5FUXA

Catalytic domain of thymidine kinase from trypanosoma brucei with dtmp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
182
structure length
168
Chain Sequence
AHGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTGDTLTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 55
structure length 168
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuxA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuxA01
1DAHA 1W48A 2YZ2A 3CRW1 5C46F 2FGKA 1TU3A 5KYKA 2ZM5A 3Q72A 1SHKA 4AWXA 5EE3A 1KTVA 2LKCA 3TMKA 3CIOA 1F2TB 5CK5A 1XJQA 2LCFA 1OFUX 3RS7A 1E32A 3LD9A 2UKDA 4LV6A 3RWOA 3DOFA 2V7QA 5FTLA 3R7WB 1C4OA 1QVAA 3ZVMA 2MMGA 2HF8A 2RGCA 1DPFA 3BFVA 2OFWA 1WBBA 1CJUC 1Z07A 2YV5A 4LC1A 4UNQA 2FEMA 1W4BA 2GBLA 1JNYA 4TWZA 2GXAA 1US8B 1MRNA 2KBFA 2QMUA 1XTKA 1XPRA 1S8FA 1ZU4A 4UXJA 2ZI4A 3FPAA 4WA7A 2IWHA 4JVMA 2RGAA 4URWR 4NP6A 4JLNA 3WYFA 1ZD1A 3MSXA 3L0PA 2OAP1 3RS3A 1JB1A 3GLIA 3SBDA 2GWHA 4LJ5A 3QJYA 4GOXA 3X1XA 5JZVA 3QXHA 1Z5ZA 4QJ4A 4TTPA 1ZM7A 4PHTA 5JSZB 2VP0A 1L4UA 1T91A 2ZI3A 3N70A 4MKFA 4URXR 4DHEA 4D82A 2RGBA 1RJ9B 1XRJA 3AF4A 4EFMA 1ZINA 1ETUA 1N0VC 1G4UR 4YXWD 4EFLA 2IXEA 2J9RA 2AK2A 4UNSA 4BQSA 1MOZA 1GNQA 2YWHA 4QM7A 1B0UA 1DELA 2OHFA 1CR1A 1YVDA 3I1FA 3ZH9B 2BOVA 3CRMA 3IDQA 5L8VA 3UG7A 4GT1A 3U44A 2RGNC 1DOAA 4Q1DA 3G0HA 3CX7A 3H84A 4MKHA 2X2EA 4RKFA 1KDRA 1Z0DA 3B9QA 1D6JA 3LRPA 5FPSA 1EX6A 4Q9LA 4EJSC 1OLOA 3A1WA 4ESHA 1VKJA 4M8NE 2FV8A 4FI3C 2BM1A 2W0MA 3M4YA 3NEJA 2X19A 2AKYA 2CL6X 4F92B 2Z83A 4JLDA 4P32A 3IILA 1BKDR 5C2JB 1R8SA 1IXZA 1MO5A 2ONKA 1E94E 4KFRA 3WMEA 4M9XA 2AHOA 2ZUDA 2HDNB 1A7JA 1KI1A 1D8TA 2FZLA 5JCPA 3I32A 2G88A 2GJ8A 2Q0HA 4LDJA 1KGDA 1P2SA 4DUGD 2VHTA 1NVXQ 4LJ8A 2BBOA 3VKWA 1T4GA 4OHYA 3ZLJA 1BIFA 4P31A 5BYKA 4EJSB 1II8B 2JIZA 1M1YE 4QHTA 2ZR7A 4V0ME 4B3GA 3TAHA 1IY1A 1QG2A 3DZ8A 2F1IA 1E2EA 3BC1A 2NIPA 3KJHA 3GJ7A 4C0JA 3W9YA 4TZ6A 1D5CA 4D81A 1VHTA 2ZI5A 5FOTA 1R79A 3DZDA 2ZJ5A 1SXJA 2ZR0A 4JBYA 5G40A 4FXPA 3SHFA 4BFWA 4DWJA 2ZU0C 5HCIA 2GEDA 4YMSA 3SE0A 3WYAA 1DEKA 3T5DA 1KI7A 3TIFA 1DAIA 2FDCA 3TVDA 3CM0A 1NL3A 4NMMA 1U8ZA 4BASA 2DB6A 1GNRA 2QTHA 2ZSEA 4TMTA 2PEYA 5EXTA 2CVFA 3KKMA 1P2UA 2QM7A 3IPXA 5KHOC 5DYIA 2ZQ5A 1NIPA 4FWIB 3GLGA 3I3SR 4QJ5A 1HH4A 2PT7A 3K9HA 4TYYA 3SBEA 3RSLA 1UBGA 1G20E 1Z0AA 2K5UA 3CBQA 1N6HA 3QPWA 4HB2A 3R9XA 4C30A 3QVVA 4CEIB 5CDFA 3QXXA 1XPUA 2CL0X 3GLFE 1OYWA 4FWTA 3LBHA 5CB6A 2RH5A 4Q21A 1XMJA 1II0A 3IBGA 3SHWA 3FKSA 2PL3A 2EU8A 3CRQA 3ZVLA 4NYMQ 4XSHA 4WXPA 3CO5A 2ZJYA 4M9QA 3RRZA 4BFUA 1B23P 1HY3A 4DLTA 1KK2A 1GOTA 1L7VC 4N1AA 5GJCA 2WBLC 5FPYA 2FMXA 4A4DA 1U94A 1RYFA 4LBZA 4L15A 1QHGA 4DXAA 2FOLA 5FOXA 2BJVA 3EC2A 2WOJA 2GK6A 2A3RA 2GDJA 3BE4A 3K70C 3B5JA 2G1KA 4DDVA 3TR5A 2IYXA 3H4MA 3A37A 4NCJA 3MGCA 4HB0A 1W36C 2D3WA 3FTQA 1SULA 1AS0A 1QF9A 2P3SA 1XD2B 3EPLA 4OQNA 3GLHE 1E9AA 4PAQA 4QGHA 2V6IA 3CW2A 2WJIA 2CNWA 4MGKR 3JVVA 1G7TA 2AFHE 3GPLA 3M6AA 1EFRA 4JLJA 3TAUA 2ZYTX 2ZI7A 5CLLA 2ENZA 3IQXA 4HB3A 2CCKA 2VHCA 1ZMXA 2J7PA 3DKVA 4ASUD 5KNCA 1I2MA 2W83A 4W5JA 1XA6A 1HEIA 2IK8A 3UATA 2XTMA 1Q44A 4URYR 1GILA 3AKCA 2P5SA 3EWAA 1KBEA 3BOSA 1IN6A 4HAVA 4G1UC 5CYOA 3K70B 2FSIA 4TLCA 5DYGA 4G5SA 3ICQB 3TJZA 3T1TA 1QHSA 5BN4A 4KITB 1EK0A 1W36B 2KSQA 2QBYA 1WRBA 3AKYA 3QSYA 3MG9A 2QPAA 1TMKA 4FW9A 4JLAA 5IT5A 4AG6A 4LHXA 1E79A 1G7SA 2XX3A 2GEVA 2WWGA 4O2RA 2JLRA 4JLMA 5J4LA 5LDDC 3U61B 3KDSE 1P75A 2O8FB 4LHZA 3KKPA 2YJTD 3AEZA 5HKKD 1GDDA 1W5SA 3K0AB 1SVMA 4JKYA 4Q4HA 3WNBA 4DJTA 1PLKA 3I92A 4FD2A 2LWIA 2P2LA 3MD0A 3CH5A 2AD1A 3CX6A 4HUTA 3CONA 3VU9A 5F3WB 1UKVY 4Q4LA 4TQAA 3OEHA 5AUOB 3FMIA 2ZIAA 2P0EA 2IT1A 2HXSA 2YOFA 3CKLA 2ZYUX 2FG5A 2YWEA 5FBWB 1L2TA 5ELXA 1XBTA 3U2QA 2IBMA 1AGPA 3PFIA 2CVHA 2NOAA 3G5UA 2KB0A 3LNCA 4JS0A 4LPKA 3KZ1E 2FSGA 4QG7A 2H92A 2JIZD 1TPZA 4LCBA 1NN1A 2AXPA 3ZD7A 4KVAA 2QEQA 4Z8YA 5JECA 4QBHA 1SVKA 5EP2A 5F9FA 3VR5A 4M0LA 5SZIA 5H68A 1YR6A 1Z8FA 2QGZA 4BLRA 1GUAA 2IXGA 2WAYA 5DN6A 4IVQA 3WNDA 1ZVQA 1NRJB 1IN8A 1E0AA 3KQLA 1RC8A 4FKDA 1T8TA 4OHZA 2V3CC 2NO0A 521PA 4BEJA 4QXAA 1KI2A 5SZHB 1S0UA 4OK3A 2WSSD 2WKPA 4DCVA 3BH6A 1LS6A 4NE2A 3QG1A 2O8DA 4MQBA 2DWQA 1KI8A 4Q48A 4RD2A 2PX3A 4TSFD 2AWOA 1KI6B 4QNMA 2W58A 4TYQA 2HUPA 4A15A 4IDOA 1XEWY 4LBVA 5H8WA 1ZIPA 2G3YA 1G41A 3A1VA 4M1TA 2NO6A 2GZAA 4YLGA 2GK7A 1GKUB 1W49A 1CJVC 2ZRAA 5FH9A 1TL7C 3P4XA 3KQKA 4B47A 3NDPA 5SZKB 1VG0B 3IUYA 1I2DA 1CR4A 4G5GA 1EFHA 1MR3F 5FUWA 2VSOA 3N2IA 5KPDA 5BW8A 1XWIA 4BLQA 4RD1A 4ARZA 5K8IA 2BC9A 1EGAA 4PHHA 3BJIC 4P4SA 4Z1MA 4RSGA 1LB1B 5EXSA 1ZNWA 1FPMA 1V43A 2H57A 3WRYC 1XMVA 1H8HA 3QKRA 1F3OA 2Z4SA 4JL5A 4N0EA 2W6JD 1OHHA 2BDTA 4XVUA 2QAGA 4MGZR 3THXA 4HATA 4D26A 4U5XA 3LW7A 4TN1A 1NVUQ 1UKEA 1E9RA 5DE3A 4PPFA 3JZAA 5KSZA 4C2TA 2QRNA 1FP7A 3HU3A 3O8BA 1HUQA 4ZO4A 3NIBA 2JCSA 5F2EA 2F7SA 3LVRE 2F1JA 1P72A 2J3EA 1A1VA 2JEOA 4JLKA 2O8CB 1NG9A 4DT1A 4GDFA 3PEWA 1E2LA 3K0SA 3GEIA 1VCOA 4EFNA 5DISB 3QE0A 1RRCA 1UDWA 4PQFA 2IW3A 3KJIA 2DB3A 1F60A 3P1JA 4V03A 2J0UA 1FUUA 3KTAA 4ZDIA 3AVQA 4NBSA 4B6DA 1KOFA 4U02A 3CRRA 2C98A 2Q21A 1BS1A 2A5YB 1ZC3A 2O8EB 3QF4B 1R6BX 4LYHA 2YOHA 1XTQA 1PTRA 1N6PA 1YZKA 4A36A 2C5LA 2QMHA 2JLXA 1KO8A 1MO4A 2VHJA 2ZI9A 2FPMA 4PC7A 2BEKA 4RZUA 5BWMA 4AYXA 5E7JA 3PEYA 1XMIA 1GNPA 2ZRMA 3L82B 2WM9B 4I1SA 2WZQA 4LOAA 1XZPA 4I4LA 5BN3A 1CIPA 3DDCA 3FFBA 1BMFA 2J1LA 2QUZA 4PC2A 1H8ED 3ZDQA 4EDHA 1LNZA 1XF9A 1E4VA 3GJ5A 3G82C 4LHWA 2QMOA 5LB2A 3BWDD 1KSGA 5AUNB 1TF5A 2NMVA 2W6ID 3IHLA 2Q3MA 4XD7A 3UG6A 5AUPB 2VTKA 1K8RA 3AVUA 1Q3TA 2GCNA 1R2QA 1S1MA 1W0KA 3CWZA 1KNXA 4HAZA 1S96A 2Q9AA 5EP4A 2R6DA 2JGNA 1TU4A 1YRBA 2QMEA 2OFXA 4KAXA 4D4JA 3OAAD 3BAFA 1N6KA 1ZAKA 4IOMA 3UK6A 3TQFA 2OBLA 4ZPXA 1SZPA 2ZRPA 4KODA 1YE8A 3U7HB 1VG1A 4AY2A 4KBFA 5DLQC 4TT3D 3V4RA 1XP8A 4LYFA 3T34A 3EPHA 3EIHA 2EYUA 3C41J 4UNNA 1CJKC 1CR2A 1PLLA 3T35A 1U2RA 2O8BB 5H1YA 5DN6D 2QN6A 1UM8A 2ZS9A 1S3GA 1U99A 4P4UA 2CEAA 2IS6A 3A1SA 2QT0A 1M7HA 3KQUA 2GVDC 4OQXA 1UJ2A 1W47A 1N6OA 1LW7A 4Z51A 5FI0B 3NH9A 3RRMA 5C1BA 2IF0A 4D0LB 2R9VA 3TW4A 3A1TA 3GLIE 5M04A 2GJ9A 4PTLA 4QL3A 1FQJA 1X86B 1IXSB 1F2TA 3GD7A 3J81k 4IVPA 4CIDA 2ZS8A 4CVNA 1COWA 4KI0A 3QQ5A 3D7MA 3KX2A 2JAQA 3B1VA 1Z47A 2PLFA 3ADKA 3R7WA 5L3SA 1GL6A 4TTQA 2VO1A 4BRWA 1TF2A 2R2AA 2C95A 1NBMD 1OXTA 1GWNA 1TQ4A 3OZXA 4AKHA 4ZI2A 3SR0A 3GEEA 2A5DA 2ZR9A 1T9HA 5CB8A 4JJZA 2KWIA 2BCJQ 3GJ4A 3B2EA 3TRFA 3UWOA 2IX3A 3HYRA 2ZRHA 5BN5A 1N2CE 4B71A 2JA1A 3AUXA 5FTJA 5JJKA 1FAQA 2E9SA 2FWRA 3DPUA 1NLZA 2IYVA 3REFA 1E69A 2HJVA 2X1VA 2JLWA 2PT5A 3N5CA 1TTTA 1DVRA 2ORIA 5EXXA 3CF6R 1GAJA 5JSZA 2PZGA 5JRJA 3DVLA 2IYUA 4TL8A 2CK3D 1WB9A 3WRXC 3W6PA 1Z6TA 1RJ9A 1RVDA 3FDIA 5EP1A 1M7GA 1FFHA 1E1RA 4AK9A 4G5OA 1ZNZA 3N2EA 2WPDA 1WDTA 2FFBA 1AK2A 1JJVA 4Q4AA 3OIYA 3CPJB 2A9KA 2DYKA 4HAUA 2TMKA 4FN5A 1J99A 4LK2A 4OI2A 1OV4A 2NQ2C 3LLUA 3EARA 1FP6A 1G3IA 3LX8A 3TKLA 4AIIA 1U9IA 4Q9IA 3O47A 2GCOB 4H1UA 3NBXX 1BOFA 4F38A 1BYUA 4MGYR 3E2IA 2RAPA 2WMOB 1SVWA 4QNRA 3W3ZB 1HQCA 4WZ6A 3PEVA 1E9CA 4OQLA 1JI0A 1KK0A 2QAJA 1KAGA 1ZD8A 3CNNA 1GZSA 3THWB 1LS1A 2YNMA 2GCPA 3C8UA 4DLRA 3HR8A 3ADBA 4TMKA 2XJ4A 3QIAA 2QTVB 3LXXA 1P9WA 2QNRA 1R0XA 4RD3A 1IN4A 1Q1BA 1BMFD 5FI1B 2CJWA 4Q03A 5UKDA 4US2R 1XXHE 2FSFA 3BFKA 1KO4A 5FR2A 3ZQ6A 2I1VB 4NU0A 2X8AA 4MRNA 4IFEA 4CT5A 2AN9A 3SU8A 3IKJA 4B3CA 1UAAA 2D74A 1G19A 1NVVQ 2F43B 1WQ1R 2XNDA 4FMBB 5FL7A 3T1QA 2EW1A 3UGLA 2FJUA 4KSCA 5TVKA 4A0FA 1VCMA 4OK5A 5IF9A 3GLFB 1U8YA 5F98A 1QHIA 221PA 2GJAA 4CYMA 3MRSA 3LO5A 4TL7A 4WBSA 3EAQA 3FYHA 1IONA 2VL7A 4OJQA 3R9IA 3VMFA 1WCV1 2CLCX 5EUQB 2CHVA 1JR3D 2KBEA 3MJRA 2IWRA 5KUTA 4IHQA 2QE7D 2B92A 4BZXA 2PEZA 1X1SA 5B30A 4RD0A 1DAMA 1KK3A 4HLCA 4CGZA 5A5GA 3UEJA 3FOZA 4GP6A 2A5JA 1NSTA 4LBYA 3ZVRA 4D4LA 2DFTA 4Z54A 1RKBA 4C7OB 1P62B 3W6OA 4NL4H 4BUJA 4A1FA 2XSZA 1TBNA 3THYB 5KU1A 3TLXA 3ZS8A 2J87A 2ORWA 3OIWA 2W2TA 3QUSA 3U3MA 1WMSA 1G3RA 2WV9A 3ICEA 2F9LA 3X1ZA 1XTJA 3NBZC 5TARA 2JJ1A 4AI6A 1E4YA 3FKQA 4GOJA 1E1QD 2OUKA 3VR1A 1IJEA 3FFAA 3CR7A 4P3YA 1DO0A 4BECA 3RDPA 1IY0A 1H65A 3D3QA 3LWNA 1XEXB 1KBFA 4JSYA 4LC0A 1W7AA 2VF7A 3NEYA 4KJZA 1AKYA 3OESA 4FCWA 4N3NA 1PTQA 2G0TA 4D2IA 3K09C 4M53A 1PUIA 2IEZA 4NYMR 5JHGB 1M74A 3UKDA 3AVTA 4GL2A 3I61A 2ODNA 3SQWA 3TGPA 3MMPA 3OEEA 4U00A 2NGRA 4NYIQ 4ZIRA 3KUCA 1T0JB 3GQBA 1JAHA 5GJVC 1OXVA 1OFIA 4S35A 2BWJA 5BYJA 5FPKA 5AJWA 2FPLA 4IEEA 4ZCMA 4HDCA 4DIEA 2IHYA 2ZRDA 1Z0KA 3CWQA 4D0NA 1EFUA 3SN6A 4HUQA 1AQYA 2Z6VA 2D06A 4DLWA 1U0HC 2UVQA 1CULC 1OFTA 3MUFA 2REXB 5IK2D 3EASA 2XZLA 4OHVA 2ZANA 4IDPA 4AKGA 3K0FB 2A30A 1DO2A 1Z29A 5LPNA 2QM8A 3BFXA 4JLOA 4TTRA 2CE7A 1ELOA 3NWJA 4NZYA 3RSOA 1XU4A 1AQUA 4ZCIA 3NXSA 4AD8A 3UGDA 3K0AA 1O87A 1XD8A 4XTCS 1T0HB 1DADA 1O3YA 2VP5A 1KSJA 2N42A 4Q1AA 3ZIAA 2XGJA 3ZS9A 5FBLB 3K9NA 1CBUA 4LYAA 2C03A 2HCJB 4LY6A 4JKIA 3EIEA 4IKEA 1GL9B 4HLQB 4QM6A 3FHOA 3W34A 2GXUA 4JSTA 2BBWA 1E6CA 1RRFA 2WMNB 3K0CA 2EFCB 1NKTA 1QHNA 3I8SA 2IHBA 1C1YA 3TE6A 1SVIA 5JHHB 2C04A 2RGEA 5KSYA 4HLUA 4LHVA 2F3TA 3I4LA 2B7BA 4FCVA 3ZZUA 3L43A 3IQWA 1NBME 5D3QA 1QHYA 2Q9BA 1KI4A 5LBIA 4C0BA 3IIMA 1KSFX 1SHZA 1ZBDA 3VR2A 1UBFA 1YR9A 3QNUA 1FQKA 3I5YA 1TAGA 4R71A 3WBKA 2ENNA 2OSBA 4PHGA 2MSCB 1IHUA 3WBJA 3JZMA 4GZLA 2GRJA 1UDXA 2UZIR 2PMKA 4G0NA 1E0KA 2CCGA 5KTYA 1YZNA 1ZNYA 4B48A 3FMFA 3VQTA 3F3YA 1U81A 5D3MB 4P4TA 1JPJA 1MO3A 1T3HA 4DLUA 5AJYA 2V6JA 1OPXA 1Z6GA 1G7RA 1P9RA 2AL7A 4IXMA 4TLBA 1OH8A 1A2BA 2QENA 3BH0A 2NO1A 4PXAA 2KI5A 3UFFA 1RRGA 2ZSFA 4ZCLA 1E0SA 3SYKA 2G1JA 1I4DD 1G17A 4ZI3A 1WBDA 2XNSA 1Q12A 5P21A 1W4CA 3NH6A 2AFIE 1W46A 4RD4A 2ZRFA 4Q01A 3X1YA 1GKYA 2PH1A 1HURA 2ECKA 3DM5A 2B8TA 1KI9A 2C96A 2OCBA 2J0SA 1X6VA 4YDHB 1X1RA 1RE0A 3KB1A 2XXAB 2XEXA 5KPJA 1VCIA 3GCGA 2ZJBA 4Q19A 5KO2A 3B6EA 2YHSA 4MRPA 2D4HA 3B9PA 3U60B 3CB4A 4JT2A 3QXSA 3SYNA 5JJIA 1CP2A 1GM5A 2I1QA 2V7QD 2C9YA 3RLFA 3GMTA 3W8NA 2CDNA 3C15C 3HWSA 3QY0A 3C14C 4KHZA 3OEED 1G5PA 4YDSA 3UPUA 1RIFA 2JJ2A 2WWFA 4MRVA 5JBQA 2O8CA 3IO3A 4LBWA 4NYJQ 4M4SA 1TQDA 1UBCA 2GBLC 3BJIA 3HPQA 4OI4A 1Z6XA 3NBFA 4B32A 4CDGA 4L16A 1KDPA 1CJTC 3RS4A 2ZTSA 3ND9A 3A36A 2ODBA 4Y0AA 5FFMA 2F9MA 4KXFB 4PHFA 2H18A 2O8EA 3QF4A 4KYUA 4A6PA 1EESA 1AKEA 4MITA 1VYTA 1WP9A 4OHXA 4BRUA 1N6LA 2W2VA 3AGQA 1F5NA 1JR3E 4B3XA 3AVVA 4BLOA 3EA0A 3HU1A 3B1YA 4W5HA 2CE2X 1ZUHA 2WJHA 3DMDA 2GF9A 5CIWA 2PZEA 2ZRNA 1MO6A 3UMSA 2ZRKA 2AWNA 4ZDKA 4EPWA 1ZC4A 1NMXA 1XNJA 5JEEA 4JLPA 4A9AA 2B8WA 1D9ZA 4ZKDA 4L4UA 4WVFA 5AJZA 5KNBA 1G8YA 2J41A 2FFAA 1OXXK 1KMHB 2YWFA 4IOLA 1S9DA 5JS7A 5E4FA 4RY2A 3ADCA 4JIMA 3NVAA 2XTZA 3WMGA 1N6RA 2VP6A 5BXQC 1ZM9A 4WAUA 4HZIA 1NLYA 1T3LA 3SJBA 3L0SA 3GLIB 4I1VA 2OM2A 4NCHA 3H2YA 2JATA 3A8TA 4LJAA 3LH5A 1G16A 3CLVA 1GG2A 2J59A 4E07A 1M6NA 3HPRA 2R6AA 4KBGA 4Q47A 3EW9A 1MRSA 2VYFA 2H1LA 2DFNA 1ZNXA 4PANA 4Q1CA 3FHTA 5DO9A 3OFNA 4OKSA 2ZXUA 1T3SA 1ZIOA 2V1XA 1G1MA 1G8FA 3AP3A 2JLQA 2GXQA 1P6XA 1UFQA 2J0VA 1CU1A 3K0EA 5HE8A 2FNFX 3RVBA 2MSEB 3NDBB 4M21A 4TMXA 1VDZA 2XOKA 1OKKA 1F2UB 1OW3B 4FMDB 5J4HA 3LFUA 2OBMA 1EWRA 1UPTA 2IUSA 3SS8A 5GJBA 1VIAA 1OXUA 4OL0A 2ZJ8A 4D0GA 3U4QB 1AIPA 1WA5A 1P7CA 5FOSA 3UXMA 1Y8FA 1HV8A 5G3ZA 4C0AC 4CW7A 1X3SA 3I5XA 2BMJA 3LX5A 2PLRA 4PO1A 2ODWA 1OF1A 4RKEA 4F93B 4CEJA 3HDTA 2V54A 3BGWA 1SXJD 3B1XA 3LXRA 2OCPA 1DG1G 1NLFA 5GJWC 3CZQA 1Q20A 3VX3A 1SXJC 3CZPA 5HZHA 1KYIA 2E1RA 5KNDA 4XWKA 5KDOA 2VIIA 1KO7A 3AF0A 4DDUA 4IOKA 4XOIA 5EJEA 1Q57A 3ETLA 3T12A 2OV2A 4UJ3A 5FUYA 2EYQA 1XFAA 2LKDA 4URVR 4DRZA 4B44A 4BFZA 1W5TA 3U3OA 4D4MA 3PIRA 1S3SA 2I4IA 1E2HA 2H17A 2MSDB 4BLPA 1ONBA 1NNEA 1TBOA 2WVJA 4JVLA 4F4JA 2JASA 4DLVA 5HR5A 1U90A 3U7GA 3PCRB 4DKXA 4TLDA 1SXJB 1J70A 4M1YA 1W0JA 4RJLA 3FKSD 2FFQA 5A4JA 3MLEA 4RVCA 4CEHA 4OBEA 1XDBA 2CHQA 2VP9A 2YVUA 1PUJA 1MABB 1TQ2A 4B35A 3DEFA 4DSOA 3T06B 4G3XA 3EC1A 1XXHB 2FFHA 2FSHA 4LUCA 1TUEA 1JQLB 4M1SA 4HAWA 1AGRA 3A4NA 4CZ2A 2ZU6A 4QBFA 1CF4A 1E9SA 1JEDA 4AG5A 1YRAA 2GA8A 4JJKA 1LVGA 5CK4A 4OQMA 4GBMA 2REBA 3K9GA 3F0TA 3TUIC 1J8YF 1N25A 1N6IA 1GRNA 2J46A 2GCOA 2JDIA 5DSZA 3CNLA 1G8GA 2IYQA 1GTVA 2PCJA 4TZ0A 4EIWA 1SKYE 3IHWA 4EPYA 2AKAB 2CNWD 2VLIA 5C18A 1EFRD 2QRZA 1OIVA 1ZRHA 1SQ5A 3PR1A 4UNPA 1EFCA 4GMDA 2WICA 1L4YA 1XCPA 3NTUA 3THOA 2QROA 3ZYCA 2FNAA 4B6EA 4B75A 4BWYA 2J7PD 4WZAE 1I4LD 2QPTA 1FZQA 3U6BA 3LVQE 2HLDA 5CLQA 5DI3B 2ZREA 4R2IA 4HEJA 4LJ9A 2YKGA 2ZSDA 2DFLA 4HAYA 2F43A 4A8JC 2P6RA 1FMLA 4JZKA 4C0HA 4DLZA 2HV8A 1Z2CA 1Q0UA 1Z2AA 1E79D 821PA 3E5HA 3RC8A 5JMTA 3GLFA 2CHGA 3S1AA 2NPIA 4K8OA 3TSOA 1G4AE 2IS4A 3F8TA 2Q6TA 3OE7A 1E2GA 4L8GA 4TMWA 4EQ6B 2WKQA 3B78A 5E7IA 2IUUA 1DE0A 4X8LA 3UGIA 2ANCA 4PR0A 5HE9A 2BKEA 1ZW6A 1D2MA 6Q21A 3OEHD 1E99A 1G7CA 4LV5B 3FE2A 4DB4A 2D7DA 1NVVR 2F1RA 4UJ5A 5G41A 1P2VA 5J4YA 1IXRC 3KUDA 3NC0C 2P67A 3AUYA 3L2OB 2ZYWX 1YHNA 4A8JB 5JI3E 3AF2A 5JCZA 3QKTA 2QBYB 3A6PC 2GEUA 4Q1EA 3H0KA 4RFSA 4ERNA 2Z43A 3THYA 1FX0B 1GSIA 2GILA 2HEIA 3B7GA 3RAPR 4PPQA 3E1SA 2ATXA 2AR7A 2BVNA 2ZE6A 3GLHA 4XSGA 1A4RA 4MUBA 4Q4HB 1N5IA 3W3AA 4FMDF 2B21A 1ESNA 2QSYA 4BGDA 2VSFA 1W4AA 1R0ZA 2CLDX 2V8OA 3VU9B 1XJ0A 3QBVA 3VKHA 3QPVA 1QHHA 1LY1A 2JLSA 3AVOA 3LV8A 5DH9A 2BJWA 3U7EB 4P33A 2GAAA 3BXZA 3IPYA 3QF7A 4KO8A 5FPHA 2IEYA 5JS8A 2ORVA 5TDHA 1Q1ZA 5LB4A 1XEXA 4OI1A 1ODFA 3EA5A 4GNKA 4G5RA 1YZGA 2VP4A 4O2LA 1T5IA 4B3DA 1NY5A 1XTRA 2PX0A 4JMPA 4F7WA 1UADA 1E2KA 5JJLA 3O8DA 1IQPA 2ZRIA 3CUEF 5TV2A 4DEYA 1NSFA 2ATVA 3SJCA 4FMCB 1JAIA 2PCLA 4E22A 5J4KA 4I1OA 1E96A 4WW0A 3GFTA 4RCYA 4C0QC 4BFYA 2WOOA 2FF7A 1GITA 2NTYC 3MWYW 1OH5A 1US8A 2IF2A 3O8CA 4DC9A 3DKPA 2YC4C 3BORA 4Z1MD 3DOEA 1G3QA 2GZHA 2ZITA 4IEIA 4NH0A 4Q7LA 5C4MA 4B33A 1PLJA 2GZDA 4A6XA 1XZQA 2O8DB 3U5ZB 4C0KA 1IBRA 1H8HD 2DR3A 4DB2A 4HB4A 3BERA 3E70C 2RHDA 1OHHD 1FARA 3OF5A 4JYBA 4RFVA 4HI0E 3FWYA 4CT4B 3A1UA 1F6BA 1KMQA 1W1WA 1E9DA 4NYIR 1KJZA 4RZ2A 2VF8A 4BPBA 1M2OB 4TLEA 2NZJA 1OB2A 3SEAA 3B82A 1JALA 2YYZA 1KJYA 2IYYA 2ZRBA 5FOVA 3SQXA 4F91B 2G6BA 1KO5A 2ZRGA 3C5HA 3WP0A 3CPEA 2OE2A 2BKUA 1G8PA 4DVGA 3NC1C 3SYLA 3ADDA 4K46A 1CTQA 4DSTA 3CH4B 1D2NA 4R98A 2ZI6A 4LJ6A 1CR0A 4Q1BA 4TYPA 1QBKC 5CM8B 5KDDA 3QKUA 2QA5A 1LTQA 3QKRB 1IOZA 1YQTA 1OIWA 3MAAC 1OSNA 3THXB 1QZXA 2O0KA 1SXJE 1CJMA 2DWOA 2J5XA 1AM4D 2HT6A 3CPHA 4MUAA 5IDVA 4RZ3A 4M22A 3KJEA 3LBIA 2P6NA 4UQOA 2ONJA 4GPTA 2ZVQX 3WHKA 4YXWA 5EE9A 2OILA 3OIVA 1R5BA 4L5BA 4TQUS 4C2UA 1R10A 3R20A 2RHMA 1AJEA 2AXNA 2RGNA 3EPJA 2CCJA 3B1WA 4NPHA 4OHWA 4V0OA 4DCUA 1P60A 1TEVA 5TMPA 3GLGE 3AVWA 1CRPA 1Q22A 2NPFA 4XD7D 1G64A 4KSBA 1XTIA 4EJSA 1II8A 3QPUA 4LZZA 4POAA 4Q7MB 4QOSA 2R62A 3GFOA 5G3YA 2XZOA 1VMAA 1W0KD 2V55B 3OHMA 4YMWA 4NCKA 1WXQA 1ZD9A 5CDFE 1FOEB 1R8QA 121PA 1KHTA 1JJ7A 4EPXA 1TF7A 1CEEA 4US0R 5D3MA 4NTZA 4KCGA 2ZVPX 2FE4A 3TQCA 1FUKA 4AURA 4UXIA 2H7VA 4A0GA 4Q7KA 2EWWA 3QXCA 5JRZA 1E2PA 1NJGA 3EZFA 1DG3A 4KFTA 3EXAA 4V02A 5DI9A 3ND8A 1BO6A 4B6FA 1AZTA 1Q3HA 3L0OA 3VHXA 3P20A 2ZETA 4DUGA 2P5TB 1JECA 1P9NA 3BRWD 4ILEA 2WHXA 5DGXA 4BFXA 1KK1A 1P61B 3KL4A 1G8HA 3VR4A 1HT1E 2NG1A 4X8HA 3W8RA 5JWRA 4I99A 2D7CA 4HZUB 4YQFA 3Q8XB 4NKRA 4B76A 1SVSA 4EKDA 4W9MC 1XPOA 4US1R 4E09A 1F48A 1XEWX 2Y8EA 4MRRA 1Q1EA 4LYJA 1BH2A 3ZD6A 1XX6A 1ZM2A 4CEIA 4R9UC 1Z3IX 2RKOA 1PVOA 1SKQA 2FZ4A 4DZZA 1RPZA 4BZPA 2ASEA 1E98A 1KDTA 2G0NA 2RGXA 3T1VA 1MH1A 3KKOA 3I62A 3CF0A 1XJCA 1GVNB 4B2PA 2D2EA 1COWD 4I1UA 2ELIA 1IJFA 4O3MA 4D25A 5AR1A 1DBSA 2BMFA 2OCAA 2XZPA 3RRNA 4IDNA 2JLZA 3U7FB 3VX4A 3WMFA 3UEYA 3RYTC 5L3VA 1FMJA 3A4MA 2EQBA 2NZ8A 3V4FA 2YC2C 3SC3A 3HR7A 4WIAA 4FMCF 4DIDA 1EX7A 3EZ7A 1NN0A 2WWXA 4HSEA 4ACBA 3VR3A 1XD2A 1GRRA 3VTKA 4C0LA 3ZQJA 2QGNA 1J8MF 5GVSA 1TUIA 2OBNA 1IM2A 3LQQA 4TL6A 2OCYC 4ESVA 1ZJ6A 2JJ8A 1ZP6A 1K5GA 4Q1FA 5J5CA 4Q4JB 4B34A 5GADl 4NCNA 3X1DA 2IYTA 1G6HA 3VKGA 1DAEA 4TMVA 4GSYA 1VIYA 4DCSA 5KOYA 2WSMA 4NYJR 1VYVA 1E1RD 5JLJA 2WJJA 1KI3A 1FNMA 5L3SB 5JWOA 2WPDD 1YZLA 5CM9C 1OIXA 3VR6A 5B58C 5J40A 4URUR 4A2QA 3UWKA 3VHLB 3TUJC 4PSAA 3MCAA 2ZROA 1KMHA 4LI0A 4RD6A 1TADA 1U9IC 4G5QA 2A5FA 4M1WA 1N0UA 3UIEA 4ACAA 3B13B 1K5DA 3FGNA 4GZMA 5FTNA 4E5UA 2WTUA 2FA9A 4JLVA 1RRPA 4PZLA 1KAOA 4XVQA 1YZTA 3SFZA 2O8FA 1KO1A 2CBZA 4WOPA 4AKEA 4DLSA 3ASYA 1Q1QA 1Z63A 5DNYB 1MT0A 2QPOA 5FBQB 2R8RA 4EAQA 3K9LA 3GP8A 3ZZTA 3MWLA 4UKDA 2EFGA 1ZYUA 4JBWA 4DBLC 3MWKA 3RS5A 5EE5B 1HA3A 3K53A 5EXPA 1KKMA 5HTKA 3ZJYA 4ASUA 3T15A 3H86A 4B2LA 1ZU5A 4Q4AB 2SHKA 2ZEJA 4MH0R 3R8CA 4Q00A 3GEHA 2XJ9A 5TY0A 3X1WA 2D62A 2YUUA 1KKLA 2GETA 1MV5A 4QC2A 2G9NA 1A5TA 2DWPA 3IO5A 4AC9A 5H70A 1Z0FA 1HTWA 3B60A 3GJ0A 2XNDD 1YR7A 3GJ6A 4IW3B 5FL7D 1F2UA 4BLTA 1KY3A 1YU9A 3EWSA 3RC3A 2GJKA 2R6CA 1JBKA 3FVQA 3W5JA 3P4YA 3U4QA 4TYWA 5TB5A 1OJLA 3BH7A 3B8HA 4TQ9A 5EE0A 4LGMA 5HKKA 4OK6A 3I8XA 2RCNA 3IEUA 3FMPB 4BFTA 3U6KA 2OAQ1 3SNHA 1KIMA 3DO6A 4KLZA 4B3BA 4MYCA 4V0KA 3KY9A 4XIGS 2QY9A 5ANRB 3QXJA 3L0IB 4KFUA 2CJWB 4TL9A 2WIAA 1YZUA 5FOUA 2JLYA 2FH5B 3L8YA 4IRUB 4NHOA 4C9BA 2CLSA 2QI9C 4LRWA 1KI6A 1N5LA 3KFXA 2ZS7A 4MKGA 5KSPA 4DCTA 2CL7X 2ROWA 3U3KA 2XSZD 1R7RA 4LSGA 1GL7A 2Q3HA 2VHUA 2QP9X 3QKSB 2N1BA 3HP1A 5CYPA 2ZJ2A 4XH9B 3BB3A 1Z83A 4PSKA 3RNLA 2EFHB 4KV9A 2QSZA 1SKYB 2ODEA 4O25A 1ZUNB 2VQSA 2E87A 2B7CA 4PZYA 1R0YA 3IGFA 2JJ1D 2EVWX 5L3QB 4J0QA 2IS2A 3A4LA 2ZE7A 1FW6A 1X8JA 3LBNA 4Q9KA 1MABA 2WSSA 3DM9B 1R5NA 4LV8B 1UEJA 4FCTA 5TXGA 4BFSA 5CITA 2Q3FA 3W5IA 1XXHA 3PV0A 3B85A 3Q7QA 4PAOA 4TSFA 2V4ZA 721PA 3R8FA 1OH7A 5L3RA 1M8PA 4W5WA 1NMYA 4QFMA 3RANA 3IBYA 4E03A 3TH5A 3D31A 2DHRA 4DSUA 3WXMA 1WE2A 2VRWB 2CMKA 3AB3A 3Q9LA 3MWJA 1T8UA 3EX7C 1P73A 3KXIA 1NJFA 3Q7PA 4NONA 2HJGA 4S2EA 2XTNA 3PXGA 2I3BA 4K81B 4LHYA 1G3MA 2WAXA 1GRQA 3QI2A 4A2PA 1YZQA 4TMZA 4P0TA 1KDOA 2MMCA 1Z0IA 5EQTA 2A78A 1E0JA 5AJXA 3AGPA 3T1OA 2ZSAA 3AP1A 1E9FA 2ZRJA 1N6NA 3RS2A 3C7KA 3C5CA 1GP2A 2AX4A 1LF0A 5FL3A 2FX3A 1VG9B 4H1VA 3D6TB 4HDQB 3TW8B 2DPXA 3IIKA 4KU4A 1YKSA 3CNOA 2AK3A 4PQYA 2W6JA 3PUYA 1Y63A 5FUXA 4L9SA 1D9XA 4KFSA 1S9HA 5DI3A 2OXCA 1IY2A 1X8KA 2J0QA 1QHXA 1G5RA 2W00A 5AUQA 3K70D 1CLUA 5IHPA 4F4CA 1DS6A 2IXFA 2ZAMA 2Z5FA 1W36D 1EG7A 2PJZA 4ZIRB 1G21E 3TBKA 3PG5A 2BM0A 3RHFA 2XB2A 1VYUA 2A7QA 4KLNA 1NY6A 3UMFA 2BMEA 3TK1A 4EQ6A 2WWYA 4M2LA 3VAAA 5IRCD 3PUZA 5FOWA 3ZIAD 1HQYE 3D8BA 4PO8A 621PA 3REGA 2B6HA 4A92A 3TVTA 2F1HA 3GJ8A 1Q21A 1DARA 4MYHA 4HUQB 2IYRA 3T5GA 4XVRA 3CX8A 421PA 4C4PA 2GJSA 1OFHA 2WJYA 4EPVA 3LDAA 3WHLA 4PPGA 4A8JA 1TX4B 1AS2A 4IDQA 2ZUBA 1P4SA 1OH6A 4ITRC 1S4QA 3LW8A 2C99A 1H8EA 1W44A 3K0CC 1ZCBA 4XWOA 2R44A 4TYNA 1G291 2WKRA 4Q7JB 1FX0A 2WJGA 3AVXA 1DAFA 1HYQA 3SFVA 4HLUC 3U44B 2O8BA 4PSVA 4MDFA 4AYTA 2IYWA 3P32A 4WXRA 3PITA 1KZ7B 4HYYA 2BHRA 3T61A 1QG4A 5HZKA 2QT1A 1VHLA 3MJHA 4QJ3A 2W6IA 3LQRA 4MDEA 2YINC 2ZUCA 2DFKB 1IAQA 1SGWA 1UEIA 2QORA 4YONB 2E73A 3CRVA 1TEXA 2R6FA 3NHAA 2PMDA 4MYUA 2QU8A 2VHQA 2W2XA 4DLYA 2BBTA 2GESA 2HYDA 1OB5A 3DHWC 3ECCA 1P5ZB 2IC5A 3OAAA 2JLVA 5B64A 3RS0A 1GKIA 4V0NA 1PV4A 2ZE8A 4IXNA 1CKEA 1NKSA 1Z22A 2O0HA 2ZAOA 1C9KA 2BCGY 1E2IA 2H5EA 4QHYA 4TT3A 2VSXA 2IYLD 3NBYC 2WWHA 1NI3A 3VFDA 4DCNA 4YMVA 2H16A 1DAGA 4AKIA 5A0FA 4YC7A 1HT2E 5CJ2A 3LY5A 1AN0A 1G9XA 2G77B 1Z08A 2ZRLA 5CJPA 2Q9CA 1NMZA 2DY1A 2ZJZA 2ZJOA 2QG6A 1R4AA 2XB4A 3UMRA 1X8LA 4QGFA 3L8ZA 4PC6A 1J7KA 2KJQA 4JVSB 3AVYA 4LJYA 4C3ZA 4D6PA 1FNNA 1R0WA 2UZ3A 1SVOA 1KY2A 1RW4A 4YMTA 3KXLA 2IS1A 1T5LA 2GF0A 1I4TD 2HF9A 4MA4A 4PO9A 3QOFA 4MGIR 3KQHA 2FN4A 3Q3JB 3AKDA 2FGJA 4II7A 4NCIA 3SDZA 3V9PA 1QRAA 3ZVNA 2DBYA 1W2GA 2JJ2D 2BMDA 3VNVA 3GLGB 1NBMA 3IIJA 3EZ2A 3DMNA 3Q5DA 1E2QA 2REOA 5HPYB 1J90A 2EWVA 4Z8XA 4V0MA 4YMUA 2NO7A 5KSOA 1KNQA 4JLBA 1XTSA 2RMKA 3LA6A 3EIQA 2BIFA 3BB1A 1JXMA 4BZQA 2IL1A 2IYSA 2RGDA 2W0SA 4DLXA 3WP1B 1WF3A 1TNDA 1L8QA 1OXSC 2Z4RA 4DEXA 3THWA 1XCGB 1U98A 1ZM3A 3PVSA 4KYIB 2C2HA 4GMXA 4ZKEA 3I73A 2CK3A 2D2FA 1E9EA 3SI7A 4FINA 3SZRA 4MYTA 4RZXA 2QQEA 2X77A 4M1KA 5SZJA 4G01B 3BS4A 2GVZC 4GOKA 4R2HA 1LF5A 1N5KA 1HE8B 4UNRA 4DDWA 1VTKA 2WWIA 2C9CA 3KKQA 3O8RA 4U7DA 4HLDA 1AZSC 4GRAA 3Q85A 4M1MA 4PC1A 2ZJAA 4A0HA 1II9A 4MKIA 2QL6A 1RZ3A 1ZUIA 4A2WA 3BD9A 3ZZ0A 4W7SA 2VA8A 3P27A 4RCZA 1RFLA 3TUZC 3LLMA 3OFND 3U3JA 1QDEA 1U8AA 3C4JA 2OFOA 5DHAA 3HYTA 1FTSA 4F4IA 3BK7A 1NN3A 3KFVA 4AYWA 4B73A 5B57C 3QVUA 4URZR 3FHCB 1SVLA 1R5OA 4O0MA 5EZ5A 1N3BA 5BQ5A 2BEJA 2BV3A 1XCMA 3BBPA 1VG8A 3AQ4A 4D80A 4OYHA 5HCNA 1Z6YA 4NDZA 3AV0B 2FPKA 2XOKD 3UANA 2O52A 1OKKD 2HCBA 1S1CA 2AD5A 5G53C 4C7OA 3KXKA 1W4RA 4HZUA 3EG5A 3SOPA 1HE1C 1RFHA 2GAOA 1ZCAA 4QHSA 4ZDJA 4XJXA 5FBRB 1ESMA 1DTSA 5K8TA 5E95A 3K1JA 3AM1A 2C78A 3MFYA 4L9WA 3SJAA 2VPPA 3OIUA 5J4VA 1MKYA 1JR3A 5EP3A 4C0SA 4PAMA 5E7MA 2FU5C 2GHIA 2ZYVX 4QGGA 4QKQA 1NN5A 2OESA 2QE7A 4JL8A 3PENA 5B2ZA 3Q5EA 2O0JA 4B43A 2P6UA 3I72A 4D4KA 1UKZA 3QG5A 1GIAA 2J7KA 3ZGXA 4GP7A 3RWMB 1Y3AA 2PJRA 5C4GB 1V5WA 5EUMA 1S2MA 1Z0JA 4R7ZA 1W2HA 1UBEA 4Q02A 4HAXA 3P26A 4JL6A 5JWHA 3AP2A 1OT3A 4LWZA 4M1OA 4XTRA 1G6OA 3AF1A 1N0WA 2F55A 3K8YA 5DIFA 2L0XA 3QBTA 3CF2A 2ERYA 2CXXA 2X2FA 3FMOB 2VEDA 4QGAA 1Z6AA 3NHBA 1NVWQ 4CEJB 3IEVA 1T6NA 1XMSA 2J45A 1RYHA 1LFDB 4HDOB 3CXLA 3AH8A 1W0JD 4X8OA 4B2IA 4A0RA 4JYCA 4LJ4A 1AA9A 2XAUA 1NP6A 1A2KC 4Q4JA 1XB2A 1DAKA 1E1QA 3HU2A 2VBCA 3ONWA 4Q5IA 5FR1A 1JR6A 3GJ3A 3W6NA 4DSNA 4X8MA 4WZBE 3EPKA 2OLJA 4M9ZA 4QBIA 1KSHA 2V1UA 2ERXA 5DHFA 5FTKA 3KKNA 4KVGA 3BB4A 1XEFA 1UF9A 5E3HA 2QAGC 4IFBA 1A82A 3V00A 4I81A 2FEOA 3K09A 3DL0A 2HT1A 3FB4A 5JEDA 1E9BA 2O5VA 2XITA 5FUVA 2DCUA 1ANKA 1YJ5A 1FL9A 2JDID 3K0FA 5JI2E 3JVUA 4B3FX 2ZSBA 4LJ7A 2NO9A 4OI0A 4ARZB 3AKEA 4CEHB 4OJKA 3U3RA 2EFEB 4IJMA 4P4SB 2RB4A 1Z28A 4IOJA 5EE1A 3H1TA 2VH5R 3PEUA 3R9WA 1GFIA 1JQJC 3SJZA 2OG2A 1K6MA 3RRYA 1AS3A 3PUVA 3ASZA 1BYIA 2JLUA 2QP3A 5K8UA 1ZM4A 2HLDD 2QAGB 2OXRA 2OEPA 2GNOA 4ABYA 3X2SA 3TSWA 3EZ6A 4ZDWA 1NF3A 1P3JA 1E2JA 1M7BA 5IK2A 5LD2C 4Q9JA 3PUXA 3WYGA 4Q18A 1PZNA 3M1IA 3PUWA 2F3RA 2IA5A 1UKYA 4DT1B 4DDTA 4BE7B 2IYZA 2KE5A 1JXOA 1M34E 4ON9A 2GVIA 2WWWA 1NIJA 3A58B 8OHMA 1CS4C 2GKSA 1FTNA 2G83A 3AF3A 2J0UB 3OE7D 1G18A 4H9GA 3KTAB 1Z06A 5AK0A 3WY9A 3PJRA 4EPRA 3M0EA 2QZ4A 4IDHA 5KDLA 3CR8A 5CIQA 1OYYA 1IN5A 1KJWA 2R65A 3PQCA 4EUNA 4TLAA 1EWQA 2ZPTX 2QQ0A 4BLSA 2IUTA 2P65A 3B1ZA 5JFGA 2C9OA 2HXYA 5F9HA 3EZ9A 2C77A 1E2DA 3KJGA 1TQ6A 4MRSA 1CRQA 4Y0VA 4XWAA 4JVNA 5FTMA 2HYIC 3TSZA 2QP4A 3GFPA 5AJVB 1VPLA 5LD2B 4QBGB 5AWFC 1KZGB 3GJXC 3F5FA 3TNFA 4BFVA 2F6RA 2PBRA 4PFSA 1EFTA 3WNCA 4OQFA 4ZV4A 4QRHA 4EPTA 2OO7A 3RABA 3S1AB 3KQNA 3QKSA 4PQRA 2H8KA 1U0LA 3QENA 2Z0MA 4PC3A 2YOGA 4BEBA 4GI7A 4Q66C 2A5GA 2PZFA 1EXMA 3BIFA 4JBXA 1E2FA 4LPSA 3KB2A 5K8LA 1VCNA 2WJVA 1P2TA 1VECA 2V9PA 5L3QA 3C16C 1PJRA 2XXAA 1LV7A 4IVRA 3NG1A 1G3UA 1YR8A 2GXSA 2RGGA 4PZZA 2BBSA 2YWGA 3LAWA 4PX9A 3AVPA 4V0LA 5EZ6B 1G5TA 4M9SA 1JEEA 2WIBA 4B74A 2C8VA 2OLKA 1OE0A 1XD9A 2N46A 2OZEA 2VRWA 1N5JA 4RFSB 5FPTA 1D2EA 2ZRCA 4JT4A 4CRWB 4N0DA 4GFDA 2ANBA 3TR0A 5GVRA 2GTPA 4L9MA 2EFDB 1J2JA 3GLHB 1U0JA 2QTFA 5J47A 2ZE5A 1QVRA 1JPNA 3QEJA 4FIDA 2VP2A 4Q9HA 4A82A 1CXZA 2A2ZA 4LX0A 4PPNA 2OT3B 3HJNA 1E2MA 1IN7A 3W90A 3NKVA 1E2NA 5FBVB 3VNUA 1QHHB 1E3MA 4UXHA 1NG1A 2R6GA 4CF7A 3QEOA
chains in the Genus database with same CATH superfamily
2JZNA 1BWQA 1OR8A 2GKGA 2V9CA 4OLHA 4PLZA 3NVKI 4MZDA 2I22A 1TTPB 3ABRB 2CLEB 3KOOA 4O4LB 1Y8RA 3AG6A 4FGKA 4Y18A 3LZ6A 1O8BA 3ESXA 2X13A 1XJQA 3ADPA 3DMGA 1E32A 4FZVA 1NV9A 4MHOA 4QYSA 5LQDA 4O4IB 2XKAA 3WOVA 2FK8A 5E1BA 3EYAA 4EG4A 2V7QA 1BDMA 2WHPB 4A5SA 4YN3A 1JEOA 2OL4A 1C4OA 1PCXA 2VJDA 1QVAA 3EIUA 4H3VA 3ZBTA 5IKPA 2RGCA 2PKWA 4UOZA 3BFVA 2OFWA 3OX3A 4OL9A 1CJUC 1IHYA 1Z07A 4LC1A 4UUQA 1TIPA 1G2QA 1JQDA 4UNQA 4WUVA 3D5EA 3EGWA 1PL0A 3SZMA 1IVNA 1TI7A 1ZJZA 3CZRA 4I9FA 1NNI1 4INAA 4BMVA 4M9RA 2FW1A 1XTKA 2QQGA 1S8FA 3SLKA 1MX1A 1XQXA 4GYWA 4WA7A 2YJ6A 3IAM6 5T5QA 2YBDA 4NP6A 3H9CA 2IWHA 3WYFA 4MP3A 3EDMA 3ZQUA 4DM3A 1UWCA 4K0KB 4IUBS 2WVAA 3L0PA 3F5DA 3DZGA 5FYDA 1BE6A 1YBMA 5EEHA 3RS3A 4H1TA 1AKTA 1VB3A 4PYIA 4X7PA 5CXSA 4MIOA 2YWJA 3VAZA 3QXHA 4CXMA 5DW0A 1Z5ZA 2WJWA 2VT6A 3IVXA 2II6A 2QPLA 1L4UA 1VP3A 4CKBB 4HDSA 4TXHA 2BFDB 4UE2A 4D82A 2RGBA 4YASA 3D6UA 4YXWD 1G4UR 4EARA 4EFLA 2AUTA 5F2OA 5A1JA 2AK2A 3HYNA 4CI9A 1MOZA 1FY2A 1W1IA 4Q3KA 1NJ2A 2OV4A 1C8KA 3AXSA 4QM7A 2OHFA 4IQ8A 1G9SA 2FMUA 4MQLA 4OP2A 4R5MA 2CWFA 4X3PA 4RPKA 3SC2B 2H7YA 3M1YA 4MV0A 4MVWA 3VPGA 5EJ5A 3I2JA 1Z7WA 3M6WA 3U44A 4PONA 1DOAA 3HCPA 5BT9A 3CLSD 1PJ8A 5A62A 4GYJA 1XZLA 1D6JA 2E3JA 4NCAA 1M73E 2KLHA 3E8XA 3R4CA 1OLOA 2BFMA 1OFVA 5FEMA 4ESHA 4PS0A 3JQ8A 4HGRA 2X0RA 4FI3C 2BM1A 1CD5A 1BD3A 3M4YA 2K87A 2N3ZA 2M9MA 3O8QA 4B3SB 4BEWA 4JLDA 2G5TA 2I87A 3IILA 4G67A 1IXZA 1MO5A 1U0EA 1PGNA 2ONKA 1A72A 3D4LA 3MBIA 4LZJA 5KJFA 2ZDQA 1HDXA 3QKWA 2D0IA 5ILGA 3WL3A 4ALNA 4XZ3A 2YY6A 1DRVA 4JN6B 3CKKA 5H5JA 1RYBA 1OZAA 5ICSA 2NSHA 5KX5F 2C7RA 2FZLA 5HGXA 1A95A 1UBJS 1JEYA 2GJ8A 1ADGA 1CZUA 3EF0A 1CSOI 2LV8A 2GYWA 2YQZA 2NYAA 3EJ6A 3IE2A 3INTA 4KXVA 4MZXA 5JS2A 4DUGD 3VKWA 4Z3KA 2XLBA 5JYBA 1T8YA 3LU1A 1H2AS 3WGLA 4HNQA 4P31A 5AKGA 5BYKA 4UVHA 5ALLA 3VYRB 2JIZA 2ORYA 2OFFA 5HFAA 4NK5A 3TAHA 3VDPA 2WWRA 1TKBA 1E2EA 3GJ7A 1CGJI 1OU4A 1D5CA 1NVDA 3U56A 2VT7A 3HGMA 4X63A 2OV3A 1VHTA 2ZI5A 1N2HA 1UFVA 2PAAA 5COQA 2IELA 1HMPA 3EGEA 1Z2NX 3KPYA 1SXJA 2QE6A 4OOEA 5G40A 4DWJA 1EBBA 5FHQA 3SHFA 4KO2S 4PAGA 5HCIA 3H3JA 4YMSA 3WYAA 3T5DA 3OC0A 1RM4A 3OECA 4CM8A 3K6JA 2WNSA 2BLLA 3IDAA 3GFGA 3TVDA 1U8ZA 3D2LA 2M6KA 2I80A 2J32A 2ZSEA 4PCUA 1LA2A 3PD7A 1EE9A 2PEYA 2CEKA 2HGZA 3WDSA 2GAJA 2FW7A 4KIGA 4LXIA 2D2XA 2BH9A 5KHOC 1BA2A 5J2UB 4E1AA 5DYIA 4IYRA 1EUYA 1PDOA 3HL4A 2EL9A 3NBUA 7YASA 2PYZA 3ACBA 4BJ3A 4OXKA 3PC4A 4D97A 2HHHB 4BBAA 2PHZA 2V7UA 1ZJYA 1G20E 1Z0AA 3CBQA 2AS0A 2ZUFA 1GLGA 3R75A 5K09A 4HN2A 3DYBA 3RIHA 7ABPA 2O7RA 5IEBA 5CDFA 2OZVA 1JKMA 3DP9A 1XPUA 3B3GA 2I3AA 1QZZA 4FX5A 1OYWA 1P33A 3WS7A 1Y7TA 3NOVA 3R3JA 5BV7A 2PUGA 2I33A 2IZ7A 2OP1A 1C5KA 2PL3A 5HK8A 3ZVLA 4HGPA 4FLFA 3CLRD 4V0RA 2IGBA 2GM4A 4E33A 1FMFA 3QX8A 4M9QA 1B23P 1CIVA 3V8MA 4ZO8A 3ZCXA 1CJBA 1RCFA 3QVWA 1I7DA 1WHSA 1L7VC 4L5CA 3DC7A 5GJCA 1U7OA 2VQFB 4QIHA 4CQMA 1U94A 1RYFA 4K2AA 5EIFA 2V3VA 5JV5A 2PT6A 4HOYA 1X7DA 3RYHB 3IT2A 1S2NA 3EC2A 4ZYYA 2V58A 2P90A 3V80A 3T3OA 1NZFA 4D74A 3K70C 4GX0A 3RK1A 2P6OA 1CVLA 4N39A 4EUHA 3KOWA 4DDVA 2IEIA 3CSUA 2GLXA 3WZ2A 3MGCA 4AW9A 1HOXA 1HFJA 3SMQA 1SULA 2H2DA 1AS0A 2P3SA 2QZPA 1XD2B 2GNPA 3GQBB 3NGXA 3PI7A 4OQNA 4OSOA 1FFDA 3HUUA 4WCFB 5I9NA 1SQ6A 4KXMA 4PAQA 4RHYA 4QGHA 2X0FA 2ZQZA 5A3SA 1E1LA 2JFBA 3GPLA 4CCYB 1PEAA 3TAUA 3L77A 2QTRA 4O6VA 1TT5B 3GVHA 5KCZA 5CLLA 2ENZA 1XQWA 3IQXA 5LCXA 4P0PB 1EWVA 1BROA 2ZLBA 1JG4A 3B52X 2DEUA 3G2QA 1ZMXA 2W83A 2A1TR 1R6TA 2C94A 2R1VB 2V7PA 4RUKA 4CTNA 2IBSA 1HEIA 3DLPX 4CHTA 4QU9A 1K3TA 1U1EA 3CZ9A 1N78A 1ORWA 1MCZA 1Z2IA 1SZJG 2AW3A 3D7NA 3G0CA 4Z0PA 1KBEA 1X13A 3T7JA 4G1UC 4TZTA 5JD5A 3GPIA 1QP0A 1QHSA 4Z4EA 1JAZA 3O9MA 2NVUA 3O03A 1EK0A 4K6OA 4KITB 1KOGA 4WNYA 1MB0A 2KSQA 1WRBA 3P0JA 2QBYA 3MG9A 2QPAA 1JKIA 1YRLA 2XHEA 4YS6A 3RYFB 4AG6A 2PH5A 3V34A 1E79A 2XX3A 2ZIVB 4OP1A 1F8GA 3VDMA 2PLNA 1V11A 3E53A 3Q0EA 1L7DA 1LNSA 5LDDC 1U11A 5HKKD 1AH2A 4LMAA 3OZWA 2B4RO 2AYZA 4JKYA 1W30A 4AMYA 1WXDA 4FD3A 1KR5A 4NBUA 4BX3A 4DJTA 3RPEA 3OJFA 4HBZA 4N0MA 2AD1A 1PR0A 2PQ0A 2JGDB 2VQ3A 5F3WB 4KDFA 4ALJA 4Q4LA 4TQAA 2RG1A 5AUOB 3ZZNA 2ZIAA 3I6YA 2HXSA 2YOFA 3PWTA 5HFJA 1FTYA 2JK0A 2FG5A 2QN2A 1KVQA 3C98A 5FBWB 1L2TA 3OJCA 4LNUA 5CCLA 1B15A 2IBMA 2ZCVA 1AGPA 3PFIA 4U8HA 2PANA 3G5UA 2KB0A 3LNCA 4JS0A 2HA4A 5C80A 2FSGA 1RWOA 2AIRA 3RVOA 1GTMA 1QF7A 1TPZA 2FI1A 3V1TC 5CBPA 2P2ZA 5JECA 5F9FA 4JEUA 4QBHA 1SVKA 3VNAA 4E3ZA 3VR5A 1N3LA 3QVSA 4M0LA 5H68A 1HYHA 5SZIA 2BM8A 4ZYLA 4CR8A 1T0BA 4BLRA 1EIWA 3LHDA 4LGVA 2A1UB 2FWJA 1R4MB 5DN6A 5E3JA 2V59A 2VTVA 4OGFA 1J9ZA 2CC2A 3E0QA 1BXGB 4QQNA 3PP8A 4B40A 4B83A 5JISA 1RC8A 2PGLA 1PJLA 4DV4B 1LPSA 1U5CA 1GGEA 2ZBUA 3KU1A 1IPFA 4UPEA 1VPEA 4QXAA 2ZWOA 5SZHB 3O90A 2PMBA 2WQ6A 4HYQA 2IXTA 3LHFA 1LS6A 1CQIB 3FZYA 3OKAA 1JQBA 4TMFA 4A5OA 1JS1X 2JIMA 1P0QA 1IC6A 1ZZEA 1TGSI 3DD1A 4Q48A 1A8HA 2NU9A 4RELA 2PX3A 3KYDA 2EHDA 1KI6B 2ZIXA 3AHIA 3UW1A 3DWEX 2WP8J 3K0KA 2TECE 4KQ2A 4E70A 2J6BA 3SOZA 4CU5A 5H8WA 3OX1A 4M1TA 2WYUA 2D5AA 2F8MA 4C3VA 2LUYA 3H5AA 2GK7A 4YBRA 3H1AA 3KQKA 3P4XA 2FR8C 3DOUA 1U28A 1VLVA 3L1UA 2K4MA 1QR2A 1XELA 1V16B 3KEOA 1VG0B 3EVBA 1I2DA 1BVUA 1CR4A 1SOAA 1Y3HA 5GONB 5K9ZA 5KSWB 3V7YA 1R64A 1ZIDA 3WFJA 1RMQA 5BW8A 5KPDA 5J2UF 4AJOA 4RD1A 3JWEA 3WIUA 1EGAA 1CWUA 2HZ7A 4OYRA 2CWWA 4DXHA 3O2NA 3BJIC 2HFJA 4ZTZB 4BBZA 1GYQA 1U9JA 2Q1TA 1Y4UA 3H8WA 4YRQA 4Z1MA 4EY6A 1O96B 1HORA 3JQEA 5EXSA 1VOTA 5HUHA 4FFRA 2H57A 4QQRA 2RHWA 3WRYC 2VAXA 4QNNA 2VPWA 3QKRA 1A5BB 3FX2A 3PE4A 3TRDA 4YAUA 5MFPA 3THXA 3EMDA 3STHA 4PAWA 1JXQA 4C2TA 1S2GA 4G2TA 3JAWA 1FP7A 1I5OA 3L6BA 2QTLA 4Y9UA 1QDUA 1HUQA 1GTRA 3ENWA 4QYIB 1QLHA 3PQ8A 1K2WA 2P9BA 3R5SA 4EY3A 1QNFA 4CL3A 1ACMA 2REQA 3LVRE 5EJAA 3LPLA 4NCXA 5E6UA 2O8CB 2DMRA 3G0IA 4UM9D 5F1PA 1B6GA 2D59A 2Y4OA 3D8NA 3QE0A 3CG0A 4ZRDA 4PQFA 3KJIA 3ZDZB 4B6RA 4HMOA 1LRKA 2XYPA 3P1JA 4L22A 2CXUA 5KQSA 1EK5A 4F3TA 2ZJ1A 3SXJA 4LI3X 4RGYA 2ZJ0A 1BE0A 3GBSA 2W6CX 3TQHA 1EFVA 1M5UA 2C59A 4N5LA 3QF4B 4UDXX 4YJ2B 2ID8A 1PTRA 1N6PA 4AS2A 5FWNA 1F6WA 2QMHA 4LKOA 4F5ZA 3AOGA 4PC7A 2CY0A 4X64B 3E59A 2J3MA 3PEYA 2CLKB 1GNPA 1SOMA 1NTOA 2W11A 2WM9B 4I1SA 2WZQA 5DOVA 3A70A 2VZ0A 3MHTA 1BHO1 4EY5A 2Z3WA 2P9QA 1I5EA 4C3OB 1SB8A 4ARVA 2QUZA 1H8ED 1KFCB 1U2GA 1YC2A 2NUBA 3CWCA 4FHZA 5IKEA 1N34B 5J8FA 2QLJA 4J49A 3GJ5A 5JC8A 3BK2A 1L6IA 3QZUA 4TLLB 2XKKA 5TQ2B 2QMOA 2MYPA 5CUQA 1F0NA 5H81A 1TF5A 3IXLA 1XRRA 1R0SA 4BLWA 2NMVA 4BVGA 5AUPB 1TZKA 3ZHTA 4NC9A 5CLGA 3U1TA 2X41A 1PNQA 2GCNA 1R2QA 1PTJA 2GK4A 4KYVA 4RKRA 4E5DA 1PQPA 5J47A 2Q9AA 5J1TB 2R6DA 1M6EX 1TU4A 2OFXA 4JX9A 4D4JA 3OAAD 4XDZA 5FQNA 2OR3A 1N6KA 1ZAKA 3ITDA 3MQ2A 1IWBB 4ZPXA 5L6MB 1OREA 2ZRPA 1YE8A 1DJPA 4LG1A 4AJJA 3SIPA 1YAHA 4KBFA 2AZXA 4LYFA 3IP1A 1XNGA 1RXEA 1KH1A 1C7FA 1CJKC 1G21A 1PLLA 3T35A 4DCGA 1GGMA 3COSA 4HDNB 3HJRA 1UZMA 2O8BB 3Q3GE 4ENTA 1UBHS 2XODA 1UBMS 1NVGA 2GM5A 3G0BA 5H1YA 1NUTA 4HX2A 4UZEA 5JAIA 2HO5A 3LCVB 2P9YA 3NHJA 4J4TA 4TUYB 1AQIA 2BLNA 1NDUA 2CFCA 3H97A 4P4UA 3IVCA 1C8BA 2RC5A 5F5LA 4NBNA 2X5XA 4XIJA 4ZEXA 2GVDC 5U4QA 1UJ2A 3M6MD 2PMEA 4G5YA 1Z2DA 5IHXA 5J3JA 3FHLA 1YA8A 3NH9A 1XR3A 2AMJA 3RRMA 5C1BA 2IF0A 3G6KA 4D0LB 5SYNA 3A1TA 4PBTA 2IU6A 4PHCA 1ES9A 4TV9A 1VJ0A 1X86B 4V1CI 1QVVA 3A14A 3QHQA 1IMJA 4PRYA 3S40A 3E9EA 4KACA 4J0IA 4IWYA 3TOCA 1WCIB 4BMPB 1ULUA 4IVPA 1SBCA 2PX5A 3BKWA 4CIDA 2ZS8A 1RQPA 1COWA 5TEVA 2PUVA 4QYWA 4MX8A 4CVNA 4ZQFA 5DN9A 1G42A 2YXNA 3TQRA 4UFPA 1JHRA 3LOUA 3BQ9A 2ROQA 2J09A 3GRYA 3JYQA 2AQHA 4BRWA 3A3PA 5DCWA 4F6RA 5DULA 4ZI2A 1QG0A 3SR0A 3FFWA 4WK0B 3CA8A 2PGJA 3E9YA 5CB8A 3AI7A 1ZMTA 3B2EA 4B85A 2L82A 2PVCA 1E3IA 3NIFB 5DAEA 1NPTO 1Y34E 5FTJA 3VJRA 2I4NA 1JMYA 4YYEA 1TU0A 3DKRA 3QE4A 4DRXB 1E69A 1YQXA 4O2BF 2HJVA 2X1VA 1NXVA 3JPWA 3C0KA 4B0OA 2YV3A 3C5WP 3N5CA 1TTTA 1DVRA 5TGZA 2DVMA 3UHJA 4RY8A 1CUXA 4A8PA 2QN3A 1GAJA 3HA5A 3BKXA 3OQBA 1U4OA 2JJYA 2PM8A 3E5MA 5JSZA 4B3TB 2IYUA 2ON6A 2CK3D 5HS6A 3VJLA 4X94A 1PNVA 2Q3JA 2A33A 1RVDA 2KM1A 3DDHA 3HZRA 3K8ZA 3DDSA 4L74A 1BKYA 1L5FA 3SY8A 4BJHB 2WPDA 4OBBA 2FFBA 1Y6JA 2P7HA 5FUMA 1SFRA 1EVJA 3HLTA 1WCXA 5FJIA 4Z4QA 2A9KA 2DYKA 2J31A 3ZI0A 3ZYZA 1J99A 2DBZA 3E2MA 1TM2A 1OV4A 2O4UX 4DJFC 1G3IA 3LX8A 1MAWA 4FE4A 2ODAA 4IF4A 2M32A 3MWDA 2HN9A 4EUFA 1C3OA 4CIAA 3B89A 2DQZA 1EPUA 4RYLA 4L50A 3ZHYA 4QUAA 4C89A 1DL5A 4F38A 1QG6A 2WIDA 4M76B 2LNDA 1K8ZB 1OAKA 1T3GA 1X1DA 2R87A 2RAPA 2UVPB 2WMOB 3E35A 4DM4A 1HQCA 3PEVA 2JHFA 3S29A 3O83A 1FB5A 3JRWA 4IH4A 1C0KA 4XR9A 5CDSA 1XL1A 3C3BA 4QLBA 4PLYA 1X7WB 3OURA 2YNMA 4I9GA 4BNYA 2DHCA 3C8UA 3ZTTA 1SJ9A 4X1IA 1R1DA 1FP4B 1S5PA 2XJ4A 2NADA 2XZTA 3DTNA 1MP0A 3NTXA 2H7XA 3QIAA 4TMKA 1P9WA 4B4OA 1R0XA 4P4LA 3RF6A 1IN4A 4L2IA 4NS1A 3LBAA 5F9MA 3Q0IA 1Q1BA 4EVRA 4NBRA 4TWIA 4UREA 2CJWA 2WTEA 4U7PB 2P2SA 2VWHA 1QP4A 5G1NA 1XXHE 2FSFA 3BFKA 4LK3A 3VC7A 2HFKA 3BMCB 3S1LA 4Z4IA 4CF6A 1JHZA 4NU0A 1B8PA 3ZV5A 1BX1A 4CT5A 4IFEA 2K9HA 4LYEA 1ZLXA 1XZEA 2D74A 2GMWA 4QQ8A 4FMBB 1XNQB 5FL7A 3T1QA 1BCSB 2PZMA 4DPLA 3KOZA 5LMNB 4KSCA 3LE8A 5AW5A 3WI7A 4A0FA 3OPMA 4MCHA 2COKA 2AOUB 2G8NA 4OK5A 4OLFA 1A4IA 5EZQA 3RUHA 3U7IA 2FUCA 2JRCA 2WF5A 1QTRA 2Y2VA 4MRMB 4WBSA 3EAQA 2QOEA 3WLHA 3R9IA 1Z4QA 1WCV1 2FDRA 4L72A 4HTFB 4C4XA 3ESRA 4GQIA 4KPUA 5IAEA 1JR3D 2RHBA 2KBEA 1SG0A 5FPPA 2FEWB 4DYHA 2IWRA 4IHQA 3GR6A 1VSVA 1X7ZB 4C01A 3H9GA 3RUPA 1KEEB 1KK3A 2I3DA 2RG7A 1Z25A 4N5MA 3UEJA 4QE3A 2DSNA 1YHZA 2BDEA 5M5BA 3FRJA 3QVLA 1GTZA 3RSHA 2Q5EA 1YI1A 2R48A 2Q8QA 1FTQA 1RKBA 1H5NA 5B3AA 4ZJZA 1B93A 5DP1A 4Z9AA 3LL7A 3W6OA 4C14A 4A1FA 1ISFA 2XSZA 1TBNA 4YUVA 1BEZA 1JSXA 2BT4A 3L07A 4QODA 1J4AA 2J87A 3TLXA 3ZS8A 1UPUA 3ZCTA 2J9XB 1J0CA 3ACCA 4FXOA 3ICVA 2JKVA 3FM9A 4DLNA 2PR7A 2SKDA 3QUSA 4U9HS 1EWTA 3S44A 2GR9A 1G3RA 3ZK9A 2AFHB 3R0IA 4KC0A 3X1ZA 1JDBB 1XTJA 3C87A 2ZATA 2XMZA 2JJ1A 1N57A 1ORIA 2HMVA 4FYXA 3UHPA 1OJ7A 1GY8A 2XMGA 5CEJA 2E89A 3AY7A 2PS1A 2FUEA 4EJ2A 2OUKA 3VR1A 3AB8A 2CGEA 4OCZA 1SQ0A 3FFAA 2ZB3A 3G6WA 4HQ6A 5TPZD 3T3DA 2BGUA 4P3YA 3TTTA 3HDHA 3KOXA 3RDPA 1IY0A 1KJNA 1NBIA 3KSUA 3K9CA 3LWNA 2PRKA 5K99A 3KYJB 4GM1A 3MILA 3QHAA 4YAWA 3JQ9C 6ADHA 1XVTA 2LTAA 3GC6A 3GLUA 4ID3A 3TJRA 1M5TA 2DHDA 3A2NA 1G2PA 3AEUA 4KJZA 4MIEA 5BWNA 1XZAA 5KTNA 3NZEA 2HRRA 2OY0A 5FLEX 1NHGA 3S8MA 1N7GA 1MTZA 1JVNA 2PYIA 1B2LA 1OLSB 4L0MA 4X3OA 4M53A 1HLGA 1PUIA 4LFAB 4JA0A 4DMLA 1NMQA 1Q0LA 3AVTA 2O4CA 3PGXA 3SQWA 4LXTA 1KXZA 4U0KA 1YB4A 4NYIQ 3ELYA 1Z34A 4QUJA 3V42A 4ER5A 2FEXA 5HQTA 1CNMA 1LPOA 1XVIA 3VPCA 2F8SA 3KPUA 3OP4A 3CV3A 3GNLA 2ODDA 1Q0SA 1M33A 2O2XA 5IZCA 1AZWA 2HU2A 2WB2A 3ZU4A 4BX8A 2ISCA 2WFLA 2TRSB 5CTJA 5BYJA 4LSZA 2UDPA 3WO1A 2FPLA 3JQFC 1V5GA 2HA3A 5CX1B 5JDCC 4ZCMA 3FGOA 1VGRA 3E22A 4HDCA 4TSRA 2WT8A 2I8CA 3MBOA 4GS5A 3TPCA 4FYJA 2ZRDA 4NDAA 3H42B 4NENA 1Z0KA 3Q6MA 1YRWA 2HA5A 5LYJB 2WNIA 3I37X 3X2FA 3O84A 3KZOA 2Z6VA 4KWHA 5FV4A 1RKXA 1V8BA 1Z75A 3HCCA 4DLWA 4YRAA 4GVXA 1MPTA 1P4JA 3CLUD 2OCLA 4JR0A 2REXB 5A05A 4TKZA 2X40A 1IDOA 3EASA 3GGGA 4HDKB 4K9LA 3X2EA 2CLMB 4BV8A 4C04A 1CZNA 3O9VA 2Q3CA 3I58A 4IDPA 3V33A 4UQPA 1NTRA 4MP8A 2PZLA 4AKGA 2AJ8A 1PWEA 1JJFA 3H99A 3K0FB 4MLZA 2BHNA 1OWOA 4GLLA 3TB4A 4DR3B 4EMUA 3BFXA 4DDKA 1CS0B 4TTRA 1L5NA 3WYDA 1DDIA 1KZ1A 1ELOA 3EDRA 3NWJA 2VPTA 2V53A 2AZTA 1EI9A 3ACDA 1IU9A 3LUCA 5DGHA 1EP2B 2AMFA 3UGDA 1CZOA 1TQHA 3K0AA 3SZGA 1T0HB 1DADA 2MWMA 5B1DA 3CLSC 3GGDA 4KR3A 2OO5A 2OZPA 4X91A 3JAMA 1XKTA 1GARA 1FSGA 4R0VA 3ZIAA 5AFSA 2XGJA 1XZNA 4HV4A 3ZS9A 3K9NA 4BKPA 3H9QA 2J3JA 2W2KA 1OILA 1TA0A 3CUVA 4J03A 4LY6A 4MRAA 3ZE8A 5KMGA 4JKIA 2P9HA 4DLKA 2W8BA 1GL9B 1SOWA 1GPUA 1EEHA 1H9AA 2C42A 1W2WB 2RBGA 4AZWA 4P82A 3W34A 1GGHA 1KDVA 3AL0C 2GXUA 4JSTA 3GX1A 4EHNA 1E6CA 4I50B 3NHPA 4JWTA 4P9NA 2G36A 4ZHQF 4G1VA 2C29D 3GLQA 3H5IA 2HMTA 3FPGA 3IP5A 3K0CA 4WH0A 4CLRA 3I0ZA 2Z57A 3V4SA 4OSEA 1MQSA 2RGEA 1X7GA 3EVAA 4UUNA 3DPSA 1UKAA 5AVOA 3I4LA 2H4ZA 2ZKIA 4ZV7A 3ECSA 1CQJA 1Y6QA 1G2IA 2XGOA 5F2KA 1NBME 4H7HA 1KI4A 3BCHA 5E8RA 5LBIA 4O4JA 2XCRB 5BOVA 1E4OA 3OT1A 1TAGA 3K8OE 3V6LA 3VJKA 1PPFI 1SXGA 3PNSA 4GZLA 2CWHA 2YY5A 3I2HA 4MR9B 1E0KA 4RJKA 4CDMA 3SHTA 5KTYA 2YUIA 5DM70 1Z38A 3FMFA 1GD1O 1R4NB 1U81A 3F3YA 1A2QA 4EELA 1JPJA 1T3HA 2I2BA 3TLZA 1JKJA 4D3DA 1BXZA 1LPNA 2V6JA 5C35A 1OPXA 5G02A 1SUPA 1A9QA 3TLYA 4KXQA 2ZUTA 1UK9A 3TEFA 1TO6A 3DLHA 1DHTA 1RXCA 4BAZA 1Y1KE 2G40A 4OHOA 4NLLA 1A2BA 2QENA 2NO1A 4ZCLA 3C8ZA 3QMWA 4MVJH 4S1TA 2NXCA 3SYKA 3VHXB 1I4DD 4ZI3A 2VR1A 2WTNA 4JU9A 1Q0ZA 2J5KA 1W4CA 1M34A 4N12A 1D4ZA 3STWA 3TYXA 2JZMA 1K75A 3K8QA 4AX4A 5FI3A 3CNBA 3E61A 3KRTA 3T5AA 2PUBA 2ZYIA 2QXUA 1KMCA 5AXDA 3WWYA 1T4DA 1GAWA 1KI9A 4ZAWA 1KEZA 4A2CA 3JR7A 1LVHA 3JQGB 1X6VA 1Y4SA 4YDHB 1X1RA 3ZWAA 4EAAA 2I7TA 1Z5PA 1ECGA 5JH7B 2XEXA 3K6SB 2XXAB 2HCFA 1VCIA 2A84A 3HWWA 5DRYA 3IEIA 3QW2A 1J21A 3F78A 2I66A 5KO2A 2CV1A 3FH0A 2YHSA 2E4XA 2H4HA 4MRPA 1H4SA 3GFVA 3IUMA 4P22A 5D1HA 4ALMA 4DJJA 4EEXA 1OXKB 3STVA 1WTJA 3CLRC 1AHHA 1R00A 3WK7A 3SYNA 4BNUA 3O4VA 4IQ0A 4AWBA 2QRJA 2V7QD 2P9JA 4ENSA 2P0YA 2W0TA 2HQOA 3W8NA 1TYEB 1NX9A 3HWSA 5I9MA 3KLBA 5D01A 2C2GA 4IV0A 4KHZA 1G5PA 4Q3OA 1RIFA 2JJ2A 4H35A 1FDUA 2OB2A 3QUQA 1I3LA 1TQDA 4RF4A 4HRAA 3PNVA 2GBLC 5IP5A 3HPQA 1MN6A 4MCIA 2IVFA 1NQUA 1EAMA 5DZSA 4TOIA 1KDPA 1P7VA 3IV6A 2QN9A 1KP9A 3VDRA 1TAHA 4AO8A 4UVGA 2ODBA 4Y0AA 4CQMD 3U16A 2F9MA 1F8YA 2WP0A 3L02A 2DUJA 4PHFA 1IUNA 4JFRA 2H18A 4IZHA 1KEUA 1WNTA 2YXPX 4KK3A 8ATCA 2YCLA 3MTQA 3LT1A 2BE7A 2PY6A 3R44A 2HA6A 5DEIA 1U3UA 5DX8A 2E55A 4BRUA 5JSQA 4D02A 1N6LA 2W2VA 4J07A 4B3XA 1ODJA 3AVVA 4DRXA 1OBHA 3HNRA 2XE7A 3UXHA 3WLPA 1A9TA 4H6XA 2ZJ3A 3DMDA 5CIWA 3EGCA 4TPKA 1JG2A 1ZG3A 1N9KA 4IFTA 4LZPA 1MJAA 1CDEA 1F3LA 1HF3A 2I76A 3ULKA 3BHMA 1NMXA 1JHAA 1T36A 2HZBA 3ILSA 2Q2VA 4A9AA 2MSKA 4JEHA 4WTOA 3BMNA 2BKVA 4UM7A 4EO9A 5KNBA 1G8YA 2GTHA 2FFAA 2Y2UA 4D9IA 1KMHB 2KX7A 4YRIA 1BUSA 3IR6A 4X1YA 2BY4A 2YRWA 1S9DA 1U8XX 3BWYA 3Q3CA 4KDCA 5H02A 2RAVA 2VDJA 4PIMA 5JS7A 1AKMA 3GCDA 5EHGA 3NVAA 4YJKA 5KYTA 4CUJA 1PWZA 2IU4A 4OJTA 1C1HA 1GA4A 1OGIA 1X80A 5BXQC 1PR9A 1NAHA 2RHGB 4GBGA 5BR4A 3MS2A 3DAHA 1GJRA 5EMKA 3DBIA 3ZTWA 3O38A 3WGGA 5AVXA 4MS1B 1G8SA 2Q1UA 2QVXX 3OFSA 1V3QE 4NCHA 3TGLA 3H2YA 4UU7A 3WSTA 3RCBA 1UP7A 4ZI7A 3PYMA 1CNEA 1HE5A 1UPCA 2C9ZA 2R6AA 2VHEA 2YASA 4PRKA 2WWTA 3KT6A 2H1LA 4X61A 1ZNXA 3FHTA 4Q1CA 1FFYA 4OQ4A 3OIDA 2V1XA 1ZIOA 3A25A 3FTCA 4KDRA 1JLMA 4XLTA 5IC5A 1YKGA 1KEWA 1MDBA 3SSOA 1DJMA 3ZGZA 2O1SA 2ONCA 3PFFA 4NECA 2WJPA 2QTBA 4CF7A 2GXQA 5SV2A 4OQDA 1UFQA 4MW2A 3AEYA 4RTMA 2FNFX 4AP9A 3NDBB 3PR2B 1B8VA 3GFQA 4XLLA 4BO1A 1J1IA 2WIKA 4QT0A 4S3MA 1IW4A 1E8DA 1MORA 4E2ZA 4BY9E 5DNEA 1M8KA 1UPTA 2CLIB 1VIAA 1OXUA 3PGKA 3ED1A 4I1IA 3U4QB 5CB4B 3NAMA 3UXMA 4C0AC 1CE3A 1KPIA 4KQIA 1R50A 1X3SA 3I5XA 1VFNA 3LX5A 3CJRA 2Q7XA 1S6YA 3X1KA 2GCIA 3RARA 3ZV7A 1J23A 1C30B 1TEZA 2GBGA 4F93B 1KL7A 3KQSA 1P1KA 4DIMA 4F3KA 1TJ4A 1SXJD 2IJGX 1UPAA 5GJWC 3OWHA 2VAWA 2ZTVA 4DDHA 3KAKA 3CZPA 3EZNA 3T7IA 3UGKA 2E1RA 1NXQA 2AEFA 2EKQA 2ZTUA 2ZT7A 3NGLA 4R69A 2I67A 5KDOA 3N59A 3AONB 2ZUWA 1KO7A 1YDWA 3AF0A 1Y6ZA 4IOKA 4DDUA 5EJEA 3ETLA 4EEKA 4GR5A 1AK1A 1AKRA 2DKFA 2ZBEA 4OA8A 4UJ3A 4F2GA 5SYAA 5FUYA 2COEA 1XFAA 2LKDA 2QLTA 3T41A 4BNIA 1XZGA 4URVR 2JB9A 1QAQA 2DLDA 2VTBB 3DOIA 4ZC1A 4E31A 3T3HA 3U3OA 1DBPA 5JR3A 3MELA 4RVNA 2XH8A 3I64A 4CM4B 4EEZA 1E2HA 1JHDA 1YGYA 3JY6A 2LIPA 4YJHA 5C3MA 4EOGA 4JAVC 3C48A 3M9LA 4MS4B 3OMLA 5HDBB 4CIVA 4DLVA 4FFBA 5HR5A 3RVPA 2C88A 4NI5A 4O2AF 3FVRA 1Q84A 1W0JA 3RVQA 1PAUA 2F2TA 1Y4ZA 4RVCA 4WSOA 4CEHA 1ENOA 1YE3A 2VP9A 3DV0A 3LGSA 3OPXA 2YWRA 3ZPXA 4C88A 1OZFA 2LGJA 4B4WA 2DUNA 4DSOA 1L9KA 1T10A 3FGZA 3LECA 4TTTS 5MN6A 4G3XA 4HN4B 2FFHA 2B1JA 1MMFB 1TUEA 1EFPA 1X7YB 1PJZA 5A04A 3UFXA 1ZI9A 2BI4A 2OLEA 3FOEC 2ZU6A 1JEDA 3DYIA 4LTNA 1YRAA 2GA8A 2J67A 1V1HA 2V0NA 3FI0A 1SHJA 1BFDA 4EY7A 1A0OA 5LOVB 2REBA 1L5MA 3K9GA 3TUIC 1N25A 3URKA 2X8BA 3LPAA 2JDIA 5F64A 4WZZA 5FJJA 2ZIZA 3NTVA 2HWWA 3F3SA 3T99A 2IYQA 5F1KA 3VZCA 3RRXA 2RKBA 5FFNA 2ZVJA 4TZ0A 1NW7A 3ND6A 4YH1A 1N0HA 2N1MA 3FSGA 5C18A 2VLIA 4C1NA 1KYZA 4WJZA 1ZRHA 5IVPA 5JT1A 1U0FA 1L4YA 2Q4OA 3FBWA 2QROA 2QTVA 5HDQA 1SRRA 3HB9A 4TKMA 1A4UA 3D7KA 2GZSA 3V1MA 5I3CA 4NPAA 4I4TF 1QQ6A 3G9ZA 2DBRA 4E1RA 2ZBPA 3N0WA 3WBJA 3NKLA 1IHPA 2OCXA 3H65A 4HEJA 3OPYI 3U7QB 4PYOA 4H7FA 5IMSA 1EX9A 1D1SA 1O94C 1DEOA 2H0RA 3A1DA 4FU0A 4LE0A 4B09A 3HO1A 5A7HA 2WPNA 1G20A 5A3QA 2F43A 2R97A 1SA0A 2OKGA 2WHYA 3BSWA 1ISHA 3EVTA 1FVXA 3F3MA 4J0HA 4OQEA 2BRUA 3MERA 5A4MS 2GO7A 5ABPA 1Z2CA 1E79D 3H9BA 1IWOA 3E5HA 3GYGA 2LW7A 1E3QA 1W85A 2NPIA 4K8OA 4PR3A 3ROPA 3VSEA 1G4AE 5DDIP 4DDMA 2D6FA 3NOXA 1UC9A 2Q6TA 4QDOA 1ZH8A 3ROEA 3D6MA 3PPXA 4GHWA 4PS1A 4EQ6B 5A03A 4GX1A 5LXTB 2IUUA 2BDUA 1IZZA 4X1KA 1ZIYA 4X8LA 5LBUA 1FP1D 3ZXSA 1RAIA 1BMDA 2BKEA 3JXEA 3I01A 4R3WA 4N41A 2CW5A 3GT0A 5HQ3B 1Z26A 1WZCA 2Z98A 1YONA 1E99A 1G7CA 2JI8A 2Q8NA 3OX2A 5KJEA 3INRA 4UJ5A 2CVQA 4IPTA 3K6RA 1NUQA 3WGQA 5G41A 1DBIA 4JHXA 3IVMA 1U1IA 1GUDA 1OUMA 1Z17A 3Q7SA 4Y2JA 1DT5A 4RTOA 3L2OB 1YIDA 3I12A 3KWMA 3ZDBA 3AM3A 2BZSA 5ALMA 3AF2A 5TRTA 4AF7A 1QGUB 2FXVA 3LT4A 2AN1A 1QU3A 4B5KA 4KR6A 1T6XA 1THZA 3H0KA 2I71A 4ERNA 1Y1RA 1YJXA 3VR5D 2HEIA 1V1MA 3DBVO 5C5CA 3VBCA 3USCS 1JHQA 1YS9A 1DJOA 1YUBA 4OHMA 2BR5A 2W22A 1Q6YA 3GUUA 1E58A 2UZ0A 4Q6WA 4KQMA 4KDEA 4QFBA 5G0UA 1NBEA 2HUNA 4N76A 1MT1A 4WN9A 3O1HB 4PLFA 2BGRA 1EHYA 1U3FA 4N5DA 2Z08A 3CEAA 1SR8A 2QSYA 2O2JA 2QTCA 2VSFA 1R0ZA 5FXMA 3GU3A 3VKHA 4YJFA 3QYPA 3V4ZA 1V7PC 3TQOA 3MB5A 1FXSA 1GPLA 5LQKA 2PE5A 3GDWA 3LV8A 1Q1AA 1IRXA 3RFCA 4YP5A 2R5FA 5HM6A 4LRUA 2J3IA 3MRTA 2PPLA 2WSYB 2FYTA 5FPHA 1NXXA 3ESDA 1X7HA 1NASA 2ZSJA 3MHPA 4UEJA 5A71A 2XE8A 2G9UA 2O3TA