0AA 1YS1X 5JAIA 3HKBB 4MR8B 2AK3A 3RABA 3LI2A 2ASEA 2ZJBA 3MBKA 3QKSA 3N3AC 4IF4A 2Z3VA 4UNPA 4BRWA 4OQMA 4LJ9A 3UB2A 3ZNQA 1TUBA 4F97A 1IB0A 5CA0B 1M1YB 5C8VA 2J85A 1M5RA 4MVJM 3SKXA 1QYDA 1V1HA 4JCCA 1IZ8A 3EWSA 4OK5A 1ZUNB 1H8ED 1YF3A 4G0ZA 1CHOI 3EQ6A 3FIJA 2GF0A 2HRCA 2IHZA 1NW3A 2JFZA 3CLSC 4AI6A 2C4MA 4C7BA 4Q4AA 3GL9A 4BQQA 2BP7A 3CGWA 4J7XA 2PMEA 2VP2A 2JFWA 1HMPA 3Q6MA 2IZ6A 2DHQA 4AJ1A 1WZUA 1ULSA 1DWUA 1G8FA 1DC6A 4H1WA 4Q4JA 1SKUA 2P0EA 1C1DA 2CDBA 1PDVA 1QYIA 2SICE 3EXFB 1D6MA 2VSQA 4LOKA 5GWXA 5H1YA 2GH1A 2DFPA 5FPYA 3U37A 5LFAA 1C30B 4MDYA 2A5FA 2O8BA 3R74A 2H1VA 3JCZA 1SZDA 2GN8A 2HK7A 3DTVA 3ZS9A 4FI3C 4ODIA 2VF4X 5JASA 5B5SA 4Y2PA 3F6SA 1B00A 3UTCA 4R2LA 1YS2X 3M6XA 3EVCA 3VJMA 4B7CA 2I7XA 3OTWA 1JKMA 2OGUA 1F4LA 3M4NA 2ZKIA 1K4MA 1NVVQ 3G13A 3TTUA 4L9WA 4Y0NA 1W29A 1J2UA 4IX9A 3WI7A 1JN0A 2CHFA 5AVYA 1ZHHA 4ZAWA 3H1AA 4XIYA 4YECA 3TCXB 2H92A 3NDRA 2NSJA 4IIDA 4NFSA 4WJLA 3COJA 1W36B 2WSSD 2AV6A 2WMNB 3RG8A 2PN1A 3F74A 3TOCA 4C5AA 1E3SA 3VDQA 1T4CB 4TKZA 2QQ5A 3ZWBA 1RQLA 3ZDRA 4CLRB 2O7NA 3C87A 5JFGA 1UBFA 5EEGA 4ZV9A 3EDRA 5JI3E 5JNVA 1G2OA 3HABA 1NZFA 4XA8A 2CYCA 3L0ZA 3TB4A 5CJ2A 5L51A 3DWEX 3R5BA 1II8B 1L9KA 1P9OA 3L84A 5U4XA 4BZZA 1QC5A 3I42A 4P5PA 2CHQA 1OLXA 4V0RA 5HBRA 1R6XA 2Q1TA 3HUTA 1RWVA 4KR0A 3X2SA 2HFKA 3DVAB 3EZNA 4YS6A 1KH3A 1JR3A 1SEVA 2JIPA 5THQA 4AKIA 2WA1A 3AB8A 3FY4A 3HNRA 3FJOA 1FXUA 3IILA 2ZI5A 1PHRA 3V00A 5DGHA 3WYAA 2AKEA 1XYGA 2HIMA 3GOQA 5CT6A 3DEKA 5EP3A 2IP4A 3E59A 4WRRA 1K5PA 1RDFA 4LZPA 1L4GA 4UJ5A 4S05A 1J0CA 3N6VA 2WT8A 4P9NA 3RSGA 4CMAA 5JI2E 5FEUA 1HX7A 1X1QA 1R0XA 1VKZA 4CHGA 1UKYA 4HXFB 4EPRA 2WWIA 3TOBA 3NKFA 3KV3O 4OJNA 2DQZA 2FJUA 3KLMX 1FFYA 4NU5A 3D6VA 4Y2TA 1IZYA 1JAIA 5FWYB 3TX6A 2R2AA 3ZDXB 1ABEA 3ELDA 3O8NA 4Z4CA 5KYYB 1ZN9A 3KVNA 4YJ3F 2QM3A 2EP5A 2NXEA 4G0XA 4UPEA 4KI7A 1UP7A 1RAGA 2O7SA 4FC7A 4LS3A 3IKJA 4PSDA 4ZQCB 3TKLA 3UGQA 1R74A 2JCBA 4DDVA 5K0SA 3FB1A 3PNQA 5EYPB 1Z0FA 2AZTA 3DOFA 1DX4A 4TWBA 1ATZA 1WLSA 4MW2A 2IYUA 4U7PB 4NE9A 2ZSUA 5G1NA 4KJXA 4DFDA 5JAQA 1USUA 1A8UA 2GCOA 4Y7CA 2WTXA 4YPVA 3G0CA 1ZCJA 5J2UB 4I9FA 1CDZA 3AETB 3WTBA 5MFZA 4G9EA 3MLEA 1TADA 1U4OA 1TCAA 1KEZA 4MVCA 1AUOA 5AK0A 1XMQB 1L1FA 3D7SA 5GZ6A 4IM7A 5IK2D 3LWBA 3DLPX 4HZUB 2V97A 4LHSA 3DP7A 3GF4A 2CW5A 4QOSA 3WK5A 2VSYA 2GESA 3QNUA 1QAMA 2FR8C 1P3Y1 1T3HA 4MV1A 4DMCA 3WLPA 3FFBA 4CNQA 4DBVO 3GLRA 1FTNA 2PUVA 2CGEA 1Z4NA 1WDKA 4E6PA 1Z5GA 1KZGB 3BWDD 1T2UA 1M73E 3TTYA 3D7NA 5HUJA 5JAOA 1ECCA 3UWDA 4A8HA 3KJFA 2MIIA 3ENWA 3GRKA 1N8KA 1DC4A 3IP6A 4LNUA 4A1FA 4OQPA 3TFQA 3GDFA 3GJ3A 5CCDA 3Q3GE 2WFAA 5JSZB 2ZJYA 4HDAA 4II3A 4LC1A 3WL4A 3DMPA 1G21B 3OP4A 5IX8A 2NO4A 1QGZA 5E38A 1AUQA 2C5HA 3DCNA 4RVUA 3WGVA 2C0QA 1MIHA 4B6RA 2YVAA 5T8KA 3JTEA 1ZIOA 1KQGA 1N2SA 3FDXA 4LGVA 1AO3A 1NYTA 1TURA 4BLSA 1NXQA 4NBNA 1BE1A 4C4SA 3JRXA 1Z6ZA 4BO6A 4MQ6A 5M5BA 2VPIA 4D4HA 2PZBA 1Y6GA 1UBCA 5FO0A 4Q3AA 2O5EA 3L0DA 3K72B 1XCGB 3DAFA 4LJ5A 3WGGA 4P54A 5E8RA 3BYZA 4TTJA 5D51S 4ZVRA 1LW6E 4EELA 4Q3EA 1I3CA 1B16A 3E9NA 2ZWMA 1M8CA 4JITA 2XIJA 3MJTA 2C2BA 1K8YB 3GWGA 4UVHA 2ZUTA 1ECLA 1JLMA 1KDTA 4ZD6A 1ULHA 2C1EA 1NUQA 3E7DA 4KX5A 2HO5A 2UVPA 2ZLBA 3MWEA 2Y1LA 1ZD9A 3IC5A 1YIDA 4DT1A 4YJGB 1SVWA 4JI6B 3K0CA 5AM3A 1D1SA 1K8ZB 4O2BB 2IIPA 2PM8A 5AJWA 5FNVA 3WYEA 4WBNB 3P9ZA 4Z8YA 4EW1A 1YNSA 2JHAA 5SZKB 1XQ1A 3VO8A 1DTEA 1O95D 3EVAA 4GZMA 4C6SA 4ACBA 2C4VA 2DKVA 1GLNA 1PWYE 3DBRB 3MS7A 2ZTHA 3FI9A 3I1IA 3OLWA 3V1UA 2QTFA 1Y3AA 4U6NA 3TG8A 3MRTA 4RTJA 5AR1A 4I55A 1BDIA 3R9KA 2J9YB 3I5MA 1G1AA 4U7HA 4CM9A 2PX4A 3PHIA 4I4TF 4J2TA 1NLFA 1Z6XA 2FN8A 2NUAB 2W98A 5JAHA 1UP4A 4MRSA 1RSZA 2DWUA 1P7PA 3JASA 3QJ5A 3K9WA 4R2WA 5GQSA 4GF5A 4PCUA 3WB9A 3BD6A 5HJ5A 2PX0A 1PV2A 1HNZB 1XMVA 2KMLA 5GONB 1OAAA 1LX7A 3SZRA 2ZW9A 3DLHA 4R69A 3ZUGA 3HJNA 3WYFA 4D9FA 2H06A 1NN1A 2PL1A 4ZQGA 4E2YA 4G8CA 1Q0TA 1SO8A 3TTVA 1NXOA 1S2GA 3PUWA 2F4VB 4O5OA 5CT9A 2XWQA 1GG8A 2VDOB 3A31A 1N1MA 3IBFA 5G0VA 2C2MA 1P5RA 3W2EA 2ZUSA 3NRCA 1EGVB 4C43A 3W34A 4CNBA 3HZHA 5J8FA 4DR1B 2FWJA 4GOMD 2DTXA 1AGPA 3GUUA 1P74A 3DWFA 2YICA 3K92A 3V4SA 1LBSA 4YCCA 1XTBA 2H48A 1QH1B 1AGYA 1X70A 2I4T