5FUXA

Catalytic domain of thymidine kinase from trypanosoma brucei with dtmp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
182
structure length
168
Chain Sequence
AHGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTGDTLTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 55
structure length 168
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuxA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuxA01
2ZRBA 3KZ1E 3C7KA 3R20A 3AEZA 1OIVA 4P0TA 5E7IA 1Q1ZA 1QDEA 3DEFA 4R2IA 1FQJA 4IOMA 4P4UA 4PAOA 1W48A 3AVOA 5HTKA 2R2AA 1DOAA 1KO4A 4IXMA 1TPZA 1WBBA 2OAQ1 2F1HA 5KSPA 2JJ8A 3BXZA 4V0LA 1RJ9A 4IFBA 2R44A 4DCVA 4G5SA 3ETLA 4WOPA 5J5CA 3RRYA 4DLWA 4FWTA 4WBSA 2VP5A 1MO5A 5JECA 2ZYTX 3SEAA 3R9IA 4PFSA 4KSCA 5JCPA 3UIEA 4NYJQ 3B9QA 3S1AB 1F2TB 1R5OA 2KWIA 3VHXA 2IW3A 4HZIA 3THXA 3ZD7A 1LVGA 3DHWC 2GHIA 3KKOA 3A6PC 3KJIA 1A5TA 4CT4B 4DLVA 1VIAA 2NO9A 3OIVA 4XWOA 3SU8A 3MWJA 4PZZA 4DEYA 3MLEA 1KI6B 3QF4A 5EP3A 3L8YA 4PQRA 2VSFA 3EZ9A 4AG6A 4KBGA 4PXAA 2GXSA 5GJCA 4ZV4A 1DAIA 1CLUA 2RCNA 2TMKA 3RHFA 4K81B 3SJAA 4JL5A 1XX6A 1E1RD 4D4MA 3HYTA 1KDRA 3B5JA 4KU4A 4UXHA 2OBNA 2OG2A 4FMDB 1X6VA 2IS2A 3AVYA 3IIMA 1TF7A 4DT1A 4LSGA 1WCV1 1TQ6A 4A1FA 5TARA 1R8QA 2GVDC 4XD7D 2ZJ5A 2QP9X 1EFRD 4IOLA 2QP3A 2VQSA 3O8CA 2MMCA 1G8PA 4I99A 3WNDA 5KSOA 5F3WB 2BEKA 2QQEA 3OIUA 4E22A 2ZI3A 2CLDX 1XXHA 3A4MA 1U0JA 1TF2A 1HQCA 2DWOA 2ZRDA 5KYKA 1IHUA 2F43A 2VA8A 2XX3A 2W2VA 1XEFA 4G5GA 5LB4A 2ZVQX 3DMDA 2VPPA 4QC2A 4Q9LA 3RAPR 1G41A 3WXMA 3UANA 1COWD 1UJ2A 3LQRA 1KMHB 4DB4A 2RMKA 2ZSEA 2OILA 2W0MA 1TX4B 2ZI4A 4RJLA 3KUDA 4JLVA 4A92A 3L0IB 1OXVA 2OUKA 1NVXQ 2W0SA 2JLQA 1K8RA 3GLFE 1RRCA 2O0JA 3VKHA 2QENA 2QM8A 3PXGA 2Z83A 5HE9A 2GF9A 3ZQ6A 2BJVA 2Z43A 5DI9A 5DHFA 2DPXA 2FEOA 1G18A 5FOVA 2GVIA 4LPKA 5KNCA 3EZFA 1V43A 4IVRA 3VU9B 4HSEA 3VAAA 3BE4A 4QBHA 3TAHA 1C9KA 4G5QA 2Z5FA 1OH6A 4LYJA 1XD2A 2OCAA 3AKCA 4JLPA 2ZYVX 1XFAA 3Q5EA 3UG7A 3U7FB 3EG5A 4HLQB 4M21A 3TAUA 2Q3FA 4UJ3A 4TQ9A 4E5UA 3AVUA 3PUZA 3LW7A 2E1RA 2W2TA 2DBYA 1Z83A 5TB5A 4JVMA 4DLUA 4IKEA 2P2LA 3W6OA 3R8CA 2ZRGA 1N0UA 5KO2A 1R7RA 1RRPA 4B6FA 2Q6TA 1QHIA 2CNWA 3Q85A 4XSGA 3AP2A 2DYKA 2WWIA 2CXXA 1Z8FA 3KXIA 2AKYA 1W5SA 1XTRA 4GZLA 4BLRA 2QG6A 3TR5A 2BVNA 2WOJA 2VP6A 3DVLA 4DRZA 2ZYUX 1ZM7A 1NLFA 4RZ3A 3AVQA 3SOPA 2ZSDA 3K0SA 5AJWA 3ADDA 1XMVA 1AK2A 4OKSA 3GJ0A 1DBSA 3GCGA 3UATA 2G88A 5GJWC 3LAWA 3FMFA 4QM6A 2P67A 3IBYA 2V4ZA 5B2ZA 1GILA 3TIFA 5AUPB 4Q7KA 4JVLA 3ZS8A 2EU8A 1QHHB 2YJTD 2ZJBA 2ZSFA 3P1JA 4G3XA 3SE0A 4NU0A 1LV7A 1E9EA 3TW8B 1SVLA 1NVUQ 3CH5A 3BB3A 2YWEA 3E2IA 1L7VC 3X1WA 1L4YA 1SVWA 5F9FA 2HF8A 2IYTA 4NYIR 5JZVA 3A4LA 1ZNWA 3HU1A 2SHKA 1QHNA 3FTQA 3UMFA 5FPKA 3TSZA 1P2SA 2V7QA 4OJKA 2J7PA 1RYHA 1RJ9B 4ILEA 1KJYA 4B75A 2FPLA 4UNSA 1S1MA 2AXNA 4JVNA 1E98A 1OYYA 3AUYA 3KQKA 2ZRPA 4L16A 3THXB 4H9GA 2CMKA 1NVWQ 3NC0C 1XF9A 2AWOA 1VPLA 2QPTA 4EPYA 5SZHB 4LJ7A 5EXTA 4A15A 1FMLA 4OI1A 1YZQA 2Z6VA 4YDHB 2OAP1 3GQBA 2ZI9A 2C9YA 5C2JB 1HH4A 1CS4C 1W7AA 3PUXA 2XSZD 4B3GA 4MUAA 3P27A 4MYCA 4NP6A 3RWMB 1W0JA 2CVHA 2VRWA 1Z6XA 3NXSA 2BBSA 2FDCA 5KDOA 5EP2A 5FUXA 5E95A 4R71A 1F3OA 3LD9A 3SFZA 1Z6GA 3K0AB 1T3SA 2N1BA 4UKDA 1BOFA 821PA 3SJZA 1Z07A 2JA1A 2QY9A 3M0EA 3X1YA 1SVKA 1YZKA 4RD4A 4TLAA 2XB2A 4OK5A 4GOKA 3UMSA 4MRPA 2R9VA 5FTLA 1TTTA 1JEEA 3PV0A 4CGZA 3D8BA 1VYUA 4BLPA 1WDTA 3I1FA 3FFBA 1XXHB 3BFVA 2JLWA 4OK6A 4F4IA 5KUTA 3W5IA 1G17A 4Y0VA 2KBEA 2F43B 1KO7A 1FARA 3F8TA 2HXYA 4X8HA 1KNXA 2RAPA 3EPJA 3OESA 5L3SA 4OHWA 1HY3A 1T4GA 3UFFA 221PA 4I4LA 4M1WA 1A2KC 1YZTA 4D2IA 5BN3A 4RY2A 2IF0A 2O8EB 3SJCA 4ZI2A 4LV5B 4L5BA 1WF3A 3CXLA 1ZD1A 2RGAA 3MJRA 4FI3C 4UNNA 4XTCS 1NIPA 1IY1A 2O5VA 1TEVA 3GLGA 4H1VA 4M1SA 4D4LA 1SXJE 3L0SA 1DO2A 5FPYA 1NJFA 1OIWA 4W5HA 2NQ2C 3IIKA 1E69A 1JAHA 2R65A 4A8JC 3LQQA 4ACAA 3THYB 4QBGB 1OXSC 5FUYA 5CB6A 1FTNA 1DAMA 1W1WA 3X1ZA 1T9HA 1YE8A 2AXPA 2GJ8A 4XJXA 1OW3B 2ENZA 1NN3A 5FOUA 3SYNA 3V9PA 2WPDA 5LD2C 2XAUA 1EGAA 5JMTA 3RRZA 2XZOA 1F5NA 2B6HA 3A4NA 1W36B 3O8BA 2ZETA 3CRVA 5HZKA 3EPKA 1XD2B 3GJ5A 3BB1A 1Z28A 2QRZA 4DDTA 5B58C 3CLVA 3PITA 5BN4A 1G3MA 3KJGA 1J8YF 1TBNA 5JJLA 4RSGA 4QKQA 4W5JA 4URVR 4JYCA 3SI7A 1LF0A 5J4KA 3R9XA 3K09A 1CIPA 3PFIA 1AGPA 1QHGA 2PMDA 4JIMA 4TSFA 2IWHA 2RGDA 3QKRB 1RRGA 1G5TA 3KKNA 1FNNA 3CZPA 4HAUA 3KFVA 3BS4A 1DAFA 3WYAA 1UAAA 4IJMA 4AKEA 5J4VA 1OV4A 4IDOA 3NHAA 4PC3A 2BWJA 4NDZA 1BMFA 3CONA 3PJRA 3MWYW 4EKDA 4HI0E 4A2QA 4B35A 1OFHA 4W7SA 1GSIA 1XD9A 2Y8EA 3AGPA 4A2PA 4YC7A 2RB4A 5KSYA 3GLHA 5SZJA 3I92A 1UBEA 2E87A 2GK6A 4C4PA 4B73A 1UDXA 2XITA 3AH8A 1P3JA 4UXJA 3Q5DA 2QU8A 1QRAA 3SR0A 2J0UA 2GESA 3CF2A 3DMNA 3WHKA 1RZ3A 3A37A 5SZIA 2IF2A 2VP0A 3RDPA 3AVWA 2ECKA 2IYUA 1KSJA 2IYSA 2C5LA 1W36D 2NTYC 3ND9A 2PT7A 1A4RA 4LHYA 2RHMA 5FOTA 2G6BA 2QMHA 4FMCB 3R7WB 4A0FA 3R9WA 2OCYC 3ZDQA 3T61A 1KI1A 3MWKA 4HUQB 1HURA 5TVKA 4M0LA 3HU2A 4CYMA 2REOA 1T5LA 2OBMA 2PX0A 5ELXA 2VSOA 1GRRA 4Q18A 4KFTA 4I81A 3SJBA 4UNRA 1XNJA 1G8YA 5CDFA 3EPLA 3B1VA 2WWXA 3IEUA 2IYYA 2GILA 3KQLA 2CNWD 4QGFA 2AN9A 4AD8A 1ZU4A 1VYTA 3QKSB 1GP2A 3LX5A 1M8PA 1Z08A 1U0HC 4UJ5A 5G53C 1KO1A 2PCLA 3H1TA 1E9DA 3BH0A 4GP6A 5EE5B 2FG5A 4DDUA 1U98A 1W44A 3QBTA 2VRWB 1G20E 4HAYA 4N3NA 3U7HB 1ODFA 1E99A 2ATVA 3GFPA 3CW2A 3BIFA 1KTVA 2J7KA 1SKYB 1K5GA 4ZCMA 4ARZA 1LFDB 2BCGY 3TE6A 121PA 4PPFA 4OHXA 3H84A 1NY6A 1IN6A 2GEDA 4KITB 4US0R 1Z47A 2BIFA 1LB1B 4RD1A 5JCZA 2OBLA 2YNMA 2ZIAA 3LNCA 1UADA 2REBA 1KKMA 2RGNA 2VIIA 1P5ZB 1GKUB 2DB6A 3NEYA 1FFHA 4LC1A 4TL9A 2EFEB 4GRAA 1NIJA 1CF4A 2V7QD 4IOJA 3RANA 2PLRA 2J7PD 1ZNYA 1S3GA 3FGNA 4BFXA 3GLIB 4QJ5A 2IYVA 4TLEA 4TMWA 1E2KA 5EQTA 2YOHA 2YVUA 2NPIA 2GZAA 1P60A 2PH1A 2FOLA 4XWAA 4NH0A 1CR2A 2FEMA 3FKSA 5JRJA 3LBHA 4TLCA 1KKLA 3KTAB 4QM7A 1S8FA 2D06A 2UZ3A 4DC9A 2Z4RA 1Z06A 2VSXA 1XEWX 3T12A 2JLZA 2WWWA 3VR1A 4U5XA 5C4GB 3AP3A 5F9HA 2DFLA 1FTSA 2CCGA 2ZE5A 5J40A 2WWYA 1X8JA 4Q1DA 4R7ZA 2QA5A 3D3QA 3I5XA 1RPZA 1W0JD 1E9FA 4P33A 1NKTA 2GTPA 5CK5A 1NBMA 1SQ5A 2QNRA 5TMPA 3ZS9A 1EESA 3BORA 3BH7A 4D80A 2CVFA 1US8B 3BWDD 5BW8A 1TQ4A 621PA 5CDFE 4R98A 1VKJA 3FMIA 5G41A 3K53A 3SZRA 2P3SA 3FYHA 2FGJA 3JZAA 5FL3A 2PJRA 2OXRA 2P6RA 1JR3A 3P32A 3EZ7A 4PO9A 3WYGA 4F92B 1JECA 2NZ8A 4JSYA 2D7DA 5H68A 5ANRB 2BHRA 1CEEA 4DZZA 1N6PA 1YRAA 2ODBA 2N46A 4HB2A 1R4AA 3GJ8A 4NL4H 2YV5A 2W83A 1GUAA 1L4UA 2WIAA 4EPTA 2B8WA 2PL3A 5CJ2A 5FBWB 1GOTA 2P5TB 2V8OA 1VMAA 2VHCA 4JBYA 3QPWA 4ZKDA 3HPRA 2LKDA 4GZMA 3U6KA 3B60A 4FIDA 1WMSA 2C78A 4IDPA 4LJ9A 4V0KA 3U3RA 4BFSA 4EQ6B 2A2ZA 1U9IA 3TH5A 1MV5A 4JLMA 3UGIA 4JSTA 1X8LA 1F60A 2G0NA 4DLXA 3GLHB 1OH7A 2PJZA 2FU5C 3RRMA 1P9RA 2YOFA 3GJXC 3AF0A 2XTNA 4S2EA 4MITA 1OHHA 3U60B 2AFIE 1RVDA 2AKAB 4BWYA 5HZHA 3FMPB 2J0UB 1TUIA 4M1OA 4CW7A 1Q1BA 4PPNA 2YKGA 4B43A 1TU3A 2QT1A 1IN4A 4RFSA 5JSZA 4Z1MA 4MYUA 2WPDD 4FMDF 4FW9A 2QRNA 4B44A 1JQJC 2QPAA 4YMWA 3HP1A 1XTJA 3MRSA 4URUR 3TMKA 2CHVA 2MSDB 2J45A 2AHOA 4IVQA 5HKKA 2GXUA 3ZVMA 3BJIA 4LYAA 2PLFA 1V5WA 2KBFA 3K1JA 1P6XA 4A0RA 3GEIA 4IHQA 1GTVA 5E3HA 1NBME 3ADCA 2G9NA 4LZZA 4FKDA 4TSFD 5FOSA 4YMVA 4MDEA 1XCGB 3EASA 4H1UA 1W0KA 3K9NA 4HB4A 3NBXX 4ERNA 1NKSA 5J4LA 4MGZR 2ANBA 3M6AA 2C77A 3K8YA 3WY9A 1BMFD 5L8VA 4KFUA 2BMDA 3RVBA 4QGGA 4MUBA 2B7CA 1II9A 1SVSA 2J41A 4C0BA 2QQ0A 4C0LA 1NI3A 1II8A 2J1LA 4TZ6A 5KU1A 2GKSA 2IS1A 5D3MA 3RLFA 1D2NA 3K0EA 4UQOA 5DIFA 3QVUA 4Z8YA 1VG1A 3K0FA 3BERA 3B78A 3PUVA 1T0HB 2X2EA 1XJQA 3LX8A 1DADA 2ZRHA 3AF2A 1VIYA 1E9AA 4OI4A 4PPGA 4LYFA 2BMJA 4PSKA 4RKEA 4ZI3A 1E1QA 2NO6A 3IEVA 3X1XA 3MAAC 5AJYA 1ZMXA 2ZUBA 2IS6A 1QVAA 3GJ3A 4GL2A 2EFDB 4P4SA 1CJMA 1NN1A 4BE7B 4CF7A 4XSHA 2GCNA 3TUIC 4BLTA 2ZRLA 1TQ2A 2NO7A 2JLSA 4DCTA 1XP8A 1YR7A 3T1VA 4C2TA 1CR1A 1G3RA 2IYZA 2HLDA 3M4YA 2ANCA 4I1OA 3C41J 4XOIA 5D3QA 4NHOA 2O0KA 1TU4A 2GDJA 4NYMQ 2KB0A 1N5LA 3HYRA 3P4YA 3VR6A 1VG0B 4MQBA 2IYQA 3AF1A 1HUQA 4S35A 3SC3A 2YWFA 2JLUA 2P6NA 2H7VA 1L2TA 5AWFC 3SHWA 3K70B 2C03A 2BCJQ 2GXQA 2ORIA 1YHNA 1FP6A 5TY0A 3DKPA 5DNYB 5FR1A 3U3OA 3MMPA 4PHHA 1B23P 3QIAA 4ITRC 4C0JA 4DB2A 4C7OA 4HUTA 3DM5A 1FX0A 4O3MA 1YR9A 4B74A 5GVSA 4FXPA 1IJFA 3EPHA 4HLUA 2V6JA 3GJ6A 4KAXA 3GLFA 5L3VA 1R0XA 1T3LA 1Y8FA 3WRXC 2ODEA 3SQXA 2GCPA 1UKZA 2HT6A 3I8SA 4OHVA 2OSBA 2O52A 3IO3A 3KB1A 4RKFA 3U7EB 4LCBA 5JBQA 2A5YB 1KBFA 1Q1QA 4N1AA 4JKYA 4OQNA 5IRCD 1H8EA 1G6OA 3WBKA 4DVGA 3WHLA 1G3IA 1XCPA 3U3MA 4B3DA 2GETA 2H92A 2JIZA 1TADA 3FHOA 3C14C 2ELIA 3A1VA 4Q4AB 4PAMA 2ZJZA 1YKSA 4GMDA 1ZIOA 1GRQA 4M1KA 2ROWA 5HE8A 1NMZA 3W90A 3CRW1 2GZHA 2VP4A 2PZFA 3WP0A 1ZNXA 4BRUA 1DG1G 2BBTA 2AFHE 4BEJA 4FD2A 4EJSA 1G6HA 3B1XA 3FKSD 4LGMA 3UGDA 1RFHA 4RD0A 2A7QA 3K70D 5TXGA 1AJEA 1CR4A 2YWGA 4MGIR 1Z6YA 1ZC4A 1ZU5A 4MYTA 2YUUA 1GFIA 1R10A 4IDNA 3LW8A 1R0ZA 1NLZA 2VHQA 4EIWA 3CPJB 3G0HA 5K8UA 3NC1C 1DAEA 3RS4A 2FA9A 1NBMD 1YJ5A 2R6AA 5JSZB 1AN0A 3KFXA 2DCUA 3EIHA 1FOEB 3QJYA 5JWOA 5GJVC 4EUNA 1GKIA 1IN5A 5J47A 3LWNA 2N42A 5BQ5A 1FQKA 3BAFA 1S2MA 4QBFA 2KE5A 3O8DA 5F98A 2D4HA 2VP2A 1W4BA 3NIBA 5JI3E 3UG6A 2MSCB 1CJTC 1H65A 2HT1A 1I2DA 3QKTA 4Q4JB 1N6OA 3ADKA 1T3HA 3PEVA 2A5GA 2JGNA 2QMOA 1Z0IA 2WJHA 1JR3D 1FMJA 2Q9CA 1RRFA 2ZRAA 3CX8A 4Q1EA 1N2CE 1ZM3A 1CRPA 1VHLA 5G3YA 2MSEB 5AK0A 4J0QA 3AKYA 5IHPA 3KB2A 3ZZTA 5FUVA 2IYRA 2DR3A 2QM7A 1CRQA 4LC0A 2NGRA 3SQWA 5H1YA 2VH5R 6Q21A 2QL6A 1RKBA 1ZM9A 4FWIB 4OQMA 4BRWA 421PA 4BFWA 5KNDA 2WWHA 1KI2A 2GZDA 2VEDA 4LUCA 4P32A 4EFNA 2Q9AA 2DFTA 1XJCA 3WNCA 1G9XA 2OLJA 5D3MB 3B9PA 4ESHA 5CB8A 2ZU0C 4L4UA 3B82A 4WZBE 3UEJA 2L0XA 4M8NE 4BECA 4GDFA 3K0FB 1Q1EA 4DDVA 1N0WA 1Q3TA 1XJ0A 1YVDA 3CPHA 1MO4A 1Q22A 1OHHD 2QGZA 3NG1A 4I1SA 2H5EA 3REFA 4U00A 3T1TA 1DTSA 3C5HA 3DM9B 3C5CA 5EE9A 2AD1A 4V0NA 4B3XA 2XZPA 5FI0B 2QN6A 4I1UA 4M22A 1M7HA 2FFHA 5LBIA 4Z1MD 3REGA 5JHGB 2NO0A 1Q21A 4HZUA 3ICQB 1JPNA 4Q1CA 5CJPA 4P4SB 1C1YA 3V4RA 3WMFA 2PX3A 2XOKA 4BGDA 4LHVA 2OLKA 2CK3A 4QGHA 5JLJA 4Q01A 2CCKA 4HB3A 4TL6A 1GNQA 3NVAA 5HKKD 4IFEA 1NVVQ 1IOZA 1VCIA 3NDPA 2IL1A 3QE0A 3FOZA 1PUIA 4MRSA 4PANA 2Q21A 3B6EA 4LV8B 5CYOA 1SVMA 3D6TB 3CRRA 2O8CA 3B8HA 4BFZA 4JLDA 4Z54A 2ATXA 2WKRA 1E9SA 2VLIA 3NBZC 2UZIR 1W0KD 2GEUA 3M1IA 2RKOA 5FPHA 1F6BA 3IGFA 3LBIA 1AQYA 4CZ2A 5K8TA 2YYZA 4DKXA 5CM8B 3UKDA 3KKMA 4DLRA 2WJJA 4C7OB 1T8TA 1SVOA 5DSZA 3BD9A 4Q1AA 2WMOB 2YC2C 2RH5A 3NTUA 5AJVB 3CPEA 1NMXA 3I5YA 1NG1A 4MA4A 1SXJA 1VECA 1PUJA 2QTVB 3LBNA 2F1JA 4Q19A 1EK0A 3N2IA 3AVPA 1OH8A 3GLFB 3TNFA 4AYWA 2B92A 2O8DA 2FN4A 1HV8A 1S9HA 3RC8A 3U61B 1E2EA 4DJTA 1MABA 3FMOB 4RD3A 4IXNA 1E2DA 1J8MF 1OFIA 3W3AA 4E03A 1E1QD 2GXAA 2RGEA 4ZO4A 4Q47A 1CJUC 1GL6A 2GJKA 4QGAA 3X1DA 3GPLA 1XU4A 1G4AE 1GG2A 3E70C 3QF4B 1GITA 2C04A 2R6DA 5C46F 5DHAA 2A5DA 3GP8A 3KY9A 4DSNA 1E9BA 3CWQA 4Q9JA 2IEYA 2EYUA 2YOGA 2HLDD 5FBQB 3FWYA 1J7KA 4FMCF 2J3EA 2H57A 3AVTA 4TL8A 2EWWA 4YMTA 3AV0B 4LYHA 3NH6A 1Z0JA 4O2RA 4DWJA 4DT1B 2V1XA 4EJSB 1J2JA 2WJIA 4QG7A 1GWNA 4C9BA 1EWQA 2ZUDA 1PTRA 3AM1A 2ZUCA 4DCNA 1G64A 2F3RA 4OQFA 5FTJA 3K0CA 2YZ2A 4TL7A 1ZAKA 3EIEA 2LKCA 2QZ4A 3VR4A 4TTRA 2ZSAA 1E0SA 1XDBA 1E2MA 5FUWA 2ZRKA 3X2SA 2H16A 1GKYA 3PEWA 3OIWA 2GBLA 2GJ9A 2O8BA 2ZJYA 2XZLA 3ASYA 2HXSA 2CLSA 2B8TA 3DZDA 1ZJ6A 1VDZA 2PZEA 4F38A 2X8AA 3B2EA 2OFWA 4RZXA 4A36A 4M1YA 4QHYA 1QVRA 5E7MA 1P73A 2EW1A 3SN6A 4D26A 1G7CA 2PEZA 4Q03A 1ESNA 1H8ED 2F9LA 4K8OA 4KSBA 2JLYA 5A4JA 1E0JA 4GP7A 4D82A 2C8VA 1WE2A 4TMZA 5DGXA 2JIZD 3P20A 4D25A 1TMKA 1G19A 1KDTA 2V9PA 3LLUA 1UEJA 4M9SA 2H17A 3RSOA 3EZ2A 1MO3A 1UPTA 3L0PA 5FR2A 3QI2A 5DISB 1MO6A 1H8HA 1HYQA 4BZXA 4C3ZA 5BXQC 3TW4A 1EG7A 3BFXA 1RC8A 3KKPA 2BM0A 4DLZA 1A82A 2GK7A 1W36C 1N6NA 3C4JA 3Q7QA 3U7GA 4MRRA 1Y63A 1UEIA 4AKHA 1N6RA 3BC1A 1DE0A 2ODNA 1JB1A 4KODA 2FFQA 4AI6A 2FPKA 1DAHA 1RFLA 2GA8A 5TDHA 3WP1B 1NG9A 1U0LA 4C0QC 1FZQA 3Q7PA 5FTKA 4B2PA 4ZPXA 4AK9A 4LWZA 4Q5IA 3DPUA 1UKEA 2ZE7A 3T06B 1Z29A 2YINC 2XNDA 1HQYE 1OSNA 1Y3AA 1DELA 2HDNB 5M04A 5DN6A 3B1ZA 3PENA 3QXCA 2O8FA 1FAQA 3LY5A 5BYJA 3AVVA 4G5OA 2BJWA 2GJSA 5KHOC 2VHTA 4CRWB 3DO6A 1E0AA 4NBSA 4HDOB 2V55B 4W5WA 4HZUB 3CX6A 3EA0A 3ADBA 3IPYA 3HPQA 1XCMA 3ZD6A 2ORWA 2GF0A 4A6PA 1RYFA 1O87A 1R5NA 2FNAA 1E96A 2ZROA 4G1UC 4LJ6A 1TUEA 4E09A 1D5CA 2WV9A 3KJEA 4PHTA 4LK2A 5KSZA 5BYKA 5J4YA 1ONBA 2VHJA 4ON9A 4HAXA 3W34A 4ASUA 1XB2A 4KO8A 4DSTA 4IDQA 2AD5A 1QF9A 1ETUA 4US2R 5B30A 3AF4A 4MGKR 4Q9IA 1AGRA 3WMGA 3C15C 3F5FA 2D2FA 3QXSA 1QZXA 3HU3A 3NWJA 4DHEA 3QSYA 3I62A 3UPUA 3ZVRA 2DB3A 4BZPA 2HYDA 2J5XA 1G21E 4LJ8A 3NBFA 2WSMA 4Q7LA 3TUJC 4MYHA 1OXUA 4PZYA 3GFTA 3QEOA 4BZQA 1ZD8A 2QI9C 5AUNB 4LJ4A 4JT4A 2CL0X 1DVRA 2IXFA 3A1TA 3V4FA 4X8OA 1G7RA 5DI3A 4A9AA 4D4KA 3GLIE 1GM5A 5CLLA 3L82B 3QY0A 4GNKA 3SFVA 2O8DB 4PSAA 2Z4SA 1KSFX 2WTUA 4EPRA 1MABB 4QHSA 1G7SA 3QENA 4JLNA 2ODWA 3RSLA 2GAOA 4C30A 1R0WA 4DIEA 4WXRA 3TKLA 3NEJA 3BOSA 3RS0A 2KI5A 2WJGA 4WW0A 4QNMA 2VL7A 2JJ2A 1KMQA 3GJ7A 2XOKD 2J0SA 2CK3D 2Z0MA 3QEJA 4CVNA 5JJKA 4AYXA 2QAGA 2FGKA 4YONB 5GJBA 3O47A 3CRQA 5IT5A 2NZJA 1UFQA 1TEXA 3N5CA 5KPJA 4QJ3A 1KJWA 5EP4A 4MRNA 4G01B 2ZRCA 3GEHA 3VHLB 3AKEA 4HLCA 5EE0A 2P0EA 4F7WA 1T0JB 1G8FA 4WZAE 3FDIA 5EE1A 1KI8A 1XMJA 3LO5A 5CYPA 4TYYA 1X1RA 4O25A 2QROA 3EXAA 1LW7A 2DWPA 1P2TA 3GD7A 3RS5A 2ZJ8A 4NCIA 1D2EA 3QOFA 4JBXA 2QBYA 4NYIQ 2WOOA 1KI7A 1MR3F 1ZM4A 3RYTC 1OKKA 3F3YA 3N70A 4OHYA 4Q1BA 1U81A 4BFTA 4DLYA 2Q3MA 2LWIA 2JASA 1E2HA 2GCOA 5C1BA 5EJEA 2PCJA 1SXJD 2HCBA 1DAGA 2I4IA 2BMEA 2O8BB 1UDWA 4RD2A 4A6XA 5FTNA 8OHMA 1IXRC 3RWOA 2WICA 1BH2A 1AS0A 3RABA 5L3SB 5K8IA 1G3QA 4NYJR 1N5KA 3E5HA 2Q3HA 1Z0AA 2QSZA 5JEDA 4TLDA 1W2GA 2EFGA 4LHXA 2IUSA 2RHDA 3KDSE 4URZR 3HWSA 3GLGB 1DAKA 4D4JA 1TF5A 1S96A 1OFTA 4BLOA 3CR7A 2PMKA 1KI4A 1L8QA 1G5PA 1M7GA 2IYXA 4Q9KA 4JMPA 1R2QA 3IILA 1GNRA 4IDHA 1LTQA 2J0VA 4DBLC 3VR3A 2JEOA 2ZRJA 1IBRA 1Z5ZA 4HDCA 4YQFA 3AP1A 4NCHA 4TQAA 3K09C 3VQTA 1U2RA 1CJKC 1Z2AA 4D0GA 3THOA 1M2OB 5L3RA 1IXZA 1XRJA 3OIYA 3SBEA 1NN5A 3THWA 2WAYA 2WWGA 1WQ1R 4XVUA 3BK7A 3KQUA 1W47A 4LHWA 1Z6AA 4XTRA 5KOYA 4WZ6A 1P72A 4YXWA 4MKGA 2QT0A 5LB2A 1GL9B 1CR0A 2HCJB 3H86A 1G4UR 3U3JA 3CF0A 2FSFA 4B48A 2GWHA 1E2LA 2UVQA 1D2MA 2ZVPX 5DYGA 4KFSA 2QSYA 2D3WA 3K9HA 1ZUIA 2GAAA 2FWRA 2CE2X 4B2LA 1KK3A 4IRUB 4ZCLA 4JT2A 1KI6A 2X2FA 4TYPA 2CL7X 1D8TA 2XNSA 3B85A 3KUCA 4JLJA 4TZ0A 1LS1A 2CJWA 4EPXA 1OT3A 1PJRA 1JI0A 2F1IA 2WJVA 4Q7JB 2QAJA 3L2OB 4NCKA 4QFMA 4TN1A 2FZ4A 2PT5A 1H8HD 1X86B 3VR2A 2YC4C 1GIAA 2PBRA 1GRNA 4LJ5A 2CHGA 2VBCA 4LPSA 4OQXA 4QL3A 4ZDWA 2VP9A 4B3BA 2F1RA 1LY1A 2IHYA 3D31A 3DDCA 4M4SA 5CIWA 5FL7A 3DOEA 1XBTA 1E2FA 2JLXA 1YU9A 2CL6X 3QBVA 5BWMA 1Z3IX 2XJ4A 5CK4A 1ZINA 2FX3A 2P65A 1X1SA 1FPMA 1P9NA 3GJ4A 2G1JA 4LBWA 4OI2A 3PEYA 3DOFA 4LJAA 1HT2E 4JLAA 3FKQA 1AKEA 1N6KA 5DI3B 4TYQA 1KIMA 2XNDD 1MH1A 1AIPA 2BOVA 2OZEA 4V0ME 2I3BA 4PQFA 4ZCIA 5A0FA 2OO7A 1ZVQA 5DN6D 2NIPA 3U4QA 2ZI5A 4ESVA 2ZJ2A 4C0HA 1E3MA 1IAQA 1ZCBA 3OF5A 2HUPA 4BEBA 2RGBA 1Z0FA 3UWKA 2ORVA 3UK6A 3VTKA 3A1SA 2QUZA 4AWXA 2BV3A 2OV2A 1ZM2A 4L9SA 3VKWA 1KMHA 4HATA 3IIJA 3LXXA 5DO9A 4PHGA 3ZH9B 4CDGA 3OEEA 3VX3A 1B0UA 1N6HA 1W5TA 3TQFA 2W2XA 1FP7A 2QAGB 1E2NA 1VYVA 3CM0A 2E73A 3MFYA 3PG5A 2A3RA 2OFXA 5FBRB 4ASUD 4RVCA 2R8RA 4CEHA 3EA5A 1UM8A 4US1R 1S4QA 2IBMA 3EARA 5FOWA 1LF5A 4Q9HA 3SNHA 3VX4A 1S9DA 3W5JA 2G0TA 4ARZB 1IJEA 5JWRA 5EXSA 2RGNC 5EXPA 1XPUA 1KK0A 1XEXA 4HB0A 1WP9A 1ZW6A 4ACBA 1E2JA 2IC5A 4CEIA 2QBYB 4KV9A 2OT3B 4UNQA 1XMSA 4RZ2A 2AWNA 5JS7A 4L15A 4YLGA 2B7BA 3CB4A 3CNNA 2DWQA 1M7BA 4KJZA 4FMBB 3PVSA 4MRVA 1M6NA 2ZE8A 4Q7MB 4JL8A 1AQUA 3MSXA 2DFNA 3TK1A 2KSQA 3QXJA 1YZNA 3CH4B 3SS8A 4AKGA 1W4CA 4PR0A 3P26A 1KO8A 3K70C 3KX2A 1P2VA 1KHTA 1GAJA 3DKVA 2JDIA 5EZ6B 1XWIA 3FPAA 1XPOA 4DSUA 2I1VB 1VCNA 5FOXA 2J46A 1JR6A 1T6NA 5HCIA 2IWRA 1VCMA 2R6FA 2BM1A 4KHZA 3RS7A 1LS6A 4X8LA 2ZS8A 2J9RA 1XTIA 1IN7A 1BKDR 2JJ2D 1ZUHA 3G5UA 4JJZA 5FI1B 1D9XA 5FFMA 1G1MA 1OYWA 1Q44A 4PPQA 2QE7A 4WA7A 3V00A 2HJVA 4RD6A 1AZSC 1HE8B 4GBMA 1VTKA 2J87A 3PQCA 2ZI6A 2QORA 3ECCA 3WRYC 4ZDJA 2ERXA 3MG9A 3H2YA 1ZP6A 2H1LA 2F55A 1G291 5J4HA 4XWKA 1P9WA 1P2UA 2OFOA 1E32A 2A5FA 1U99A 2W6JA 4GOXA 1E0KA 1NL3A 3LRPA 2ZEJA 5EP1A 1HE1C 1ZYUA 5CIQA 1I4TD 4PHFA 1GNPA 3FE2A 1NNEA 3TLXA 5H8WA 3OE7A 721PA 3NKVA 1OKKD 1WBDA 4QRHA 4ZDIA 2ZJOA 1QHYA 2FFBA 2ZRFA 5JS8A 3THWB 1TAGA 2JJ1A 3UGLA 2BDTA 4URXR 3TSWA 1R0YA 3T5DA 1T8UA 4LRWA 4TMTA 1P4SA 2ZYWX 3Q9LA 3TBKA 2HYIC 3ZLJA 4KLNA 4TTPA 3LXRA 2MMGA 1TNDA 4PC6A 4HAWA 1GDDA 4B33A 1KAGA 3MJHA 2WZQA 3B1WA 1U9IC 5CITA 3JVUA 4P31A 1XD8A 4BFVA 1WA5A 2NOAA 4B32A 1W4AA 3WMEA 4XH9B 3N2EA 4Z51A 4B76A 1E9CA 3JZMA 3QF7A 3VR5A 1BYUA 2CJWB 3IHWA 3G82C 1AA9A 4TQUS 1PVOA 4II7A 2WKPA 2AK2A 3GEEA 1EFUA 3QG5A 2CEAA 4CT5A 3QG1A 4HAVA 2WVJA 2OHFA 4RFSB 1BS1A 2ASEA 3K0AA 4Q00A 2ZR7A 1TBOA 3ZVLA 4KCGA 4GPTA 1K5DA 3E1SA 4OL0A 3TVTA 3TVDA 1KY2A 2V1UA 2BC9A 1IM2A 3BJIC 4A2WA 1FUUA 1G5RA 4GSYA 4CEJA 3H0KA 1AS2A 1I4LD 1DEKA 3AB3A 3LV8A 4LBYA 1N3BA 4EPWA 3MWLA 1MOZA 4BFUA 5AR1A 4IVPA 4Q66C 1XMIA 2BMFA 3U4QB 2PEYA 1IXSB 3FVQA 4KI0A 4YXWD 2IX3A 3VFDA 4RCZA 1D6JA 1U8AA 2ZAOA 3W6PA 1Q0UA 1F2UA 1P61B 1WB9A 1JPJA 2UKDA 3CZQA 3EAQA 3FHCB 2F7SA 1OF1A 2F6RA 1DO0A 1HTWA 3B13B 4LV6A 3SDZA 4TYNA 1KDOA 2O8EA 1ESMA 1GZSA 5EXXA 1YR8A 4BLQA 1MKYA 3RRNA 1UBFA 1YZGA 1XZQA 1II8B 1N25A 1NRJB 1ZUNB 2IT1A 3KKQA 4FINA 3EX7C 4OYHA 2HF9A 4AY2A 1KO5A 2ZRNA 3LVQE 4CEHB 4TT3A 3THYA 3T1OA 5B57C 2ZR9A 2IUUA 3T15A 2B21A 3SYLA 4F93B 2FV8A 3QUSA 1PTQA 3ZYCA 4A8JA 4DLTA 1XEXB 5K8LA 2IUTA 1P7CA 3EW9A 1DG3A 3KXLA 5E4FA 1EFHA 4OJQA 2OCBA 2NG1A 3UWOA 4CEIB 2C2HA 3I72A 5FL7D 4AIIA 1U8ZA 4AC9A 3ICEA 4URYR 5FPTA 1SHKA 1SZPA 3JVVA 1Z22A 3PCRB 1QHSA 3IQXA 3WYFA 4C0AC 2C95A 3W8NA 1OJLA 2WIBA 1YZLA 2C96A 2J0QA 2D7CA 1ZIPA 1P62B 3PUWA 4Q4HA 5DE3A 3A8TA 5EUQB 1KSGA 1N5IA 4DCSA 3Q72A 1BIFA 2ZAMA 4M9ZA 1CU1A 5KNBA 3QKRA 1KY3A 4TLBA 5EZ5A 3VNVA 1E4VA 3NDBB 3I32A 3LA6A 4A0GA 1XA6A 1BO6A 2FH5B 3ZGXA 2VF7A 3PR1A 3TGPA 1XEWY 4A0HA 2EFHB 3MD0A 4O0MA 1CJVC 3IHLA 4KLZA 3OEED 3I61A 4MKIA 5FTMA 1XTSA 2C99A 5JWHA 4HLUC 1NJGA 5FBLB 1HEIA 1PLKA 1FX0B 3R8FA 1XXHE 2DY1A 2FNFX 3QXHA 2HJGA 4NE2A 1KZGB 2V3CC 1KDPA 2ZITA 2WJYA 1R6BX 3AKDA 5AJZA 4C0KA 3QXXA 2C9OA 4JL6A 1JAIA 5HPYB 1ELOA 2VTKA 4OI0A 3LVRE 4DUGA 1CTQA 3CBQA 4TWZA 2ZM5A 4FCWA 4AURA 2ZXUA 3PUYA 3O8RA 2F9MA 4LI0A 1LNZA 2WAXA 4DEXA 5B64A 4M9QA 4EFLA 1Q20A 1U94A 3R7WA 3U5ZB 1DARA 4TMVA 4HUQA 3EZ6A 3OHMA 4FCTA 4EJSC 1W49A 5LDDC 3A58B 4M9XA 2WHXA 3ONWA 4KFRA 4P4TA 1YRBA 3U3KA 3HJNA 4BFYA 5KPDA 3PEUA 4PC7A 1EFCA 4LX0A 3J81k 2JDID 3TSOA 3ZZ0A 3VNUA 1EX7A 2J59A 4GFDA 4V0OA 4QOSA 2BEJA 2DFKB 2R62A 3EWAA 4TMKA 4B6DA 1JQLB 1OFUX 3T35A 3QKSA 2G77B 2ZR0A 4D0NA 5KDLA 1JEDA 3TJZA 2LCFA 1KNQA 2QE7D 2FMXA 2BBOA 3CWZA 4JBWA 3IO5A 4UNPA 2WMNB 5UKDA 1NP6A 3ZIAA 1W4RA 2X77A 3IPXA 1E2PA 1D9ZA 2W6IA 3OFNA 3LLMA 4GI7A 4ZIRA 4KYIB 3U2QA 1M1YE 4LOAA 1ZC3A 4KBFA 4NTZA 1TQDA 4JLOA 3SYKA 2IEZA 1PLLA 4RCYA 2W6JD 1CKEA 5EUMA 5HCNA 1UKYA 2ZE6A 3I4LA 5GADl 4CEJB 3DL0A 1HT1E 2XGJA 3L8ZA 3NBYC 1ANKA 3CF6R 3B7GA 1E2QA 2ZPTX 2P6UA 4NZYA 4F4JA 3OE7D 1RE0A 4R9UC 4L9MA 2K5UA 3HDTA 4LY6A 4B34A 5IK2A 1JBKA 3IKJA 1GVNB 2JJ1D 2GEVA 5P21A 4QBIA 5IF9A 5LPNA 2WSSA 3ZVNA 3GLIA 4IEIA 1VCOA 2A78A 1NSTA 4MKFA 3C8UA 3KJHA 2OM2A 3BB4A 3LDAA 1F2UB 1BYIA 3KQNA 1E94E 1IN8A 3AF3A 2H8KA 2ONKA 1YR6A 4Q48A 3KTAA 3A1WA 4X8MA 4LJYA 521PA 2BKEA 2E9SA 2G3YA 2OXCA 3W6NA 1N6LA 3CRMA 4JLBA 1Q57A 2ZRIA 1WRBA 4LBZA 3TQCA 1DPFA 2R6GA 4Q21A 4RFVA 1JXMA 2CCJA 3BBPA 1SHZA 5SZKB 2RGXA 1CBUA 4OBEA 4ZKEA 2ERYA 1NF3A 4IW3B 3DZ8A 1E9RA 2C9CA 1NY5A 4V02A 1RW4A 4WIAA 1AKYA 2A9KA 4A8JB 3QQ5A 4QXAA 1US8A 4M1TA 5E7JA 3U6BA 1M74A 5C18A 2XXAA 1NMYA 2X1VA 2D62A 1AZTA 3TR0A 3WNBA 3RNLA 2QTHA 1EWRA 5LD2B 2GRJA 1S1CA 2CDNA 2ZREA 3HR8A 3UEYA 4KYUA 2ZQ5A 4NONA 3OEHA 3GMTA 4IOKA 4LBVA 4PQYA 2Q9BA 2REXB 4Q4HB 4TTQA 1RIFA 1U8YA 2OEPA 2QMUA 3CX7A 4POAA 1E2IA 1S0UA 1Z0KA 1SKYE 4TMXA 2O8CB 1PV4A 1J90A 1VHTA 4JZKA 1II0A 2WKQA 1PLJA 1S3SA 4MH0R 3LH5A 1IONA 4N0EA 4PC2A 3W8RA 3FB4A 1N5JA 4K46A 1FW6A 1EXMA 3OAAA 2CBZA 2C98A 5DYIA 3T34A 4NMMA 4EQ6A 4AKIA 1SXJC 4F4CA 1A1VA 4XVRA 2V54A 1Z2CA 1SXJB 4TT3D 3ZZUA 1K6MA 1KSHA 2ZSBA 3B1YA 4OQLA 2NMVA 1SVIA 1ZNZA 1KI3A 2CHQA 5FPSA 5CLQA 4XIGS 1EX6A 4PX9A 4DIDA 4V03A 2QTFA 4E07A 4DSOA 1WXQA 4NPHA 2I1QA 1E4YA 3U44A 1NLYA 3MCAA 4D6PA 5HR5A 4PAQA 1G8HA 1KI9A 4GT1A 3T1QA 3ASZA 3GLGE 3NH9A 3K9GA 3IBGA 3P4XA 1J70A 1IY2A 3HR7A 3L43A 2FE4A 4JYBA 4DDWA 5L3QA 1OXXK 1Q12A 1E79A 1PZNA 3IUYA 4HEJA 1I2MA 1O3YA 2JATA 1E2GA 2QP4A 3EIQA 4M2LA 3CNOA 2CLCX 1N0VC 3I73A 1Z0DA 1MRNA 4NYMR 2ZI7A 4KVGA 3BFKA 1KJZA 3T5GA 3IQWA 2EWVA 2QMEA 2XB4A 3ZJYA 1XTQA 3D7MA 5FBVB 1Q3HA 1MT0A 3K0CC 4JLKA 4OK3A 2DHRA 4URWR 2GNOA 2AL7A 2VF8A 4ZDKA 2YHSA 1DS6A 5JRZA 1QG2A 5AUOB 1SULA 3AGQA 4B71A 2GBLC 2BKUA 3F0TA 4N0DA 4AG5A 5GVRA 4NCNA 1IQPA 1UF9A 2EVWX 5JJIA 1KZ7B 2FJUA 2VHUA 5CM9C 2IS4A 1ZD9A 1R8SA 2VO1A 4ZIRB 3ZQJA 3KL4A 2EYQA 2XTZA 1KAOA 3TRFA 2ZRMA 5JI2E 3LFUA 1NN0A 2VYFA 4O2LA 5DH9A 4B6EA 3CIOA 3RC3A 4DUGD 3TUZC 2O0HA 1CP2A 1UBGA 2NO1A 1OB2A 1R79A 2H18A 5AJXA 5JEEA 3GLHE 3I3SR 1W46A 3BH6A 1ZBDA 4U02A 3QKUA 1A2BA 2W00A 2Q0HA 1E1RA 1T91A 2WWFA 3CKLA 4V0MA 4Y0AA 4A82A 3BGWA 2QGNA 2GJAA 4EAQA 1JALA 4LDJA 4B2IA 4KXFB 2IXEA 4XD7A 1VG9B 2PZGA 5EE3A 1JJVA 4AYTA 1EFRA 3OZXA 2JLVA 3AQ4A 4IEEA 1TL7C 4M53A 2X19A 2QPOA 2BBWA 4G5RA 1YQTA 1ZRHA 3EC1A 2GVZC 2RGGA 5AUQA 5C4MA 1X8KA 3FHTA 4TYWA 4C0SA 1AM4D 4F91B 4D81A 1JNYA 2A30A 2CE7A 3W9YA 3ZIAD 5KDDA 2HEIA 2O8FB 4BLSA 2W6ID 4FCVA 1QBKC 3OFND 4YMUA 3MGCA 2ZU6A 1KBEA 1FL9A 5G40A 1IY0A 2EQBA 4DXAA 3S1AA 1F2TA 2XXAB 1COWA 4QHTA 1M34E 3UMRA 2ZJAA 2EFCB 2JLRA 2WBLC 5H70A 2YWHA 2IA5A 4NKRA 4WXPA 4ABYA 4DCUA 1CXZA 1G7TA 4I1VA 3L0OA 2ONJA 4BPBA 4Z8XA 3GFOA 2P5SA 4Q4AA 2OCPA 1CULC 5IK2D 3KQHA 4PO8A 1QHXA 2WSSD 1R5BA 2QEQA 4CIDA 2AK3A 2OE2A 5IDVA 4DLSA 3NHBA 5DLQC 1NSFA 4RZUA 3VKGA 1AS3A 1C4OA 2FSIA 3MUFA 3Q8XB 2IK8A 3A1UA 4QNRA 4UXIA 4BQSA 3AVXA 3CNLA 4OHZA 1N6IA 4HAZA 4B3CA 3BRWD 3QVVA 3H4MA 2XEXA 4D0LB 1X3SA 2G1KA 4WAUA 4LHZA 4GOJA 1UKVY 5JHHB 3RS2A 1OIXA 2JAQA 3EWSA 4P3YA 1YZUA 5KTYA 4G0NA 1F48A 1XPRA 1Z6TA 4C2UA 2KJQA 4JJKA 1KGDA 1W2HA 2FPMA 4M1MA 1MRSA 1T5IA 3U44B 4EDHA 1FUKA 3EC2A 1XTKA 3CO5A 2FZLA 4YMSA 1OH5A 2QAGC 4MGYR 1SGWA 4PSVA 1SKQA 3W3ZB 2XTMA 1KOFA 2A5JA 2AX4A 4HLDA 4Q4JA 2IHBA 3OEHD 3ND8A 5L3QB 5FH9A 4U7DA 4MDFA 1A7JA 1NVVR 2IXGA 2R6CA 3I8XA 3UXMA 4JVSB 3SBDA 3QPVA 2D74A 3QPUA 4XVQA 1FNMA 5A5GA 4HYYA 1OPXA 1G16A 2JCSA 1HA3A 4B47A 4PC1A 1Z63A 1G8GA 3K9LA 5TV2A 2ZS9A 4FN5A 5JFGA 1E6CA 2ZTSA 2FSGA 1JXOA 2NPFA 5G3ZA 3VU9A 2WM9B 3AUXA 3Q3JB 3OAAD 1I4DD 2G83A 2ZS7A 1OXTA 4JS0A 1UBCA 1VG8A 3WBJA 4BASA 1JR3E 1J99A 2D2EA 2RGCA 1P75A 2IYWA 3RS3A 4JKIA 4YDSA 2GCOB 2IYLD 2FSHA 3VMFA 2F3TA 2XJ9A 2OESA 4PO1A 5F2EA 2ZANA 3CUEF 3FFAA 1G3UA 1KK2A 4GMXA 4A4DA 4BUJA 1EFTA 4PTLA 4L8GA 1OE0A 3KXKA 4EPVA 4NCJA 3C16C 2W58A 4PZLA 1JJ7A 3SHFA 4KVAA 4W9MC 3CR8A 2V6IA 2HV8A 4Q02A 4B3FX 2XSZA 3QNUA 1KK1A 1XZPA 4R2HA 4EFMA 2FFAA 2FF7A 3PIRA 2ENNA 2AR7A 1E79D 4MKHA 1GL7A 1U90A 1OB5A 3A36A 1QG4A 5BN5A 1KYIA 1ZCAA 4HDQB 3IDQA 4Q4LA 4WVFA 4Q1FA 4QJ4A 4L9WA 1OLOA 1QHHA
chains in the Genus database with same CATH superfamily
4TTIA 2Q6VA 3B48A 4OHBA 5YASA 1THMA 2AHRA 2C4TA 3U4DA 3WLOA 3PTLA 3Q1LA 3TW8A 3RTBA 1Q1ZA 4EELA 3DOOA 2HFJA 1QO0D 4R2IA 1YQQA 3AUJB 1FQJA 1K2VN 3FJYA 1W48A 3K30A 1XC7A 5EKSA 4GM0A 3WIUA 5JZ9A 2Z1DA 1N2BA 3D9QX 3I6ZA 2P5UA 4AY3A 1TPZA 4C7VA 1WBBA 5C8YB 1EM8B 3M3PA 2NXCA 2W6MA 4H6WA 4NAUA 5KI6A 4U2GA 1CT0I 3T3OA 2VC2B 3EK2A 5FEMA 3ZV5A 2I7XA 1O5TA 5K2OA 1RJ9A 2G76A 4PONA 3A28A 4G5SA 3ETLA 4FNMA 4RKWA 5EJAA 5J5CA 2OYRA 3CPSA 4KRYA 5HUHA 2ZBPA 3E9RA 3UGJA 2CJFA 3CW9A 1YS4A 2QMQA 2HADA 3SEAA 3R9IA 4PFSA 3V7FA 3S1AB 3Q8WA 5CJJA 4UDXX 3U0BA 3VHXA 2KYRA 2IW3A 5JVDF 3KKOA 1YA8A 2GHIA 3B4VC 1QZTA 3NOVA 4BN4A 3NANA 3OIDA 1RQGA 4IGFA 4EHKA 4DLVA 3FOAA 1M8FA 3LUJA 1EZ1A 3SU8A 5LYJF 1A9PA 2XY4A 3GMSA 2AEMA 3PK0A 1R0SA 5EP3A 3PUHA 1XAIA 1P2GA 1W8IA 3KYCA 4WNAA 2O4CA 1AQ6A 4MUHA 3SF0A 1WB5A 4LF5B 3ZKWA 2NV2B 1DAIA 2A9QA 3TQHA 1EBBA 1NZJA 2BM8A 5HUQA 3H1BA 4OMUA 4XYLA 4BO7A 1NC3A 5JAQA 4WP4A 4KU4A 4BB9A 2UUPA 4AP9A 1VLQA 3IIMA 1TF7A 3L41A 1A5BB 1KOLA 1P80A 4DT1A 1HPTA 3ESZA 1XDDA 3Q12A 3STXA 4F2DA 2VQSA 1XL1A 2ZZMA 1EFPA 1CX9B 5TQ2B 2BEKA 4HYQA 3QNWA 3AYZB 4LYYA 1JR2A 1QONA 4FP9A 1FUYB 3PP8A 3LI2A 3EIWA 3WK7A 1S2NA 1BVRA 4G81A 5KJ6A 3JWGA 1TF2A 2PRSA 2Z2ZA 4RJKA 3TM5A 2PPVA 1HDGO 3R6LA 4HD8A 4GKBA 2O2JA 3G02A 2GEFA 2C9ZA 3QVKA 3OOHA 4G5GA 4ZVOA 4YMHA 5JYDA 3DMDA 4RNDB 1RWOA 3RAPR 3ZBUA 1G41A 4RO0A 4DMFA 4NCXA 3EOZA 3UANA 4EKGA 3TOAA 1NPTO 2N0SA 2VTVA 5K3CA 1UJ2A 3O75A 1JG3A 1U0SY 2VR1A 4ATNA 3LWZA 2ZSEA 3F7TA 3JZDA 1J33A 1SWWA 1AUPA 3L8MA 1E8NA 1FYVA 4QJIA 3OZUA 1FJHA 4A92A 1P3DA 1L7MA 2J3QA 2OUKA 4RAOA 4GYYA 3EGDB 4ZODA 4ZYUA 2FQXA 2K7FA 1IY9A 5CFQA 1G8JA 4KBYA 2V7GA 2VTEA 2QUAA 4ZQBA 3MTEA 3EMVA 1PIWA 2VDPB 1RRCA 1ECPA 4BO9A 4JUFA 3PXGA 2Z83A 5HE9A 3ZQ6A 5DI9A 2P62A 2OB1A 1RE1A 3HXLA 2GVIA 4LRUA 4KMRA 3SIWA 3EZFA 1GSAA 5FPPA 4CHTA 4N5IX 3VAAA 3BE4A 1OWOA 1C9KA 1DXYA 3GPIA 3MEKA 3TAHA 1XDSA 4TKUB 2CV2A 1E59A 2WMDA 4KN6A 3RSHA 3TR6A 4CIBA 4U7PB 4WCFB 5BV7A 3QEMA 5JAOA 4B7CA 1YVRA 2AOUA 3ND7A 1YNOA 4B8WA 5E8RA 3ER9A 4EHLA 1OCEA 4DLLA 3FUCA 3MS7A 2ST1A 5LKRA 4HLQB 4LHEA 4JI5B 1VHDA 4AJPA 4TQ9A 4WZZA 1RI4A 3KR2A 5TGTA 5AIAA 2E1RA 1MJHA 4NEQA 1JIQA 5AJTA 3GLUA 2HHLA 2YXDA 5DHSA 4NZPA 4IKEA 3PQ3A 2W90A 4NQZA 5LQSA 1QGUB 2BDEA 3R8CA 1BFDA 1R7RA 2IP1A 3DBVO 2BH2A 2EG5A 3B20A 2KMPA 4E5NA 3Q3EA 3Q85A 4C2BA 1EDBA 5F7JA 1I32A 1ZHHA 1U1DA 2PBFA 3EGXB 2GD0A 3KXIA 4RANA 1W5SA 1XTRA 4BLRA 3VYUB 4OKIA 5EMMA 4BQEA 1P4GA 2EZ8A 4UBIA 5I6DA 3DE6X 2PZMA 3DE7X 5CCMA 4I9NA 4BX8A 4FUQA 3IPAA 3K0SA 5AJWA 4CV3A 2CSXA 1VRVA 1CY1A 2VFAA 3DXFA 3GJ0A 4JOBA 4OKSA 3F8SA 3WLFA 1Z2NX 1AC5A 2VHZA 4D9EA 2HKIA 1Z12A 2OR3A 4HWKA 5GJWC 1PJ8A 3FMFA 1WKCA 4X3CA 5H59A 3IBYA 2M6LA 4B6SA 1GILA 3PQ6A 2BD0A 4OMFG 1T9BA 4JHXA 1D5WA 1OGYA 2YJTD 2XT6A 5BYBA 3IUEA 1UJ5A 2P30A 3OZDA 3PQDA 4FFNA 2I78A 3SE0A 4EGAA 4P7JA 3DR5A 3QVXA 1E9EA 1PNRA 2OOSA 1NVUQ 1V4NA 2C92A 1XLWA 3BB3A 3E2IA 3CH5A 3IMKA 3G68A 4Z9XA 4OA8A 2LPMA 1HNZB 5J2TF 4IIUA 5CM2Z 1DRWA 1ZNWA 3A4LA 1ABEA 5AOBA 4G37A 4CM3A 1QHNA 4K0KB 1BG6A 2VZ9A 3AR3A 4WY8A 4EAAA 1W88A 4YIKA 3TSZA 3K4QA 1GZ6A 2GKOA 2V7QA 4LDRA 1RYHA 4YWHA 3HFSA 2CWHA 3HQ4O 3H2KA 4B75A 1PUXA 1KH3A 2XADA 1JFRA 3FCSB 4JVNA 3AFIA 1E98A 1OYYA 3DT8A 3HUFA 1U28C 1HYEA 2ZRPA 4Q3BA 3IT1A 1UANA 4W5QA 1G6Q1 2CMKA 5LVAA 1ZRNA 1X7GA 1V39A 4QO7A 4E6EA 4EPYA 1SHTX 4YQZA 4MNTA 3KOUA 3DEJA 4KAFA 4NXNB 1K7YA 2Z6VA 4HFMA 2Z8YA 3PGKA 3GQBA 1AUQA 2YMLA 1WMAA 2YVKA 1F8XA 5C2JB 1CS4C 1W7AA 4UUAA 1W59A 3BXFA 1FNDA 1SUCA 4MUAA 3P27A 4NP6A 3VOBA 5F2NA 1H5NA 3RHZA 4B3SB 2R2GA 4MO2A 3V33A 1GD1O 3B8EA 2BBSA 2FDCA 2B82A 1Y4ZA 3ZOZA 2DQZA 3EDCA 5EP2A 1MX1A 1J00A 1HJAI 3QP9A 4DMGA 1DRJA 3SFZA 3K0AB 1E1DA 1V7CA 1DV2A 1YQUA 2AJLI 2RDMA 1NASA 1BOFA 1Y6QA 2RHOA 1C0PA 5TJ9A 821PA 5AW4A 1C7JA 1V11B 1XTBA 2DLNA 3FOWA 1F9AA 4KDCA 4OEHA 5DM2A 2BRUC 1R64A 3KHTA 3AEXA 3M0EA 4TVKA 3X1YA 1I14A 1SVKA 4RD4A 4H0CA 3ML1A 1Z25A 2QN7A 3NT2A 3UMSA 1G5FA 1YDHA 1KY5A 4L50A 4MSUA 1JEEA 4HH1A 2PBLA 1WDKA 2R8XA 3D8BA 1VYUA 1UPXA 4AN0A 1OLUA 5CT6A 3AFMA 3FFBA 3WGZA 4B09A 3UTDA 5KUTA 3FCEA 1EHIA 1A9OA 3VYVA 4NK5A 1P2BA 3BYZA 1Z6QA 2F43B 2KBEA 5E3IA 4NV0A 1PD0A 3VSDA 2GKTI 4IQ4A 1D8AA 4RA6A 3CVUA 1GRVA 2P9BA 3NHLA 5K3BA 1L8OA 221PA 4M1WA 1U0TA 4M98A 2AN1A 2XIJA 4RY2A 1M2WA 2IF0A 2FMHA 3R3JA 4WXYB 3S28A 1OA1A 4ZI2A 5B5SA 4L5BA 5ICCA 3HH2C 5JCJD 1WF3A 3CXLA 1ZD1A 1DDIA 4GI1A 3OWXA 3KLBA 1EJ2A 4NCAA 4LRTB 4LYGA 2OM6A 3SF8A 5AI4A 3X2EA 4DL9A 1K8QA 2H2AA 3H5AA 2PQ6A 2CUNA 2E6UX 4U00A 3IIKA 1IJKA 1JAHA 3LZDA 3O7MA 4K05A 3UFXA 4PZ0A 4TTJA 5FUYA 3NALA 4BIMA 4MWOA 3LECA 2XZDA 1LH0A 3H6HA 1DAMA 3VYRB 1W1WA 1PJ2A 1ZWLA 3X1ZA 5EKTA 3L0CA 2GPYA 4JJ6A 3AHGA 3KPJA 3K72B 5TEVA 3SC6A 4LN1A 1P7WA 3W9BA 2CFCA 1O94D 1MD9A 1LBEA 1YZHA 4OLJA 3QUAA 3A4NA 4DM4A 1LWNA 3CY6A 2ZETA 2O1XA 3CRVA 4QO8A 4XSVA 1XD2B 3BB1A 4DDTA 3PITA 3LNTA 2ECFA 3N8KA 1M2OA 3KJGA 5JJLA 4WSOA 2OZVA 1ZRMA 4JYCA 3SI7A 5M3BA 2RGYA 2C7QA 4OSEA 2D2VA 4HNGA 2ZT5A 3PFIA 1EVYA 3SJUA 2PMDA 1S3FA 2J5QA 2Y3IA 2ADMA 2HK9A 3TNDA 4JIMA 4TSFA 1VHWA 4FK8A 5DW0A 4EGCB 1JHDA 2JGAA 3BN3A 1L5YA 3IR7A 3PGJA 4ZWNA 3E8XA 3QFHA 3WLSA 4QWMA 3ITDA 3KFVA 4Z9YA 1DAFA 1P7YA 1N9GB 1QO7A 1ULZA 1Z88A 2ATCA 1OV4A 2HSGA 4EF6A 1X74A 1QIIA 3NHAA 3T8YA 5EYPA 1TO2E 4MAMA 2QLLA 1CDOA 1NHGA 1OFHA 2CY0A 3GFSA 3GLKA 5IXJA 1S5PA 1IZZA 4L75A 1DTWB 2Y8EA 2H4WA 3WL3A 2E48A 1AT1A 4RGVA 4R40A 3SQLA 1YB1A 3AI1A 1PHPA 1CY0A 3A2KA 3SSNA 1UBEA 4PYRA 4YJGB 4C4PA 3K20A 3WWDA 3AH8A 1P3JA 4YRIA 3GH3A 1ESDA 2Z58A 3BDIA 4KLRA 2J0UA 4E6PA 2F3QA 1TJ3A 4NFHA 3CF2A 3F97A 2WU4A 1GHTA 1UM9A 2AIRA 4YJ3F 5JZBA 5KNCD 1EP9A 2OORA 2W8ZA 4U3JB 5LIRA 1QQAA 2FWNA 3HUTA 4CMEC 1JILA 5KYYA 2IYUA 4BNTA 3BIOA 1HSOA 2VRBA 3EDMA 2PMBA 2C5LA 1W36D 4UHKA 2OAEA 4J2OA 1MIOB 1PZGA 3WYEA 1XLVA 3OLZA 4RY8A 5F76A 1GPH1 2CMGA 5ALEA 2V0GA 2Y9MB 3R7WB 1RLTA 2OZPA 3PDIB 4FMCB 2OCYC 2Q2VA 5FFFA 4IHJF 3RARA 3H9GA 4A8HA 5HF9A 3MWKA 4IIVA 4OREX 2J4DA 3T54A 4Y7DA 4TRMA 4H27A 4QQFA 1RM4A 3GRZA 4PLTA 4RHXA 4CQMB 6NULA 2IP2A 2JB9A 1U1IA 1UC4B 4MUFA 4KFTA 1VKRA 4I81A 4RF4A 3UT5B 4ZYYA 5D5QA 1NQWA 2WYWA 3B1VA 3DR3A 4XIJA 2IYYA 3ZWXA 2WB4A 3WHPA 3H3JA 4BNDB 4QGFA 2AN9A 2D8AA 4OU5A 3VZDA 1RXEA 4ZXPA 4EARA 3LX5A 2FYTA 2R1UA 3ELWA 1U0HC 3D4OA 3EQ2A 3R3WA 4XDHA 4F56A 3G6KA 1R3DA 4NR0A 1E9DA 3BH0A 3EQZA 2IBTA 1U98A 5CH5A 4CKWA 1GZ3A 4GM1A 4QLBA 3U7HB 2WDZA 3G0DA 1B0AA 1ODFA 2ATVA 2JRCA 4M9UA 4UM5A 5EIFA 4ZT2A 5G0VA 4DZTA 5I8WA 2I67A 4UUQA 4ZCMA 4ZCPA 2JAOA 3F73A 3PXCX 3SLRA 4PPFA 4FQ7A 2HMYB 2WIGA 2FR8C 2XWQA 4FLEA 2GEDA 4KITB 1PD1A 4US0R 2NACA 3WLJA 1LB1B 4XUGB 2H4YA 1H4VB 1ONSA 4E1PA 2OBLA 3CU5A 4I4TA 3UK7A 1PVDA 1UADA 3LNCA 4JGGA 4KQ9A 2C4VA 3TO5A 2GSWA 3I37X 2YHBA 4RMJA 3K16A 5GGXA 2BI7A 4ENWA 1GKUB 1UIRA 3OM0A 4ITUA 3RVNA 4LDZA 4EO4A 1NMSA 2C42A 1RLIA 2DB6A 2Y76A 3BPSA 3NPMA 3NEYA 5A6SB 1FFHA 4LC1A 1K0UA 2W2QA 4PLHA 3I6QA 4WXMA 4D79A 3JASB 1ZICA 3T7SA 1NIJA 4FOOA 3ZV4A 3VO2A 1TC2A 4BFXA 3FGNA 1PZXA 3GLIB 5ALNA 1LD3A 2YBDA 4E4YA 1E2KA 4QDXA 1YJQA 2YOHA 2RONA 4MLCA 4WJKB 1RHRA 2GZAA 1NT4A 3ZGLA 1NUTA 3I0ZA 3IT2A 4R9VA 3PGMA 4NH0A 1CR2A 3RV4A 4BDTA 3N53A 3LBHA 4TLCA 2DHCA 4QM7A 4HGNA 3LT5A 3OZAA 1YVUA 2GTHA 4UFOA 4QYIB 3QEAZ 1Z4JA 4UVHA 2O8VA 1E62A 1JTVA 2VSXA 1W34A 3VR1A 2WNIA 2C20A 4IR7A 1UWLA 4P22A 3AUSA 2DFLA 3JPYA 5C1IA 4DLNA 2ZE5A 3O26A 4K87A 4I1PA 2DLDA 1YBVA 3ETJA 3N5KA 4Q1DA 2VOEA 4F2WA 2QVBA 3OHPA 2QA5A 3GRRA 1P77A 1NNSA 1W0JD 1EDDA 3OXLA 2RIJA 5JD4A 2ONZA 5T3YA 1IBMB 5G0UA 1SQ5A 2QNRA 1P4JA 4Z7OB 7MDHA 2ARPF 5ALLA 4YCCA 2AC4A 4D80A 2CXRA 1SCUB 3GBVA 3JVEA 5EWLA 3P2IA 2C3MA 4LZLA 5BW8A 3MRTA 3ONDA 1VJ1A 3OQNA 2Q1SA 1W19A 2YV4A 3B3JA 2GI4A 2GIVA 1F9EA 2IEAA 3K53A 5LYYA 3ZHBA 4CN8A 3KYDA 5JY1A 3G85A 3OM9A 1U7WA 3FRHA 4CFZA 1AF4A 1TJ5A 3NVDA 5L53A 2VSNA 2CBXA 2OHIA 2OXRA 3HWRA 4FFRA 3H9EO 4Q34A 3O4IA 2JHAA 3TZHA 3O74A 4WOBA 1TYBE 3D1VA 3V4ZA 2GKGA 1C7QA 3GGOA 3RH0A 2C3OA 4F21A 2NZ8A 2C5SA 4HFJA 2OHGA 2QN9A 5H68A 1SGQI 5BUCA 5KYXA 1FX1A 3DT9A 3MELA 2I7VA 4NL4H 1T2DA 4L76A 2W83A 5JC1A 1CUXA 3D81A 4CNBA 3IOEA 4DWOA 2PL3A 4GQAA 4AXBA 4CI0B 1VPDA 2LRHA 2HWUA 3ENVA 5LA6F 4JBYA 3QPWA 5I9BA 2ADOA 2LKDA 4GZMA 1ZITA 2HDWA 2G07A 1F14A 2EGGA 3GZTB 4FIDA 4UBLA 4GO1A 2A2ZA 1U9IA 3Q2OA 1MV5A 3TH5A 4B5LA 1F60A 4RSMA 2JW6A 3GLHB 3OQJA 2W6QA 2Q3JA 3RRMA 4BQOA 1P9RA 3GJXC 4FLMA 3V48A 4DRXA 2UVPB 4NJMA 4QSMA 4UUBA 4Y0NA 4BCCA 4BVJA 4Z4EA 2X0IA 3KVRA 1T0BA 3ZDCA 1F12A 2ZTHA 4U2KA 1RVDA 2AKAB 4XWYA 5EMKA 5H16A 3FMPB 4CM8B 1ZDMA 2GPSA 4X1OA 4BNNA 1TU3A 2CXQA 3MXTA 3UUGA 4PS1A 5JSZA 3PFFA 4MYUA 4RY9A 3OFSA 2WPDD 1NQUA 1A0OA 3TXXA 1RKQA 4B44A 2FKNA 1DJNA 3GZNB 3SR4A 3HP1A 3MRSA 1PDWA 1AKMA 3Q3GE 3QTLA 4B0PA 4KG7A 2GUGA 1G8AA 4C21A 4IVQA 1DAOA 2MR5A 1O03A 2GXUA 1E66A 3LPCA 3D5QA 3O21A 2Y1GA 3R2JA 5ESXA 4D4HA 1DBPA 2PUDA 1BXKA 1ADGA 4AJLA 1XZGA 4ADSG 1P6XA 3AOEA 3GEIA 4HPXB 4OBXA 4S04A 1GTVA 4FDMA 1L5HB 1N3YA 3RQIA 2GEBA 5FOSA 1HI9A 5K0FA 1JG6A 2H1RA 3KYBA 5DBGA 3MILA 4G07A 2GHQA 3EASA 3KBBA 4H1UA 4M7PA 1W0KA 4GR4A 2QRGA 4HNAB 5LP6A 4ERNA 2G9RA 5B7QA 1DCFA 3M6AA 4WUTA 3H4IA 1VM6A 1BMFD 5L8VA 1CB7A 1PAUA 3RVBA 1TCUA 3SY8A 1Q7TA 3MNFA 1II9A 2NADA 3HKBA 4C0BA 1GCUA 1GAXA 3LT1A 1H9AA 2J1LA 3LOQA 5HJ2A 5A3JA 1WXIA 5D3MA 5E6SA 3GJQA 3QU2A 4DMHA 1SUAA 3K0EA 4EP1A 2FQYA 4DYVA 1DG9A 4UQOA 5DIFA 3F9CA 1R37A 2BMVA 3BERA 2Y1DA 3UQYS 4G86A 2OGTA 3L93A 3L8HA 1YI8A 4R9RA 2VTDA 1VIYA 4PPGA 4PSKA 1X1TA 1BVHA 2BMJA 4RKEA 3MLBA 3PF9A 4LXQA 1VIMA 2YJ4A 3X1XA 2VT3A 2VDNB 4F85A 2F67A 1QVAA 3OJOA 4F3RA 3GJ3A 2PO7A 1ZJJA 2EFDB 1K08A 1H2XA 1ZSYA 2PKCA 3CNHA 3ISTA 3NWPA 3O0TA 3PHGA 4INOA 4TV9B 3CA8A 4NENA 2I4NA 1A7UA 3PCXA 4U5QA 5CFNA 5KJ1A 1TQ2A 2MYUA 4JJ8A 3AU8A 4YHBA 1YR7A 3CN9A 5TPWA 3T1VA 4YUYA 3DLBA 4HYTA 1T34A 3M4YA 1JIIA 4XOIA 1QCDA 2M9MA 2V6FA 4GPIB 1T4DA 3V1UA 4E94A 5IT0A 1TU4A 3AJRA 4JWTA 4YQYA 1E8DA 5KOHB 2ZYAA 3WSVA 2A1UA 5A06A 2IYQA 1NYLA 2WYVA 4UD6A 5IBQA 3SC3A 5HJEA 2FEWB 3FPKA 3HDQA 5AWFC 1L2TA 3K70B 2NXEA 2C54A 4JR1A 2YY7A 5CG2A 3ABIA 3AERB 2DM6A 1A27A 2HIAA 2QIPA 4MP6A 2P2NA 3T52A 1DC6A 3LYHA 3MMPA 4HYEA 3E3OA 3QIAA 4C0JA 5JNWA 3DMTA 4DB2A 3AZQA 4M6WA 3TEJA 4C7OA 4HUTA 1UFOA 5GVSA 1Y7TA 3T9DA 2XIQA 2XRZA 1IJFA 5BSGA 2PU5A 1GLVA 4KAXA 5BR4A 5K8VA 3TPZA 4EJMA 5JVDA 1T3LA 2FPWA 2VCHA 4F11A 5IAOA 1CUGA 1UKZA 4U6SA 1YK1A 1FYWA 1NFQA 3IO3A 5I8ZA 2XTAA 2X9GA 4LCBA 2A5YB 3O8OA 1Q1QA 2YNMD 1QYVA 2RE8A 1P31A 1A8UA 3GOHA 4RQBA 3RM3A 4RTMA 3H9CA 4DVGA 1G6OA 2JAWA 4L8LA 4AJ9A 3W8DA 4C03A 1XCPA 3UM9A 4O33A 5CA0B 3C8HA 1EJ0A 2WW8A 4IG4A 3DZIA 1VGQA 1PQYA 3ZTWA 3QHQA 4EY3A 4HQKA 4L02A 1CGJI 3KSZO 3HTXA 4Z9AA 4GWLA 3A1VA 5U1PA 3LRTA 2ZJZA 3C2QA 3M6VA 1F8GA 1ZIOA 2HMSA 4DLBA 4I14A 1V2HE 2ROWA 4XDYA 5DT2A 3W8FA 4D3YA 2QSJA 2V7BA 4H35A 3W90A 2Q6IA 3DPSA 4TT8A 1K68A 1P4HA 1WD5A 2AFHE 3I45A 3PNLA 5DW3A 4GLOA 2P75A 1SJ9A 3FKSD 4NEGA 3VVLA 4KPUA 4C22A 3B6IA 1RFHA 2ROQA 4LGCA 1B41A 5TXGA 5C81A 1GXSB 1CR4A 2YWGA 4IYRA 4X6UA 4QYWA 1Z6YA 1ZU5A 3ESYA 3SHOA 4EUHA 5AW3A 5EIXA 4HRAA 2YUUA 3N74A 1GFIA 3LPMA 3LXMA 4B7AA 1R10A 2NU4I 3G8DA 3L6DA 3DLCA 4M99A 3VR0A 5HJ5A 1SMKA 4S1TA 1D4OA 2QW0X 3GFRA 1R0ZA 3LW8A 3QHPA 4MWEA 3T5AA 1SC1A 3NP7A 2VHQA 3LJKA 3CPJB 2XECA 4KO4S 3CXRA 4HWGA 3D8RA 1BW9A 4JB0A 4X1KA 1Q2UA 1XKTA 3FH0A 3NC1C 1DAEA 2XA9A 3QE3A 5D5PA 3BCUA 1FTQA 3SKXA 2GPWA 1Z35A 4MZDA 5I7UA 2UZ4A 1YJ5A 2O3UA 4KXNA 3UHJA 1DEOA 1AN0A 5JQGB 3IEMA 2A1TR 1KJIA 2LZ0A 4LSMA 2HIMA 5J47A 1F4LA 3PJEA 4CF4A 2N42A 1R9GA 1FQKA 2O48X 3G7NA 5BQ5A 3SSMA 4JI0B 3X1MA 4DREA 4DY6A 5J5AA 5AVTA 4UBNA 3IKMB 3KBOA 5F98A 1PR3A 4MIOA 1WZUA 3IDZA 4HMPA 1YBHA 3OCWA 4Q4JB 4INZA 2Y0PA 1ATZA 4AIRA 1JWBB 1T5BA 1VC2A 1X13A 2A5GA 1H5UA 3UAYA 4YV1A 1DKQA 4UVIA 1UK8A 2DGDA 2WQ6A 4XPIB 1QTNA 5B2FA 1L1FA 4JODA 4BXOA 3F96A 4K9SA 2Q9CA 1IFXA 3CX8A 2UZ1B 4FFWA 3QYJA 4O4HB 2MSEB 5AK0A 1A88A 1VMEA 3M9LA 1VDMA 4J0QA 3WB9A 1U4SA 4N0QA 1WY7A 3DDUA 5CNJA 2Q5LA 4BMZA 3QU7A 2DR3A 1CRQA 5CX4A 2VH5R 6Q21A 4FWIB 1V6AA 421PA 1YWGO 1DNPA 4QSHA 2G67A 4XYMA 1QRTA 1QVVA 2GZDA 2VEDA 4LUCA 4QTUB 3OM8A 4U7WA 4AJ4A 4UREA 1BHQ1 1Z2PX 3Q6MA 2ZB8A 1T43A 1XJCA 3B9BA 2WYIA 2XUOA 4U63A 3MUEA 1JFFB 1ICEA 2AYZA 3COPA 3LHKA 2P4HX 4JJFA 1ODTC 2L0XA 4L22A 3K0FB 1Q1EA 1IZYA 1Q3TA 1Y34E 1XJ0A 3FDZB 3CPHA 4F4FA 2L18A 2NTVA 1T5DX 2R1VA 4D44A 1THTA 2GLUA 2C9MA 2WFLB 1LQTA 3C5HA 3DM9B 3LT2A 4O5AA 4OOFA 2AD1A 3BXEA 4D96A 4DA8A 4JNKA 3DA8A 1PBNA 1PN3A 4XRRA 2VH2A 4FBMA 2FFHA 1GKKA 5JNRA 2XCOA 1WDMA 1RXUA 5LBIA 1PPFI 1YQXA 5T4FA 3ROXA 3SCZA 3UQZA 1Q21A 4CQJA 1EK1A 3DGEC 4HZUA 4BVBA 5E1DA 1XQVA 4C4XA 3N07A 3VDXA 4QREA 3V4RA 3WMFA 1J2EA 4BHTA 4BGDA 4ZO9A 3A2LA 4QGHA 2ETXA 2WILA 5AIBA 4JBNA 4TL6A 5HKKD 3H1GA 2HDHA 1OMUA 1M2FA 2ABWA 2QR2A 4IJKA 4BNZA 2ZB2A 3NDPA 3SVLA 1JYEA 1ZS9A 3DMRA 5JISA 2ERCA 3QE0A 3FOZA 4LV8B 4MQEA 4QYSA 2VT7A 3CRRA 5ALHA 2XBMA 3AR2A 4HCJA 5CTAA 1X7WA 5D3ZA 1GTJ1 1AN9A 4KN8A 1E63A 1NXSA 1YR2A 2VLIA 3NBZC 4JB2A 4LIPD 3TZLA 1PF7E 4WFIA 1GUYA 2TECE 3M1IA 5CDGA 5J2TA 1Q6ZA 1P91A 2RI6A 1Z7KB 2JJQA 4L08A 4RVDA 3ONFA 3LBIA 4DKXA 3AESB 5FNVF 3RCBA 3UKDA 3KKMA 2XMRA 3H1EA 3LM8A 4RUKA 4DLRA 1COZA 2NUAB 4PX3A 3ILXA 3FPEA 1YR1A 3RVOA 4Q1AA 4L07A 2VJBA 4IINA 2BFBB 4TQGA 3CPEA 2Q4EA 3B5EA 3NX4A 3GUYA 1RC1A 3S55A 3LBNA 3SVTA 1OH8A 1EK0A 1MZPA 3GLFB 3TNFA 1ZI6A 3RSZA 2FN4A 4J3NA 3RC8A 5TX7A 3GNLA 3T0IA 1MABA 2GYUA 2J3MA 3PF8A 3PFKA 4GPD1 4UATA 1K8YB 4CM6A 4IXNA 4YIHA 4LXXA 2QM3A 1J8MF 2W6NA 1IPEA 1NJ5A 4IMPA 5IAAA 1VP9A 2LCIA 1O4VA 1T6ZA 4ZV9A 3BWMA 3IE2A 2BZ0A 4WEQA 4CMGA 3S2FA 1LZLA 1GL6A 1I1OA 5ARDA 2FOIA 2YVLA 3TIVA 4C01A 1J0XO 3FW1A 1KH1A 4ENSA 4ZVNA 2FMTA 1GG2A 1MXHA 1D04A 2R6DA 2NU7A 3GXOA 3LX4A 5C46F 1BE8A 1TJPB 1EWTA 4K9DA 5DHAA 4ZK2A 4WESB 1RHQA 4MEAA 4OPMA 4DSNA 3WGJA 1VLJA 4A7PA 3CWQA 4D99A 2IEYA 5F33A 5EXDA 5FJIA 2HLDD 3DO8A 1MIHA 3TB4A 1UQTA 1TEZA 1Q0SA 4MQ6A 3AV0B 4Y2YA 4B31A 1OWMA 3VR6D 2G1PA 1F4VA 3HBJA 2R4QA 4GBED 1QM5A 1G63A 3EQ9A 1G42A 1YZ3A 3D5TA 4C9BA 4JELA 2GO1A 3LCVB 3OLWA 3JAKA 1HMPA 4PO3X 1L7BA 1QH1B 2XV1A 3UVEA 1R6TA 4N76A 2ZUCA 1XR3A 3ZKAA 3FGPA 4DCNA 2CNBA 4DR1B 3EXG2 3K0CA 1GA1A 1U7OA 5LZ8A 3NUQA 3V1MA 1K92A 2LKCA 1TVEA 1XDBA 3EA4A 2CMFA 3JQAA 1VKZA 2ZRKA 4C6TA 3KQWA 5AJHA 2GBLA 1JI3A 3WWOA 3P9NA 2XZLA 1MQAA 2YY5A 3GFBA 2HXSA 3OZGA 4JP1A 2CLSA 1I6KA 1B2LA 2J3JA 3DZDA 1VDZA 2MSLA 3E0XA 1JV2B 4ABTA 1WO8A 2OFWA 3ZHCA 4IILA 4AQ7A 1GARA 2P11A 1ULUA 3D6AA 3SN6A 1UVFA 3UUFA 3W5DA 1ESNA 1H8ED 2IUFA 5ED4A 4U8GA 5A4JA 3FBGA 2R7MA 2AG6A 4GP7A 4QE3A 3WOVA 4DIMA 3NU1A 4TMZA 4DSAA 5CCLA 1U7UA 2F62A 3NKFA 1VA5A 1JVBA 1KDTA 2CLHB 3MVEA 2DBRA 4PFKA 3ZI4A 2ZBRA 3BX1A 2CHEA 2HA3A 1X1QA 3E23A 3L0PA 3UGKA 1UBKS 2B0CA 5D86A 3ST7A 2W6PA 5CVDA 1MO6A 1Y7HA 4F3KA 2L42A 1M83A 1P0CA 3RVSA 3CQ9A 3BFXA 4LY0A 2GK7A 5T64A 2LD4A 2WNSA 3C4JA 3LBFA 3F5MA 3Q7QA 4FKZA 2W70A 3UW1A 4LA4A 3JATA 2ODNA 3ZHSA 4AQYB 2FFQA 2JLAA 1DAHA 2VJCA 3CZRA 1YTUA 1MVLA 3HA7A 1XLTA 2C0CA 2K6GA 2O2XA 3L18A 4RZIA 5CURA 5D1HA 5KYVA 4DILA 1V5EA 1R6DA 1UXIA 3FTNA 4E14A 1Y6RA 4IIXA 1BKSB 3PHHA 4GVXA 5E6UB 3T06B 3KWMA 1Z29A 1GA4A 3DP9A 4CM9D 1OSNA 1HEYA 3JR3A 2UYYA 3O7WA 1DELA 4KKVA 3QVTA 4L5JA 4PZAA 4KRXA 4D45A 5M04A 1YZYA 1RMQA 3GRFA 4IG9A 4W9NC 4XCQA 4EMBA 5BYJA 3HKCA 1KR2A 4J4BA 3HLKA 3KLPX 1QIGA 1B3BA 1SO8A 4INAA 1ISMA 2GJSA 4E5YA 4R1PA 1E0AA 3MJTA 2OL4A 4HDOB 3W2TA 2C7RA 4DLAA 1M1YB 3INRA 1ONPA 2FJ0A 2FHPA 1JAYA 1YRYE 3KT3A 3ZTTA 1A9ZA 1MJBA 2BP7A 3ADBA 3WLPA 4AZ3A 4GGPA 4Y3UA 4UVDA 1R5NA 5LQCA 4RM2A 2HWYA 4A03A 1D5CA 1KE1A 3JTEA 4LJSA 4PHTA 4LK2A 3QW4B 4J7CA 1ZPDA 4F2GA 2V7TA 2AQ8A 3JCZA 4P84A 5DMHA 4HAXA 1Y5NA 3GHYA 3FM9A 2M6KA 1A4XA 3W34A 5KYUB 1XB2A 4KO8A 4YO7A 3R7BA 1ETUA 2GPNA 5B30A 4US2R 2NQTA 1SOAA 4YP0A 4YJ3A 4PCAA 1DIHA 3WC4A 3C15C 3GJSA 3F5FA 2D2FA 1OTXA 2Y0BA 1JKJA 1QZXA 1UUFA 1ICIA 1XF1A 1S8AA 3HU3A 1OFGA 3V2UA 4DHEA 2F1OA 2IV7A 3N0XA 4KRGA 4KWEA 4ME6A 4Y9UA 2AI3A 3HBFA 2I7TA 5IC5A 3ZVRA 1GNSA 5K1ZA 3UPUA 3L7DA 2DB3A 1ZH6A 4KLCA 3BSFA 4K9LA 4GX5A 5CLGA 5F3RA 2H2WA 3V8NA 1AXGA 2RG1A 4YX9A 1Y5IA 3W2EA 1LW6E 4RU1A 1OXUA 3O82A 3A9TA 3EZGA 4IHJA 4RBNA 4DG9A 3QEOA 1EX1A 1ZD8A 3KQTA 3QJGA 1CZLA 4KXQA 4JI3B 2X9QA 1DVRA 3L49A 2VQDA 5IJ9A 4S24A 1OYVA 3EB9A 3L82B 1USUA 1MC1A 1GFZA 3P97A 4GNKA 1M76A 4LDNA 3F6YA 4PSAA 3RK1A 1KSFX 4EFDA 2O8DB 4NBNA 5JDIC 2PGNA 3OQ6A 2QS9A 4G8CA 1Y1KE 4J0JA 5IC4A 3QENA 4C7BA 3OCZA 2UXCB 4KGVA 5K0TA 3FBWA 2A88A 3GXBA 4OY3A 4XAQA 3GCZA 2ZJ7A 3NHMA 3WZMA 5BORA 3BOSA 3I2YX 4L8WB 3WIVA 3SWWA 1BJKA 4QNMA 4WW0A 5B1YA 4L28A 3I9OA 4D9MA 3T0FA 3B6ZA 2Z08A 2QR5A 4Z53A 3QEJA 4AYXA 1VSQA 1V45E 4DIUA 2FGKA 2W71A 2RH8A 1X15A 3UAWA 4E46A 1I1HA 3VO1A 5IT5A 1YK0A 1J39A 2NZJA 5IYZA 3A6LA 1E58A 4LFBB 1V25A 3N5CA 2C2YA 1BUSA 2BGUA 4QJ3A 4ZICA 4RK4A 3AKEA 4HLCA 3VC1A 5HOQA 2B1IA 1FFAA 1BD4A 4QLOA 4RJIA 2M32A 1G8FA 4GC9A 4UEWA 3VKFA 2JIBA 1KI8A 3LO5A 2RBKA 3OT4A 4N54A 1X1RA 3DAHA 4NOJA 3TX2A 3OZCA 3U62A 4BU1A 1NUHA 3LF1A 1YIOA 3WQHA 4A6DA 3OT1B 4DMRA 4QDOA 2VJPA 4FFMA 2ZBGA 3FLEA 4YRDA 3KM0A 4ZMSA 1MR3F 4YRMA 3E9DA 2R86A 4PU0A 5EJ7A 3U81A 4Z4HA 2FRXA 1U81A 1C9EA 3FLMA 3I2GA 2UAGA 5A5FA 5H5JA 2VBIA 3IKVA 1JEYA 1R9NA 1TA0A 1E2HA 2JASA 2Q1XA 2ZAIA 5C1BA 2I4IA 1X77A 1DAGA 1FFXB 2BMEA 4J6EA 3RIYA 4MRMB 1IXRC 4NU5A 4TROA 1ACJA 3RWOA 3T9BA 3WDLA 1NJ6A 3SE7A 1Z2OX 3ZR4B 3OJ0A 5EFOA 3NT5A 1J0AA 2P9FA 1BX0A 3TD9A 2C7VA 3EXFB 3L02A 4BVAA 3E2MA 1N5KA 2RJNA 4YJFA 2PIDA 4FEEA 2Z3VA 3KLNA 3S29A 3GT0A 1V0JA 1KZYC 1M1ZA 2G40A 4AZVA 3K4PA 3MMSA 1CZOA 4ZOCA 4X20B 2I9KA 1RWWA 1H3EA 2IUSA 1KYYA 5FA6A 4ND8B 1CUHA 2ECPA 3GPBA 3LFTA 5G1PA 1DAKA 3IJRA 4MW2A 3HXMA 1U5KA 4KSYA 3TGWA 2L82A 3H8SA 5IDWA 2PWZA 3LMKA 4FQ8A 4K6GA 3UWMA 1Z13A 1ZWKA 3L4EA 2X8JA 3ZJTA 4RMGA 1ZESA 1SUBA 3STHA 1FTGA 2MHCA