5FUXA

Catalytic domain of thymidine kinase from trypanosoma brucei with dtmp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
182
structure length
168
Chain Sequence
AHGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTGDTLTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
molecule keywords THYMDINE KINASE
total genus 55
structure length 168
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuxA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuxA01
2GTPA 4US2R 3QEOA 3EPHA 4XTRA 1KSGA 2J45A 5GADl 2A3RA 2NG1A 3KB2A 2QU8A 4EJSC 1GG2A 4LBYA 4LC1A 1ZM7A 1NLZA 4CT5A 5BYKA 4L16A 1TQ6A 1GL7A 4MKHA 2JLYA 2R2AA 2VTKA 3A4MA 1J2JA 4ZIRB 5IRCD 2VP4A 4IJMA 4DB4A 3AVXA 2QMHA 1NJFA 3PUYA 1OKKD 4RZXA 2RGNC 1W36D 4LDJA 5M04A 3C14C 4WXRA 3U3MA 1NMYA 3ND9A 2EYUA 1ZNXA 2ZSDA 4LWZA 4PO9A 1QHIA 1GL6A 2QP4A 1UJ2A 3KKPA 3VQTA 1OH5A 1OH6A 2ZJ5A 1KI9A 4HB0A 1P6XA 2HT6A 4LHWA 5CLLA 5JWOA 4EQ6B 2PX0A 4ERNA 1OFTA 5C2JB 4U5XA 1L4UA 2J7KA 2WWXA 1KBFA 3CR8A 1E6CA 1S4QA 2KBFA 3X2SA 4PPQA 1V5WA 2PZGA 5E7MA 3MRSA 5DYIA 1OHHD 4Y0VA 1KY3A 3KQKA 4W5JA 1TF5A 1CR0A 4A0HA 4PZZA 5L3VA 1WF3A 5FTKA 3IPXA 1NBMA 3QIAA 2ZAMA 2FPKA 1JXMA 3LX5A 2GA8A 3LH5A 1G18A 1R6BX 4HLQB 3SQWA 1P2UA 3IIMA 2WSSD 1QHNA 4B6FA 1Z47A 5P21A 2W2TA 3U7FB 4Q4HA 1S8FA 1KKMA 3G82C 4A92A 4AIIA 3CWZA 2QPOA 4AYTA 2G6BA 2JJ1A 4TMVA 5TDHA 1KNQA 1JR3D 5KO2A 2D4HA 3GEHA 2C99A 1SKYE 4NPHA 3TQFA 2V1UA 1W2HA 2P65A 2ZI5A 4MRRA 2ZR7A 2ZQ5A 4RD0A 2ZUDA 1J7KA 3IHLA 2BCGY 2WV9A 5B64A 5L3SA 2PLRA 4HAYA 3WRYC 3ICEA 3THYB 3I32A 4BFWA 4TMXA 5EQTA 3W9YA 2PH1A 2NQ2C 3T06B 4DCNA 1OSNA 1DELA 3F5FA 4U02A 1IJFA 1R0WA 3DVLA 2SHKA 2QGNA 1G16A 2X19A 2WM9B 3QVVA 3R7WB 2XTZA 3GD7A 3UK6A 1Z0DA 1KIMA 3EPKA 1U9IC 3FB4A 2EWVA 2FFAA 4O2RA 4R71A 2C03A 2J0UB 2ZRAA 1AJEA 4A6PA 1ZD1A 1XD8A 3T5GA 3C8UA 1IAQA 1KJYA 1UKVY 1OE0A 4IDPA 2BHRA 3FWYA 4G0NA 4KJZA 1L7VC 1ZIPA 5KPDA 3UEYA 3QF4B 1VECA 1EWQA 4E07A 4GNKA 4OQNA 1LS6A 4DLXA 3TGPA 3FGNA 1JXOA 1KYIA 1N0UA 4MKGA 3OE7A 1I2DA 2CK3A 1PTRA 1EG7A 1GTVA 3I61A 1WDTA 2DPXA 1X8LA 2ONJA 3MGCA 1G4UR 3CX8A 5IK2A 4A0FA 4AKHA 1II0A 1N5KA 1F48A 4W5HA 1DG3A 2PT5A 2R6DA 2Q3HA 2GJKA 1E9CA 1P61B 4GT1A 3EZ9A 3MMPA 4HB3A 3PUXA 1AS2A 2MSEB 4Q7JB 1Q22A 4TL7A 2H92A 1DBSA 4BZQA 1XTSA 1YZTA 3KXKA 4HYYA 2GXAA 4FCWA 3I1FA 2IXFA 2R8RA 5CDFA 2KJQA 4N3NA 3UGIA 1ANKA 1KMHA 1T8TA 2C8VA 2UKDA 2XJ4A 3UWOA 1CJMA 1NSFA 1JECA 3VU9B 2GZAA 1VDZA 4NHOA 4EIWA 2P5TB 4NDZA 3Q7PA 2IBMA 1UF9A 3AV0B 3Q3JB 4JKYA 4X8MA 2P67A 2R62A 3IO5A 5AK0A 2BEKA 3VKWA 4BFYA 2AWNA 4HDCA 3MJHA 4IFEA 1Z0KA 1C9KA 4RZUA 3BH6A 4QGFA 4QBIA 3T34A 1M6NA 3GLHB 3SHFA 3WYFA 5EXPA 4F38A 3ZQ6A 1R8QA 2P0EA 2GEDA 4A2PA 2LWIA 1XMSA 5FUWA 1WA5A 4TMWA 3G5UA 4DWJA 2B8TA 4NCIA 2OILA 2QNRA 1D2NA 1FPMA 3EAQA 1RFHA 3L8ZA 3UMRA 3I72A 5EXTA 2J0VA 2J87A 3TAUA 2QTFA 3K0CA 1BMFD 2DWQA 5EUMA 2HYIC 1HT2E 4I99A 3L0PA 2OE2A 4C9BA 3LA6A 1N0VC 3C5CA 2IS4A 4KCGA 1P62B 4M9ZA 1CTQA 2ECKA 3OEHD 1XNJA 1WRBA 1Z06A 4FCVA 4LGMA 4PHGA 2QT0A 1JI0A 4YMWA 4LHXA 4BLTA 1GM5A 2DBYA 1R0XA 2J3EA 4B3CA 4PPNA 3UATA 1N5LA 1QG2A 3KKOA 5EP3A 4PAOA 3SBEA 2X8AA 3LVQE 1OB2A 4US0R 1MH1A 1CXZA 1XXHA 1YZKA 2HLDA 1T9HA 1CJUC 4NE2A 1WCV1 2QRNA 2XAUA 4LJ5A 4B35A 2GJ9A 4KO8A 4X8LA 1XZPA 4OI4A 2G9NA 1OIWA 2X1VA 1DO2A 3GMTA 1DAMA 1HE8B 2CBZA 3SE0A 4DZZA 621PA 4BFVA 1U0LA 4J0QA 3SNHA 1DG1G 3BWDD 3L43A 2ODBA 1E9AA 1OFUX 3IPYA 5H68A 3AP2A 4FN5A 3SJZA 1JR6A 2JCSA 3MCAA 1ONBA 4DLZA 2D2FA 1KMHB 4UNQA 3KJGA 4BUJA 2P6NA 4US1R 2IK8A 4B3GA 1JNYA 2XZPA 5J4HA 4KITB 1XMVA 1H8EA 4WZAE 1IQPA 1XX6A 1KO1A 2XXAB 3NDPA 4QJ5A 1S1MA 2IHYA 1AK2A 5GJWC 3NHAA 1YHNA 4A2WA 4Q7MB 1IONA 1PLLA 1VG8A 3HP1A 4G01B 2DR3A 4DLTA 4YMVA 3RC3A 4DVGA 2CHGA 2E9SA 4YMSA 3LQRA 2CLCX 1OKKA 5J40A 4RZ2A 5TV2A 3PQCA 2WOJA 4KV9A 3HWSA 3DZ8A 4PSKA 3EARA 2ZJZA 2GVIA 1KJWA 4Q4AB 2QORA 2TMKA 4TWZA 1XEFA 1EFTA 4EFMA 2J0QA 1FP6A 3DMDA 5JECA 2GILA 3HR8A 1R0YA 3HU2A 4A0RA 2AFIE 2NO0A 3PEVA 3TIFA 4D4LA 2L0XA 2GCOB 3NBZC 4RZ3A 2OCYC 5HE8A 4IHQA 3UKDA 2A2ZA 2ZM5A 1JEDA 3AUXA 3CRQA 4ESHA 3O8DA 2O8CB 5KSPA 2W83A 3LQQA 4M9QA 2XOKA 2CLSA 1KDRA 4LCBA 3VX3A 5SZJA 4A4DA 1UBCA 4GBMA 4RFSB 4C2TA 2W6IA 3AQ4A 3CO5A 5FTMA 4ZI2A 2R9VA 3PCRB 1HH4A 2JAQA 5JWHA 4FMBB 3ZD7A 4Q9JA 2XTMA 2JJ2D 4M21A 2ZSEA 1KK3A 3NEJA 4NZYA 1IY2A 4YXWA 3E2IA 1SKQA 4KAXA 3TSOA 2E87A 2WIBA 2A30A 4E09A 3OIUA 2IYSA 4HAZA 1G291 2Q9BA 2QL6A 1NG1A 2BEJA 4Q03A 4BEBA 3RWMB 1X8JA 5JRJA 1U8YA 5BW8A 1ZM4A 3U3OA 4C0BA 1Z6XA 3FFAA 1G3QA 1X86B 1XCPA 2JJ1D 4Q1DA 2BMEA 2RGDA 1I4TD 1WQ1R 4F93B 3SYLA 2W0MA 3PFIA 4PO1A 4B3BA 4C2UA 4AI6A 5EXXA 3BH7A 1E3MA 4BLQA 1SVWA 2WKQA 2WTUA 5DISB 2WWYA 1N6OA 421PA 1N6RA 2ODNA 2QMUA 1Q44A 3GLFA 1Z5ZA 3RS4A 1N6KA 1FOEB 2Q21A 2NO1A 2QN6A 4JLPA 1CEEA 1XJ0A 3B82A 2BM1A 3EWAA 3RANA 2ZU0C 2IS1A 1O3YA 1XF9A 2FFBA 3MSXA 3AEZA 4DUGA 2QAGA 5JWRA 1ZAKA 2E1RA 3FHOA 4QGGA 1E1QD 4Q4JB 4BRUA 2Q0HA 1X3SA 2FSHA 1CLUA 3R7WA 3BE4A 3K9LA 4FCTA 4B33A 5FOXA 1AGPA 1KK2A 1LS1A 2IYWA 3U3RA 4XOIA 1Q21A 2MMGA 1W46A 4IVPA 5EP4A 1XCMA 4E5UA 1KJZA 1XDBA 1ZW6A 1MO6A 2RGCA 5JSZB 2P6RA 1P72A 2AX4A 2VF8A 2QSYA 2ZRKA 2REXB 1ZINA 3WMGA 1T8UA 5KNBA 3RS7A 3CM0A 2JLXA 4BLOA 4Q7LA 4BRWA 1S0UA 2AD1A 4L9WA 4WZBE 3K0CC 1YR9A 5CIWA 5L3QA 2GCOA 3MWJA 1RPZA 4IDOA 1XTJA 3R9WA 2F1RA 4B71A 4RD6A 3IBYA 1X1SA 5DI3A 1TQ4A 1G5TA 1SVMA 4M4SA 5FL7A 3QKRA 3QVUA 2PCJA 3LXRA 1M7HA 1N6NA 1P2TA 3LV8A 1DPFA 2PT7A 2CCKA 2O8FB 3NG1A 4RFSA 2O8EA 2AR7A 2CL6X 3GFTA 1G7SA 4CT4B 2I4IA 3RWOA 1U94A 3T1OA 4KODA 1W0JA 4Q5IA 1WBBA 2YOFA 3V4FA 4YONB 4NCKA 2ZE8A 2FGJA 4R2HA 3UPUA 2FJUA 4ASUD 1Z3IX 4EDHA 3GEEA 1CJKC 5AWFC 1FUKA 2GDJA 5CK5A 3NXSA 4WBSA 1L4YA 1NSTA 3W8RA 1R79A 1XPRA 1G7CA 3GLFE 4F4JA 2GEUA 2WWIA 1NVXQ 2QPAA 4Z1MD 1GNPA 5C1BA 4I1VA 4WVFA 5JRZA 2GCNA 4TTQA 1IXRC 3M6AA 5EZ6B 1A4RA 1RZ3A 2ODWA 4GFDA 2IYYA 3WP1B 3TQCA 2RGBA 3CKLA 4MYHA 2IEYA 1ZMXA 2WOOA 4QGHA 1E0KA 1KAGA 4WXPA 1JQJC 1KGDA 1J90A 4TSFA 1Z8FA 4CEHB 2REBA 2FOLA 2ZYUX 1NIPA 4JVLA 4MYTA 3MWKA 2I1QA 4CRWB 4MYUA 5JMTA 3AVPA 2JGNA 1YZQA 4NYIR 3WNDA 3EZ6A 3QXXA 2QAGB 4OHXA 3IUYA 4BQSA 4I1UA 4Q66C 2AKAB 5FOSA 4XIGS 4RD1A 2PJZA 5A4JA 1NIJA 1DTSA 2ORIA 3V00A 1W5TA 4MA4A 2XNSA 1G3UA 6Q21A 2GJAA 4MGKR 1NLFA 2JATA 2Q3FA 4BFZA 1RE0A 4IDNA 4IW3B 4EQ6A 5LB4A 3OEEA 2UZIR 4H1UA 1A82A 1FQJA 2GETA 1A2BA 1CS4C 5DE3A 5FTLA 4AD8A 2BBWA 5DNYB 3VKHA 5CIQA 1KAOA 1S9DA 2ZTSA 2ZJ8A 4RKFA 2IUTA 2IYQA 4D2IA 1E9BA 1E2JA 2D3WA 2G88A 1XTKA 2A9KA 4ZDWA 3QKRB 2JLQA 1MO3A 4HAVA 3R9XA 2J5XA 3HDTA 4EUNA 3EASA 5JBQA 4A36A 3OIWA 2JLSA 2WJIA 3X1XA 3HYTA 1VCOA 1E2MA 4NYMR 5JS7A 1IN5A 4MRVA 1HY3A 2ASEA 2F3RA 4XVUA 2OLKA 4EPXA 1YZNA 4Q1BA 3OHMA 4B73A 1E69A 2XTNA 4DIEA 4DBLC 1H8ED 1U2RA 1ZUIA 5GJBA 1Y8FA 3GFPA 3GEIA 2IUSA 4QGAA 4HUQA 1R10A 2DFTA 2NO9A 1ZUHA 3PR1A 3ZIAD 1GFIA 5L3RA 2A5GA 4Q18A 4KSCA 2XXAA 4QC2A 3CBQA 4PANA 5AJZA 1E79A 3EPLA 4MGIR 2UZ3A 4WOPA 2W6ID 5AJYA 4BLRA 2BMFA 3A1TA 1CR4A 3WY9A 3L2OB 3SZRA 1Q3TA 4LV8B 1NKSA 4M22A 1R5NA 4RD2A 4B48A 4CEJA 3VHLB 4P33A 1E2IA 2VO1A 1P5ZB 5JHHB 1KO8A 4DEXA 1QHYA 4WAUA 2HYDA 1F2UA 3VMFA 5DH9A 1NN5A 4C0KA 4HZUB 1JQLB 1KI8A 4C0JA 1R7RA 2J0UA 4HZIA 3BB4A 2QP9X 1VMAA 3Q5DA 4OJQA 3A1SA 1IM2A 2ZANA 4QHTA 2DB3A 3AVVA 2CEAA 1ZC3A 5G3YA 4UNSA 3SU8A 1CBUA 3GLIE 3K8YA 3P4XA 4JYBA 4D25A 4ZI3A 2AXNA 3L8YA 4C0LA 1NY5A 2KSQA 4H1VA 1RRFA 2VQSA 2BKEA 3NH6A 3P1JA 1SVOA 4LUCA 4A8JA 3CRW1 1IOZA 4PC2A 5TARA 4IVRA 1TTTA 5J5CA 1E0AA 3GLIB 2O8CA 3NEYA 4UQOA 4A1FA 3PUZA 4L9SA 3L0SA 5LPNA 2FEMA 1P3JA 2YINC 2QMOA 2ZITA 3QXCA 4YXWD 1DO0A 1KI4A 3ICQB 4LJ9A 5CDFE 1XB2A 3GLGA 2O8DA 4AKIA 3OFND 5KSOA 3JVVA 2AL7A 2XX3A 4EAQA 5EP2A 1TUEA 2IF2A 1XEWY 2QI9C 3WYGA 2AHOA 2ZJYA 1G8HA 1OXTA 4B74A 3QSYA 3I8XA 4NYIQ 4BEJA 1AIPA 1T5LA 5JJIA 4A0GA 1GWNA 3K1JA 2FDCA 2RKOA 1HA3A 4JLOA 4TYPA 4DLSA 4EPRA 3H0KA 3TR5A 4MRPA 3THWA 4M1OA 1W36C 1EGAA 1RRGA 5KPJA 3ZS9A 2W2VA 2XEXA 4QBFA 3EIQA 2ZI4A 2ZETA 1Q0UA 4GP6A 2H8KA 3TUIC 4KSBA 5TVKA 3ECCA 4D4MA 5GVSA 3GLFB 1XEWX 4DDTA 3GLHA 5K8IA 3BFKA 1K5DA 2F9MA 3K09A 3MFYA 4TYWA 2XB2A 4OHWA 1P2VA 1LVGA 1A2KC 1D9ZA 2EU8A 4PFSA 1BOFA 3LDAA 2GF9A 5FOWA 1ZM3A 3LLMA 2BWJA 1AZSC 4MKFA 4B2LA 4ZIRA 5JEEA 4MGZR 1OH8A 1KHTA 2WWWA 1O87A 1KI1A 5JJLA 4OI1A 2YWFA 4JKIA 1OXSC 5A0FA 4IOKA 3QI2A 3U2QA 4MRSA 4JSTA 1R0ZA 2VP9A 1RYFA 2CLDX 1UBEA 2H16A 3QQ5A 1TEXA 1UM8A 4GPTA 4LBZA 2IW3A 2VHTA 4LOAA 4DSTA 1W44A 3QOFA 3SJCA 2FPMA 2H1LA 4IDHA 1ZNYA 2F43B 2G3YA 2D62A 5JSZA 2JJ2A 3VR5A 3BC1A 4UNPA 2GBLC 3RVBA 4PPFA 3IEVA 1OYYA 5L3QB 1Q57A 1U9IA 4YDSA 1E1QA 1T3HA 2AWOA 2JA1A 3PEYA 1XXHB 3H86A 1Q1EA 1KDTA 3AVOA 2ZREA 5DI3B 4DB2A 2YJTD 1UFQA 1QHXA 1ZC4A 4IFBA 1K6MA 1Z0FA 1FMLA 2OFOA 3R20A 2JDID 5FPKA 5JEDA 2EFDB 3K70B 2MSDB 4G1UC 5FOUA 4DDVA 3RLFA 5A5GA 2OCPA 1QVAA 2BM0A 1T0HB 2NOAA 4HLUA 5HCNA 1AS0A 2DCUA 3A1VA 2WAYA 4FXPA 3GJ4A 3N70A 1VTKA 1MO4A 1XP8A 3F3YA 2VRWA 3LBIA 3N2EA 3AGQA 5F3WB 2R6CA 4LHZA 3QE0A 2H7VA 1DAHA 1EFRA 1ZM9A 4OK6A 1IBRA 1KOFA 3A4LA 1KSHA 4DLYA 1IJEA 5FPYA 4AG6A 3GPLA 3THWB 1QVRA 2RH5A 2XJ9A 2I3BA 5IF9A 2CXXA 1NLYA 4QOSA 3TW8B 3HR7A 2VPPA 1S3SA 2C2HA 4TQAA 3LD9A 2VHJA 4B32A 2OFWA 3SEAA 1NN1A 4LX0A 3QKUA 1ZP6A 1M2OB 2MSCB 3GLHE 5B2ZA 4BE7B 3KQUA 3N2IA 1F2TA 5B58C 1GL9B 3OFNA 1G8FA 3CF0A 2FN4A 4YQFA 2QAGC 4OQLA 5HR5A 1Q1BA 1F5NA 2YWEA 4UNNA 5G40A 4NKRA 2J7PD 1XPOA 2ZRJA 3LLUA 5GJCA 1XD9A 4CDGA 3HJNA 3RSLA 4LJAA 2OUKA 1E2HA 4LJ8A 1G3RA 4FMCB 5FPHA 3LY5A 1VPLA 4OQMA 4DKXA 3B85A 1HTWA 5AUNB 3E1SA 221PA 1DEKA 1GKUB 2ZE7A 1OFIA 3SJAA 4QM7A 2HLDD 3ONWA 2ROWA 2OO7A 4G5OA 3AP1A 1VKJA 1ZJ6A 3X1DA 2Y8EA 4HB4A 5JI3E 4NH0A 3KDSE 4JLJA 4DLUA 4B34A 3THXA 2AK3A 4K46A 1HUQA 4YLGA 3WBKA 2C98A 2BCJQ 5KOYA 2REOA 1NVUQ 1HE1C 3CWQA 3IKJA 4FD2A 5J4LA 1M7BA 1JR3A 3NKVA 3VR6A 3NWJA 2O8BB 5IDVA 1NF3A 1OH7A 4PR0A 2B8WA 3B2EA 4ZPXA 1MRNA 1K8RA 1MT0A 4D0NA 4BZXA 2Q3MA 4RSGA 2BDTA 4JLMA 4OI2A 3U4QA 1SXJB 1SVIA 2B7BA 3JZAA 3HPQA 5FPSA 1NBMD 5AUOB 2R6AA 2WSMA 3EA5A 3QPVA 3NHBA 1KSFX 4AYWA 821PA 3I62A 2QY9A 2ZE5A 2A5DA 3C4JA 3EIHA 3HU3A 1DAKA 3BH0A 1YU9A 4ESVA 1GRQA 1AQUA 2CK3D 3KKMA 1QG4A 1KY2A 2C9CA 2ZRBA 1AS3A 1NP6A 1T5IA 1WE2A 3QXHA 4MQBA 3SS8A 3G0HA 1ZCBA 4GMXA 4Q47A 1NVVQ 2N46A 4PPGA 3I4LA 1Z83A 3P4YA 4L8GA 4Q4JA 3NH9A 4EPYA 2V7QD 3EX7C 1TQ2A 4XVRA 2QBYA 2HF9A 1G20E 4JYCA 1ZRHA 2OCAA 1XBTA 1G3MA 4Q00A 4XTCS 2A5YB 4HZUA 2NZJA 2WPDA 5FUVA 4Q21A 1XWIA 2HCJB 5G3ZA 1KI6B 2DFNA 1QHGA 2NPFA 5BN5A 3CPEA 5HZKA 1ZVQA 3H1TA 2VHQA 2CHVA 1CP2A 1II8B 2PLFA 2D7DA 1VYVA 1FX0A 1GDDA 3LFUA 4Q19A 4AKEA 2KBEA 3RRYA 4M1KA 3EA0A 3OZXA 5FTJA 5JLJA 4JVSB 2OAQ1 3CNOA 2FA9A 4M0LA 2YOHA 3B1XA 1OXUA 3K0EA 4L5BA 3ZZTA 1R5OA 4JSYA 3WHLA 2O0HA 1B23P 4A9AA 3QNUA 1K5GA 1XMIA 1ELOA 1W4RA 4D81A 3UANA 1SVKA 1XFAA 4E22A 4EKDA 4CEIA 1GAJA 1Q1QA 2BBSA 1EK0A 3B13B 2YZ2A 1X1RA 5FR2A 2QSZA 1DAEA 3H4MA 1LFDB 3DKVA 4TMZA 3WNBA 3U3KA 3EZ7A 5E4FA 4UXJA 1J70A 1E2EA 2CNWD 3RRZA 4S35A 3W34A 4FWTA 4P4SA 1UEJA 2BBOA 1Q3HA 4R7ZA 1TUIA 4BLPA 2ZVQX 3NC1C 1U99A 2WMOB 4G5SA 3WRXC 4UJ3A 3IBGA 4M8NE 2F1JA 5KUTA 1ESMA 3LBHA 5TB5A 4XSGA 4XWKA 2IYVA 1WXQA 3AF0A 3LW8A 3U4QB 3AM1A 3FHTA 1BYIA 1KTVA 2J7PA 3IQXA 3AF3A 3SC3A 5JCZA 1FZQA 4P4TA 3EC2A 4QKQA 5KDOA 2B21A 1Q12A 1E4VA 3BORA 4KFRA 1FNMA 4KBFA 4DRZA 1T3LA 2O5VA 3EZ2A 4RJLA 1SGWA 4MKIA 5J4KA 5IK2D 1E1RA 3D8BA 1XZQA 3TK1A 3BERA 3NBYC 1AM4D 1E2DA 3ZDQA 4LJ6A 3TKLA 2IYLD 3U6BA 2ZR0A 1P4SA 4TL6A 1A7JA 2FE4A 2ELIA 1FNNA 1U81A 2V55B 1AQYA 2WZQA 3BAFA 4Z51A 1P73A 3T1TA 4BFSA 3B5JA 4CZ2A 5G53C 2QA5A 3CRVA 4YC7A 3PITA 4JL6A 4URXR 1SXJD 3FKQA 3BK7A 4N1AA 2F43A 1J8YF 2RGXA 4NCHA 4PHHA 3AF4A 1YKSA 3R8CA 5K8UA 4QJ4A 1TMKA 3SOPA 1E99A 4BFUA 1AN0A 1II8A 2CE7A 3DMNA 3ZH9B 3QJYA 4Q9KA 1IY1A 2KI5A 4F4CA 4AK9A 4EFLA 1JPNA 1E4YA 3T1QA 3R8FA 4P0TA 5SZIA 1FTNA 4JT4A 3SN6A 3TE6A 3O8CA 3UGLA 3OIVA 4RCZA 3CB4A 3BJIC 1QZXA 2YV5A 2RMKA 5BXQC 2B7CA 2ZPTX 4A2QA 2G1KA 3K70D 5FOTA 1UADA 2DFLA 2JIZA 4URWR 121PA 4NONA 1JAHA 3SFVA 3ND8A 3T12A 2D06A 4DLWA 2JJ8A 2A78A 2VF7A 3KB1A 1OIVA 1JJ7A 4GZMA 2VBCA 2ZRNA 5G41A 3I5XA 1C1YA 1OB5A 4DLRA 4ZO4A 1XPUA 4IXNA 4DCTA 1XTIA 1GNRA 3C15C 1OW3B 1PUIA 1DVRA 4TTPA 4FMDB 2WJJA 2ZRLA 3TVDA 1BIFA 5L8VA 1YR8A 1TQDA 1N2CE 4DSOA 5LBIA 1Z63A 4UJ5A 1D2MA 3X1YA 2WWHA 8OHMA 2ONKA 2IS6A 4UXHA 3LVRE 4RCYA 4CEJB 1P9RA 2DFKB 1SHKA 4KHZA 2GK7A 2GJSA 4V0NA 1U8AA 1KDPA 2ZI6A 4TSFD 3TJZA 2EQBA 3MAAC 5SZKB 3FDIA 1F2UB 2FPLA 1N6PA 3BFXA 4HAUA 4PTLA 2ORVA 3IO3A 1IY0A 1F2TB 2W6JD 2ZUCA 2VSFA 1ZD9A 1F6BA 3CONA 3TAHA 3N5CA 1TBNA 3AKCA 3EIEA 3AB3A 1E2FA 4I4LA 1PV4A 1X8KA 1CU1A 2IXEA 1DAIA 2RAPA 2D2EA 2FSGA 4IOJA 1GKYA 3SBDA 1NMZA 4LHYA 1TF7A 3VKGA 1E32A 1ZU4A 2FU5C 1VG9B 5J47A 3QUSA 2V3CC 3BGWA 4TLBA 1H65A 3FKSD 4JIMA 1RJ9A 3RDPA 2F3TA 4HEJA 3WNCA 4MDFA 1LB1B 2YC4C 3GLIA 2ZRHA 2J1LA 4BASA 1N0WA 3EPJA 2HXSA 4JLKA 3GJXC 1QHHA 1BH2A 2RGGA 5B30A 4KYUA 5AJWA 2JLUA 4M2LA 1YRAA 2QM7A 4V0MA 3ADKA 1M1YE 1EXMA 4OK5A 4PZLA 4QL3A 3S1AB 3ZVRA 3I5YA 1N5IA 5H1YA 3K53A 1P75A 1TNDA 2NO7A 1CRPA 5KHOC 2ATVA 3AP3A 3JZMA 2XITA 2V54A 4GRAA 2GVDC 5DHAA 5KSZA 1TL7C 2QENA 4G5GA 1RC8A 1ZCAA 1RIFA 1XD2A 2FG5A 4LJ7A 4Z1MA 1UPTA 1XTQA 2NTYC 3T1VA 2FNFX 2O8BA 4GP7A 3RS2A 1S1CA 1U90A 2OBLA 2EYQA 2C9OA 5B57C 3O8BA 5J4YA 3RS3A 1F3OA 5C4MA 2ZEJA 4KXFB 1TPZA 4Q9IA 2XGJA 4LI0A 2QT1A 1G8YA 1KNXA 2WWGA 3KQLA 1RRCA 2A7QA 4B2PA 4BLSA 2F9LA 1W0JD 1NL3A 2HJGA 3ZYCA 1G7RA 2FNAA 5AR1A 3OEED 1GITA 1F60A 1CJVC 2EFHB 2R65A 1UKZA 1R8SA 2FGKA 4CEHA 4GI7A 2ORWA 4NCNA 2C9YA 2ERXA 3WHKA 4KYIB 2IS2A 2G0TA 3ZIAA 5DSZA 4KLNA 3KKNA 4DCVA 3JVUA 5H8WA 2CDNA 3FYHA 2Z0MA 3KL4A 3K0SA 5CYPA 1OF1A 4I1SA 1SXJE 2BOVA 4JJKA 4FW9A 1RKBA 1S96A 1KI3A 2ZRPA 3KXLA 5FUYA 3QPWA 4HI0E 4L4UA 5SZHB 4D6PA 1M34E 1I2MA 1SULA 1FAQA 4JLBA 2WKRA 1GNQA 5EE9A 3E70C 1PTQA 5DI9A 3NVAA 2Z6VA 1VG1A 5LB2A 3CZPA 1L8QA 4JT2A 3U3JA 1E98A 2XZOA 1N6LA 4JMPA 5F9HA 5IT5A 3FPAA 1T91A 4D26A 1D2EA 1GUAA 4LYHA 4XH9B 4TZ6A 4DSUA 3B60A 4NU0A 2YKGA 2OBMA 1G6HA 2PMKA 4X8HA 1JPJA 3BB1A 1FX0B 5CLQA 4ARZA 1II9A 1FL9A 2QMEA 4LJ4A 3PVSA 3QF7A 3OAAD 1NVVR 4DDUA 1FTSA 3AH8A 1Z2AA 2ENZA 1AZTA 2QTVB 2WWFA 1E9FA 1NN0A 1RFLA 2QAJA 1QHHB 2Z4SA 4QG7A 4HB2A 1W0KD 1TX4B 1SQ5A 3KY9A 2VL7A 3RSOA 4B6EA 3S1AA 1E1RD 3QKSB 4TT3A 2X77A 4A15A 4HDQB 4B75A 2WBLC 2C96A 1YR6A 1G64A 3CPJB 4M1MA 1W5SA 1GRNA 2G0NA 1LF0A 1E0JA 5CJ2A 1D5CA 3C5HA 2CVFA 5TY0A 2J59A 3LBNA 1G7TA 4P4SB 4HUQB 3EWSA 3RABA 2ZE6A 1JB1A 4GZLA 5D3QA 1HQCA 1Q1ZA 3AVQA 3OAAA 3UGDA 5FBLB 4C0HA 4F92B 4V0LA 1COWA 2BJVA 4LPSA 1ZBDA 3FFBA 3CZQA 4LC0A 1M8PA 2W0SA 5JHGB 3MUFA 3SI7A 2QUZA 1SKYB 1NVWQ 1P60A 2VLIA 1NI3A 2W6JA 3TUZC 3I92A 3WP0A 3TUJC 3DL0A 5FBRB 3RAPR 4M1TA 2GAOA 4Q9HA 4E03A 4AKGA 3EXAA 5FL7D 1PZNA 2GF0A 4M9XA 4AY2A 2C77A 4BGDA 3UMFA 4YMUA 1GZSA 1CIPA 4Q48A 3L82B 3T61A 3PEUA 3U44B 5AJVB 3K70C 1Z29A 2ZRMA 3I8SA 4RFVA 3SYKA 4O2LA 3W5IA 5AJXA 1VIYA 2JIZD 4V03A 2WVJA 3GJ8A 4B44A 4ASUA 2RHDA 4DCSA 3TSWA 4RVCA 4H9GA 4Z8XA 3QXSA 3KFXA 1XRJA 1QBKC 4A8JB 3FVQA 3TLXA 3TSZA 4CVNA 4XWOA 3DPUA 3P32A 2XSZA 2R44A 4HSEA 3VX4A 5C18A 2EWWA 4P31A 4BECA 1W49A 4ZDJA 1W7AA 1XEXA 1KBEA 2V4ZA 4FMDF 2F55A 2ZYWX 3B9PA 3GFOA 2ODEA 3GCGA 1OLOA 4NBSA 5EE5B 2P3SA 5EZ5A 4ACAA 4JVMA 2FSFA 4CF7A 3ASZA 4N0DA 3CUEF 5E3HA 3KTAA 3GLGB 2O8DB 1AA9A 3VAAA 3QY0A 3D7MA 3IQWA 1TF2A 2EFEB 5CJPA 1W4BA 2FH5B 1FP7A 4A6XA 2IYTA 5KDLA 3FMFA 4KBGA 3W6NA 4QRHA 3K0AA 5DN6A 5ELXA 2V7QA 1NY6A 4NMMA 1XXHE 2VHUA 4KVAA 4YDHB 2GBLA 4LRWA 5HKKD 2J0SA 2AK2A 4GOXA 5DIFA 2QE7A 1WB9A 3QKSA 1QRAA 3DHWC 4L15A 3ZVLA 1E9SA 1MABA 2AFHE 2ZSAA 2QTHA 4LY6A 2A5JA 4JLAA 1L2TA 3GJ7A 1V43A 4WA7A 5FUXA 4RD4A 2D74A 2VP5A 1KO4A 1GSIA 1JR3E 1S2MA 3QKTA 4CIDA 3U7GA 1SXJA 1T3SA 4MUAA 2Q6TA 2R6FA 4JS0A 4EFNA 1YZLA 2VIIA 3U60B 2ZSBA 1U0JA 1CR1A 3GJ3A 4DLVA 3KXIA 3W5JA 3ZVMA 1DADA 2FZLA 2J41A 1GP2A 3IGFA 3ZLJA 3HPRA 4Q1CA 1OPXA 3W3AA 3PXGA 4FINA 1CRQA 4KFUA 3UWKA 1Z22A 5D3MB 4HAXA 4GOJA 4XD7D 3SQXA 2Z83A 2IXGA 2NPIA 3AKYA 3OEHA 1P9NA 1G6OA 2QBYB 4IDQA 3MWYW 1G3IA 4FI3C 4HLUC 1E2GA 5EXSA 3TVTA 5L3SB 3CH4B 5E7JA 1OIXA 2ZRGA 4XSHA 1BMFA 4Q9LA 5FH9A 3QG5A 1PVOA 4W9MC 1TEVA 2KB0A 4DXAA 4GDFA 1NMXA 1ZYUA 2ZI9A 3NTUA 1JJVA 1LTQA 3P27A 2OSBA 1E2QA 1US8B 4F4IA 3Q5EA 4DIDA 4TL8A 3A37A 1XA6A 3FMOB 1R2QA 4C7OB 3Q7QA 2DWOA 2UVQA 4PQFA 3W90A 4EPVA 4LHVA 1NG9A 2BMJA 1U0HC 4LSGA 1XEXB 1DAFA 1OJLA 5FFMA 3U61B 2Z5FA 3B6EA 4G5QA 1IXSB 3KJEA 2DYKA 3V9PA 4TMKA 5FL3A 2IEZA 2JASA 4PO8A 1UEIA 4PC6A 3O47A 3ADBA 5JJKA 4Q4HB 3VTKA 3ZQJA 2F6RA 1YVDA 3IILA 5JI2E 1H8HA 4LBVA 1QHSA 2CMKA 2ZS8A 721PA 4QFMA 5FI0B 2VRWB 4B6DA 3FHCB 5FBVB 1KK1A 4BFXA 2E73A 1SVSA 1KO7A 2PL3A 3KJHA 1BS1A 2JLZA 1N25A 3NBXX 1Z07A 3KZ1E 2JLRA 4FIDA 1BO6A 2WAXA 1IN7A 4URUR 4F91B 1SZPA 1KMQA 3ZVNA 4M9SA 1UDWA 1N6HA 1VIAA 2F1IA 2ZI3A 2ZS7A 4URZR 2GZDA 1E2KA 1HYQA 3REGA 4C0AC 2IYRA 1ZUNB 4HLDA 2HF8A 5HTKA 1MV5A 3KUDA 4M1WA 3WMEA 2ZAOA 3SHWA 3UMSA 3VR1A 3H84A 4EJSA 2D7CA 2WPDD 2FFQA 1MRSA 4JLDA 2PMDA 1MR3F 3RYTC 2CCGA 3FTQA 4LYFA 2EW1A 3B7GA 5AUQA 3TH5A 4D0GA 2CL7X 3A8TA 4XD7A 4R9UC 4ZKDA 1IXZA 2BC9A 2ZXUA 1JBKA 2XZLA 3CPHA 2DHRA 4P4UA 2QG6A 4TLDA 3QBTA 2QEQA 4GOKA 3OE7D 3U6KA 1PUJA 2WJYA 2WIAA 3QF4A 1XTRA 1GVNB 2F7SA 2JDIA 2KWIA 5E7IA 1EFCA 2WMNB 5CK4A 1G5PA 3UG7A 1U8ZA 1RW4A 1Z08A 5TMPA 4GL2A 3B1YA 4TLAA 3IEUA 2OZEA 2OFXA 1OXVA 1W47A 4DC9A 2CL0X 4ZV4A 2DB6A 3IDQA 2HCBA 4NCJA 3D3QA 2OXCA 3BOSA 4LV5B 3W6OA 3RRNA 2ZS9A 3QXJA 5HE9A 2VH5R 3J81k 3W6PA 4C4PA 5EE3A 4I81A 2CJWB 1RRPA 3U7EB 2AN9A 4U7DA 4C0QC 3M4YA 1Z0IA 1Z6AA 1Z6TA 3PEWA 2GNOA 3ETLA 4TYQA 5BN3A 2HV8A 2GCPA 3DM9B 2WHXA 1US8A 1E2NA 2GZHA 1ZNZA 3CR7A 4A8JC 4ARZB 4DCUA 4QHSA 3H2YA 3TBKA 1XJCA 5DN6D 3THXB 1G19A 4QNRA 1FW6A 4ZKEA 4W7SA 5EJEA 2GHIA 1LF5A 4NL4H 1UDXA 1KI2A 1C4OA 1D8TA 2CE2X 2FF7A 1EESA 1AKYA 2V6IA 4AURA 5KSYA 1OV4A 4PC3A 3C16C 3BFVA 1T0JB 1H8HD 1VHTA 1W48A 2G1JA 2HDNB 2ATXA 4BPBA 1PLJA 3DOFA 1TBOA 5C4GB 2CHQA 2WJGA 4POAA 4WIAA 2CVHA 5LD2C 4PZYA 2NZ8A 4QJ3A 2IF0A 3K9HA 4QM6A 3A58B 2YWGA 3K9NA 4XWAA 2YOGA 2OG2A 5C46F 3CW2A 1KKLA 4JVNA 3B1WA 4RY2A 5KTYA 1W2GA 3OIYA 3TRFA 3C41J 1P7CA 2VSOA 3GP8A 1EFUA 2ZJOA 3A36A 2WICA 4W5WA 3T15A 3MWLA 1DAGA 3CNNA 1R4AA 2CNWA 2EFGA 1KSJA 2VHCA 3LNCA 1A1VA 1VG0B 2IL1A 5FPTA 4HUTA 4D82A 3K0FB 1VYUA 2QQEA 1BKDR 3CF6R 4O0MA 4LV6A 3QEJA 4F7WA 4D4KA 2Q9AA 1GILA 4JBXA 4QBGB 3GJ6A 3B1ZA 2MMCA 2I1VB 1KI6A 4BZPA 1YQTA 2IA5A 4AWXA 1D6JA 5IHPA 2NMVA 1S9HA 1Z0AA 1G9XA 1Z0JA 3BD9A 5CYOA 4L9MA 3ZZUA 4QNMA 1I4LD 4Q7KA 1G4AE 2H17A 3CH5A 3ADCA 3SJBA 2H57A 4MDEA 2VP6A 1M74A 3AGPA 5DGXA 1Z2CA 4MRNA 5BWMA 4EPTA 1A5TA 2O0KA 1GRRA 1S3GA 2CJWA 4NYMQ 1E9EA 4DSNA 1SVLA 3NBFA 4B76A 4EPWA 5UKDA 5FTNA 3M1IA 2W2XA 1Q20A 3ZD6A 3KTAB 2JEOA 3PUWA 3RNLA 3U7HB 4CEIB 3MD0A 4LYJA 5GJVC 4D0LB 1ZU5A 1LV7A 2GAAA 4TYYA 4Z8YA 2ZJAA 1SHZA 3CNLA 3K9GA 3AKEA 1IN4A 5HKKA 4DT1B 4KFSA 1XCGB 2ANCA 4M1SA 4K8OA 1XD2B 2RB4A 3MJRA 4IEEA 3CRMA 4II7A 4LYAA 4P3YA 4PAMA 1KK0A 5FR1A 3THOA 1D9XA 3T5DA 4JL8A 4AC9A 2OT3B 3RC8A 1LY1A 3TMKA 1EX7A 3THYA 3GJ5A 1E2PA 2QM8A 4ACBA 3B1VA 4DEYA 2IC5A 2WSSA 4PHTA 2QRZA 4IOLA 1UBGA 4UXIA 4MYCA 3IIJA 4O25A 3P26A 4JBWA 3KQHA 4C0SA 4OKSA 2WKPA 4IRUB 521PA 2G83A 5EE1A 2HXYA 3DEFA 5HPYB 5KYKA 2GK6A 3Q72A 1W36B 3PG5A 4OYHA 4ZDKA 2OESA 3REFA 3A6PC 2OAP1 1ZD8A 1VYTA 4D4JA 2C5LA 5JFGA 2KE5A 5D3MA 2DWPA 5JS8A 2YYZA 3QENA 5F2EA 1NBME 2RGNA 2FZ4A 2FX3A 3CX6A 1G5RA 1KZGB 2F1HA 1TAGA 3IHWA 1WMSA 2QE7D 3RS0A 4CYMA 1VCMA 4URVR 5F9FA 3WYAA 2YNMA 2GRJA 4Q4LA 1YRBA 2OM2A 1PLKA 3PUVA 1FMJA 2QP3A 4N0EA 2N42A 2ZU6A 1T4GA 3AVWA 4KFTA 2BMDA 3LX8A 1CKEA 2HT1A 5DO9A 4Y0AA 4DDWA 5J4VA 1N6IA 4ZDIA 2ZSFA 4C30A 1FUUA 3WBJA 3W3ZB 3BRWD 2VA8A 4A82A 5KU1A 2GKSA 3NIBA 4IEIA 2OV2A 2FEOA 1EFHA 4G5RA 1SXJC 2OEPA 2HUPA 2BBTA 3F8TA 2PEZA 4KU4A 4ILEA 4PXAA 5FI1B 1IN8A 3SFZA 1U98A 3DKPA 2GJ8A 5BQ5A 3AF1A 3LXXA 2VP0A 2FV8A 3ZJYA 3ZS8A 2IWHA 1E94E 3IIKA 4K81B 4DJTA 4R98A 3BXZA 5KDDA 4NYJR 5ANRB 2ZRDA 2ZJ2A 3X1WA 3BJIA 2WJHA 1KDOA 3HU1A 4OHZA 2Z4RA 2XNDA 2ZJBA 4DT1A 5DHFA 3KFVA 2ZVPX 4OL0A 5LDDC 4RD3A 1DARA 1E9RA 3DZDA 3C7KA 2Q9CA 3AVYA 2XSZD 4MUBA 1Y3AA 4IXMA 1CULC 3DM5A 1TU3A 2IX3A 1XU4A 1HT1E 2QROA 1T6NA 3T35A 4BWYA 2GXUA 2QGZA 4ITRC 1FARA 4TMTA 1AGRA 1XMJA 1W1WA 2GVZC 1YE8A 4V0ME 1RVDA 2BIFA 2PZFA 3HYRA 4OQFA 5CITA 3SR0A 4XVQA 2R6GA 3FE2A 1FQKA 2OXRA 2EVWX 3GQBA 4OHYA 3KUCA 3NC0C 3VR2A 3UFFA 4D80A 5CM8B 1I4DD 3FMPB 4PQYA 3PJRA 4ZCMA 1OT3A 3U44A 3QBVA 2IUUA 1LW7A 5HCIA 2CCJA 4ON9A 3KX2A 4Q02A 2IYXA 1GIAA 3P20A 2DY1A 5FBQB 2B6HA 1EFRD 3CXLA 1UBFA 3MG9A 3ZGXA 3CX7A 3BS4A 4HDOB 4PAQA 3SDZA 3AVTA 2AKYA 5KNDA 1VHLA 1TU4A 2PEYA 1HV8A 2ZROA 2W00A 2B92A 3A4NA 4KI0A 4QHYA 5KNCA 3O8RA 1RJ9B 2QPTA 2P5SA 1W0KA 2HJVA 2Z43A 4HLCA 2PX3A 1AKEA 1EX6A 1WBDA 1UAAA 2IYUA 1RYHA 1YJ5A 1Z28A 1XJQA 3TNFA 5F98A 2QZ4A 3FMIA 1OHHA 3LAWA 2O8FA 2ERYA 1M7GA 2YHSA 2VP2A 4Q01A 5K8LA 2ZIAA 3FOZA 1NRJB 3Q8XB 1VCNA 5TXGA 3W8NA 2VYFA 1NN3A 2GXSA 4FMCF 2H18A 1E79D 4QXAA 3VNVA 1UKYA 1OFHA 3EW9A 3K0AB 3I3SR 3AUYA 2ZYTX 5EUQB 4X8OA 3B8HA 3L0OA 1G21E 3OF5A 1MOZA 4OJKA 1G8PA 3RHFA 2YC2C 3DDCA 4JJZA 2ZI7A 3K09C 2ZRCA 1DOAA 2X2EA 2ZR9A 4TZ0A 1IHUA 2GEVA 3QPUA 4IKEA 2H5EA 1JALA 4TQUS 1G8GA 3X1ZA 3ASYA 2BVNA 2HEIA 2P2LA 3BBPA 3BB3A 4B3FX 4O3MA 4UKDA 2O52A 2NIPA 3OESA 1PJRA 1G1MA 3EC1A 4NP6A 3AF2A 3CF2A 1EWRA 2GESA 1HURA 5AUPB 1B0UA 1CR2A 4LK2A 4MH0R 4OQXA 1W4AA 1BYUA 2BJWA 2W58A 1CJTC 1Z6GA 4Q1EA 3ADDA 4NYJQ 1E0SA 4Q4AA 4GMDA 1YZUA 3B78A 2ANBA 4HAWA 3GLGE 2ZRFA 3VR3A 5GVRA 4V0KA 4FKDA 4V0OA 4XJXA 2XOKD 3TW4A 3K0FA 3TR0A 2C95A 1WP9A 4WZ6A 4LJYA 3WMFA 4B47A 4OI0A 4TN1A 3L0IB 2XB4A 1P9WA 3UG6A 4CW7A 1ETUA 1HEIA 1HQYE 1ZM2A 2LKCA 5FOVA 4TLEA 2ZUBA 2C04A 3M0EA 4TQ9A 1NKTA 2FFHA 5DYGA 4V02A 5FBWB 4LZZA 3V4RA 1LNZA 1GOTA 2RCNA 3AKDA 1MO5A 5H70A 5EP1A 1ZIOA 3CIOA 3PIRA 2N1BA 3B9QA 1KZ7B 3ZZ0A 1VCIA 2RHMA 1GKIA 1DS6A 4C7OA 3PV0A 2BV3A 3KQNA 5LD2B 1Z6YA 4MITA 2PCLA 1COWD 2RGEA 1QF9A 2FSIA 4TTRA 2RGAA 1MKYA 4Q1AA 2V9PA 3VU9A 1OYWA 4PX9A 4JL5A 1E2LA 2PBRA 1G17A 3FKSA 3UIEA 3AVUA 2QQ0A 3Q85A 3GJ0A 1Y63A 2NO6A 2BKUA 4Q1FA 3R9IA 3CRRA 1R5BA 4B3XA 4P32A 4JLNA 3UXMA 4ZCLA 2C78A 4TT3D 4BFTA 1FFHA 1N3BA 1NJGA 2ZRIA 4ZCIA 4TL9A 2O0JA 4B3DA 5CM9C 4KVGA 4LPKA 1QDEA 2LKDA 2A5FA 4PSVA 4OBEA 4JBYA 3I73A 3RRMA 3EZFA 2ZYVX 3WXMA 5JZVA 1CF4A 4OHVA 2YWHA 4B43A 2VSXA 4JZKA 4PSAA 4EJSB 3BIFA 2K5UA 2IT1A 1J99A 2P6UA 4Z54A 4S2EA 4DHEA 1X6VA 1N5JA 2WJVA 4I1OA 4YMTA 1ZNWA 1DE0A 3VR4A 2IYZA 3DO6A 4LBWA 1ODFA 4AG5A 3EG5A 2OLJA 2AXPA 2IWRA 1E9DA 3SYNA 3KJIA 3VHXA 1NNEA 3LW7A 3VNUA 1J8MF 4GSYA 5BN4A 1IN6A 2GXQA 3VFDA 2PJRA 3KKQA 2PZEA 1UKEA 2G77B 2YUUA 1W4CA 3E5HA 3U5ZB 4OK3A 4URYR 2V8OA 2EFCB 3D6TB 4TLCA 2NGRA 1OXXK 4QBHA 4B2IA 4G3XA 5E95A 2GWHA 4PC7A 2J46A 5HZHA 4TYNA 2V6JA 3PENA 5CB6A 1ESNA 4C3ZA 4UNRA 2YVUA 1YZGA 4CGZA 2OCBA 2OHFA 4FWIB 2O8EB 4M1YA 3QG1A 4KLZA 3LWNA 4MGYR 2J9RA 4IVQA 2X2FA 1KI7A 1YR7A 4M53A 4WW0A 3LO5A 3Q9LA 2FWRA 3A1WA 3RS5A 3DOEA 4DUGD 2LCFA 4ABYA 3A1UA 1KO5A 2V1XA 4AYXA 2AD5A 4JLVA 3F0TA 5CB8A 5K8TA 1G41A 4PQRA 4R2IA 5BYJA 2XNDD 1E96A 1JEEA 3NDBB 4HATA 1JAIA 4IOMA 4PC1A 3CLVA 2FMXA 5JCPA 4NTZA 3UEJA 1P2SA 4PHFA 5DLQC 2JLWA 2JLVA 2OBNA 3MLEA 5EE0A 2ENNA 1TADA 1MABB 4RKEA 2IHBA 3D31A 4U00A 3LRPA 2VEDA
chains in the Genus database with same CATH superfamily
1QK4A 2F67A 2CD9A 4GMFA 4JWTA 1SU8A 3D2AA 4TKVB 3LOUA 4XTRA 2J45A 2NSYA 5BSTA 3N74A 1KSGA 3T6KA 5LQNA 5GADl 5D3KA 3KB2A 4BNDB 3EVEA 3IE1A 2QU8A 4IDEA 5BNTA 3PSHA 3URKA 2GKOA 2XWSA 4FPXA 4EY8A 2ARKA 4H7FA 1UPBA 4LC1A 5DMHA 4BV2A 4EF5A 3B5EA 4FBGA 1DV1A 3KJXA 4GGPA 4L16A 4GGOA 5F33A 5IP5A 4KQGA 1O03A 1HYEA 4D41A 1AKUA 2YHAA 5I9BA 4EY6A 4HQ0A 3SCZA 2P3OA 3N8KA 2P8SA 2Q45A 2QM0A 1ZX1A 4CHGA 1Z2OX 1Q50A 3E4DA 2QMHA 1PL6A 5CGQB 3ZWYA 5A9RA 3GELA 5EPOA 2RGNC 3NORA 4W1SA 3UUFA 4E6PA 1WMAA 1NLUA 2R97A 4K5QA 2FRDA 4RMNA 3G7NA 4BX9A 4F8JA 1ZUWA 4P22A 1OH5A 5K0NA 1T6YA 2WTAA 2ZJ5A 1KI9A 1KFEB 5FNVA 1P6XA 4RDIA 5C80A 4EW3A 2HM7A 5KYNA 4EHKA 5JIBA 3KYDB 4EQ6B 4MIYA 1OFTA 2BFBA 1Q16A 4H7JA 4ZHQF 4QTZA 4ZZ0A 4KDFA 4PLHA 3MMSA 5BN4B 1PTJA 3JQQA 4JFRA 3R3ZA 2KBFA 1V3UA 1XZNA 1RE1A 2OPBA 4CTOA 1OLUA 3X2SA 4S1VA 2X76A 5DNVA 4NEGA 3V1MA 3N5KA 2CW5A 4RA9A 3DP7A 1WKBA 5DYIA 3D43A 3K6RA 3NFRA 3TRJA 2XMRA 5LXTA 1TF5A 1VZ3A 5HEKA 3A2LA 1UCFA 1Z33A 5EHQA 5KNBD 1GHTA 3IPXA 3G79A 3UJ6A 5CXUA 3F8WA 1F0PA 4PV7A 3EY4A 5TE9A 5B6JA 3WWEA 1E8DA 3LLSA 1ECGA 1ADYA 2AOTB 3ZKAA 5P21A 1GZUA 4YMIA 1HG1A 1D09A 4O1IA 4A92A 1KKMA 3G82C 1YJBA 1KS2A 1TCAA 2J5QA 2VI5A 1DT5A 4TMVA 3ILXA 2Z09A 3JQ8A 5BSUA 3U80A 5KO2A 2D4HA 1TJ3A 3S0JA 4NPHA 3TAXA 2AMLA 4MAAA 4XYMA 4CM9A 1NUSA 2XIQA 5EJ6A 1CE3A 1OJ7A 5JSYA 4V0SA 1B00A 3VH1A 3OIGA 1ORVA 3FAZA 4J0FA 1X9HA 1E7RA 2BM8A 2PWBA 1FXUA 1GGNA 4HAYA 2E5FA 3IDFA 5THKA 2C0QA 3WRYC 1YF3A 3ICEA 1SZDA 1J39A 4OLAA 4BFWA 1WHSB 4TMXA 4KMRA 3UWMA 4D3FA 4D4LA 1JG7A 2NXEA 3JAMA 4U02A 2R96A 3V4LA 3HRHA 3ANXA 5BWLA 1G16A 3OPNA 5I48A 2WM9B 4QQNA 4KGXA 5K0TA 2XTZA 1C9NA 3GD7A 3T8YA 1NJ8A 1MEOA 3NHZA 3R2JA 1B73A 4D3YA 2VBGA 2IZOA 4WNAB 5AKYA 1VL1A 2BEWA 5DSTA 4I9UA 4CE6A 3PXAA 3CVVA 3O21A 2J0UB 2ZTUA 3CF4A 1DJNA 1KFCB 3L4KA 3M6LA 2OD2A 5DM70 2IYOA 3AESA 3P9RA 1ESDA 5FO0A 1LK5A 3S2SA 2XADA 1ML4A 4X7RA 4NBWA 3U26A 1B6TA 5CEFA 1ZJYA 4D8VA 5EHIA 1H9AA 3MLBA 4E07A 4ODIA 4MEBA 4OQNA 1LS6A 3ZWXA 1NQWA 3TGPA 4HYTA 3OQ6A 3CT4A 5F35A 1XMXA 1KZ4A 3OE7A 2CK3A 2H3HA 3PL1A 4EA9A 5B7QA 1RBQA 1MCZA 3I61A 2DPXA 2OTCA 3VPDA 4WKNA 1FB5A 1G4UR 3CX8A 5IK2A 3RI3A 4A0FA 3S2IA 1N4AA 1II0A 1EM8B 1MGOA 4W7HA 4D9MA 1XZBA 4UOEA 1NV8A 3LKDA 4ZXPA 2FX2A 2NZ2A 9ABPA 4ABTA 4QYMA 2R4UA 3CWCA 2IP1A 4EB8A 2GJKA 1E9CA 2G1UA 3EZ9A 3Q1LA 5KJEA 1ZR4A 3D8HA 4Q7JB 3FDXA 4IVNA 3F6EX 2O5RA 1OLUB 4LWPA 2IEIA 3WJAA 3TO7A 1PR0A 2KJQA 4N3NA 4F9TA 1YVUA 2Z5LA 1KMHA 2C8VA 4LOIA 4BFLA 4R8LA 4D46A 1TFUA 2DX7A 1MC1A 1IBKB 4CKBB 3RK4A 4UMDA 3KSMA 2FZKA 1JECA 1N0HA 2GZAA 1VDZA 3VU9B 3ZU6A 2EBHX 3HZOA 1WOYA 3Q7PA 5GONF 5TPWA 3MTJA 1HSZA 3S27A 5J1TB 4JKYA 1NX9A 3WSWA 4X8MA 1H23A 3E48A 5KZMB 4P7GA 5HF5A 1VP3A 4MMYB 4Y98A 2WLTA 3IULA 4MV8A 5FULA 2HIAA 3VKWA 2BONA 4V2UA 4WXYB 4BJ1A 4ZTZB 2C7VA 4RAOA 3BH6A 1DGQA 3RUIA 2QV0A 5EJ9A 3CN9A 3GOQA 3IOEA 1TZBA 1U8EA 1YV9A 4IIJB 3E9CA 4L1KA 4RH3A 4UHDA 4AKSA 6CHYA 1HRDA 3S2UA 3KSBC 1L5YA 1I7DA 5EXPA 3HO6A 4F38A 1YJAA 1POWA 5JNTA 5HOEA 4XX1A 1R8QA 1U8FO 2YWJA 4OQQA 1DG9A 4YAEA 1DZ3A 3H8SA 4IX1A 4ANFA 4C4SA 2GEDA 4A2PA 2LWIA 2P9GA 1TM7E 2YY7A 2FI1A 3W5VA 4LY0A 1CG6A 1ZZGA 3OH8A 1QIKA 2A5LA 2GTHA 2RJNA 1Q91A 2OILA 2B8JA 3AWIA 1ZOOA 1D2NA 1FPMA 3N07A 1RFHA 5DBEX 3IAM6 5LP1A 2J0VA 2X5NA 3TAUA 1NA5A 1R6TA 2QTFA 2XNCA 1BMFD 2DWQA 5EUMA 5I9TA 4DSAA 4YX9A 4I99A 1QUEA 4WT7A 2XYPA 4RHTA 3JTEA 1GN8A 1UC5B 3H99A 5LOVF 3C5CA 2B2NA 1NVKA 3ISVA 3O1HB 3AESB 3ZHRA 1QH9A 1EDDA 3H16A 4U2BA 4UEQA 3AM5A 4BMZA 2QXUA 1CTQA 4FCVA 1WRBA 3ZE7A 3ZX5A 2QT0A 4YMWA 4L27A 1UWCA 2DBYA 3LP8A 2J3EA 4B3CA 2A9QA 3UATA 2O2GA 3A05A 3KKOA 2DOKA 1OREA 1ZMOA 5EP3A 4PAOA 5J58A 4Y7DA 1U0SY 3L07A 1M5TA 3LVQE 3VR0A 4US0R 2AG5A 3ER6A 4QOGA 4RXTA 1CXZA 5BYBA 1JKJA 1CJUC 1E6WA 3DTVB 4HQOA 3FROA 3BMCB 2XAUA 4RZIA 4KO8A 1DZIA 2Z5VA 1ZVMA 4OI4A 2ZFUA 4KGVA 2X1VA 3GMTA 5HF8A 5AW7A 1P77A 2IDMA 4XUEA 5AW1A 2CBZA 4ERXA 1VRCA 2JAOA 3BRSA 1U0LA 2CY0A 4J0QA 621PA 1WUJS 1YRLA 3K2BA 1PVDA 3NEPX 4QAJA 2AMYA 5JYEA 2BP7B 3HP4A 3BWDD 3L43A 2AFRA 3FCSB 4EF6A 3OZRA 4EVSA 1T15A 4PZCA 4XDZA 3SJZA 1SU7A 2HSJA 4LY9A 1JR6A 2X14A 3MCAA 3M3DA 1JDNA 1K7XB 1ONBA 1RYEA 3QBDA 5A7HA 2AFIB 4CN9A 4UNQA 1F9EA 1F51E 3GVHA 3REQB 4ZI7B 5BP7A 4B3GA 1A8IA 1V1MB 5ALRA 3VUFA 1TUBA 1H0KA 2ONYA 2OOKA 4R8KA 1CSEE 4KITB 1BX3A 3KE9A 4WZAE 1D07A 3BJEA 2JEZA 2ALJA 3MINB 4YAJA 2YHIB 5T5QA 3SD7A 3U7RA 3W1VA 2XXAB 1T6ZA 5DYTA 3NDPA 1S1MA 4KACA 2IHYA 3TLKA 4DA8A 5L4LA 1KC3A 5KMGB 2AS0A 4A2WA 1RXSA 3WGNA 4F11A 4IGAA 1JDBC 1Z13A 1A2OA 4ZOEA 1VG8A 5TJHA 4CI0B 4ETWA 2EJTA 2V7EA 4H1HA 2E7ZA 1BFUA 3A3PA 3GUVA 3H6KA 5KHAA 3NHYA 1LDBA 1XDUA 2E4WA 2BCEA 2R00A 3RC3A 1YL5A 2BFCB 5CXSA 3LQRA 2FQXA 2VTBB 4RZ2A 3PDIA 1NOKA 5AM0A 3O5AA 1FNSA 1HFWA 1WX1A 3EARA 2G28A 4P80A 4JJIA 2GVIA 2Y71A 2A9OA 4UULA 1J7JA 1XEFA 3QKWA 3AEUA 3WYCA 2XUAA 4YCAA 1Y34E 4RJJA 1FDIA 5JECA 2GILA 1YQDA 3HH2C 3HU2A 3SQOA 1U7ZA 2QKYA 2V5UA 1T24A 3EQ8A 4RYLA 4UHBA 5GWXA 5B2EA 3TIFA 1ZGJA 3FRHA 5DZSA 2GCOB 5EJFA 3ZI7A 3L7CA 1A69A 5CPBA 4EHLA 1NW7A 1Q0PA 2ZJ3A 5HE8A 2HWYA 3UKDA 2A2ZA 4HZGA 5CA1F 1H4SA 4G86A 1XI2A 1L4LA 2A1IA 3MJ4A 2ZBGA 5C5CA 4I9HA 5CA1B 2W83A 1TZ2A 2P68A 3LZ6A 4BV8A 2DLCX 2JCXA 3TYXA 4DA7A 1NXVA 5D01A 1WCIB 2F2TA 5KX5B 4LXHA 2X1HA 4F7DA 1A97A 4OHBA 5C4IA 1GRCA 3JWGA 3OFVA 4RFSB 3IOBA 4C2TA 4L50A 3AQ4A 3CO5A 5BURA 3O9ZA 3DW1X 1TM3E 3PCRB 3O03A 5A9TA 1PFVA 3EOZA 3VKUA 1W75A 2YNMC 4OQEA 1PEYA 2QYTA 1OX4B 3AEKA 2SKCA 2XTMA 3H1AA 3X2EA 1PG2A 2ZSEA 4Z7QB 3R5CA 4NZYA 4ZVLA 1QP4A 3URMA 4TZKA 3VSCA 4CR8A 1QH1B 2Q3EA 2XRFA 1JX6A 2I7XA 2AN4A 1D8AA 4OJKA 4YXWA 4DMFA 4JWKA 3ZIUA 3TQIA 3U16A 3HJHA 2A30A 1UDAA 1BC5A 1H0SA 4E09A 1T2NA 2OO5A 3K1ZA 1P1IA 1GQSA 2AX3A 1CWUA 3AEQB 3EXEA 5CTJA 3VZQA 4BEBA 2J8ZA 4H3HB 1P0CA 4WUTA 4G8DA 5BMVB 5KQLA 1U8YA 1WG8A 3T9FA 1IB0A 4G0YA 4MV6A 4DA0A 4UVEA 1WGTA 4ZOQI 2QJWA 1EAYA 4IIUA 1YXMA 3SYLA 3NC4A 4PO1A 4B3BA 4BDTA 5HOQA 4BO2A 1CY4A 1E3MA 4BLQA 4YP0A 2A1UB 4BNWA 3TQRA 5GIPE 2DHQA 5HIAA 3MT0A 1ZJJA 1UWKA 5CFRA 1JDBB 5IKPA 1FOEB 2ILTA 1I0IA 1V39A 2NZUG 2W8ZA 1XJ0A 2ZBRA 1RWXA 2BM9A 4YI3A 1UPXA 3EVNA 1P4JA 3EWAA 3MINA 3QLTA 4U9HS 3RVSA 3ZWQA 2PS9A 3EY9A 4GXTA 1CQJB 1XF9A 2O2XA 2XY4A 3FPJA 3AEZA 1X7DA 4U0KA 3A6FA 1RRMA 1X1QA 5IUJC 2QAGA 5JWRA 1UPUA 1ZAKA 2I2WA 2M1XA 3JZFA 4GICA 5B1HA 5CBPB 2QB5A 3FHOA 2NUPA 1O4VA 2V7BA 5KI6A 4MINA 1TTHA 2J5KA 1HPTA 4ZT6A 3EIWA 1CLUA 2P9TA 3IBCA 4YV0A 3R7WA 3BE4A 3UOWA 2E85A 5AJTA 2Z8YM 4I55F 5FOXA 1AGPA 4B33A 4XD2A 3PPIA 3U3RA 4RTRA 3QVJA 1Q21A 2MMGA 2PMBA 4XOIA 1DSSG 3FIJA 4IVPA 1QIEA 1TKRA 1UZNA 3OLZA 5EP4A 1B8UA 1KJZA 4IHJF 2ZRKA 1VP9A 3U4CA 3R7LA 5IMSA 2REXB 4DCGA 1BVYF 3RS7A 4ZICA 4E7OA 1G21A 2FRXA 2HC9A 3MWEA 2HBRA 2E49A 4B4KA 2JLXA 3S8MA 1S0UA 4L9WA 3ZIDA 4BJHB 3U1VA 4D8WA 2RH9B 5G4KA 3QUQA 3QE9Y 2GCOA 3MWJA 3RBZA 1TTPB 2PPVA 3CNEA 4B71A 1WHTB 4M0PA 4RD6A 3AI1A 4RH1A 5ESWA 5DI3A 4C20A 4M4SA 1SVMA 1YB2A 3TW0A 3E23A 5LYJF 2KYRA 1I7QB 3I39X 1PJ8A 2PCJA 1XZJA 1CUVA 3LXRA 3MWFA 4JC0A 1UFRA 2JCBA 5DM0A 4YP9A 2P7IA 1EQ2A 3H3JA 3L4JA 2CCKA 3UMJA 4RFSA 2ZSHA 3OLVA 2AR7A 2GT1A 3OJEA 4MMZB 3WK8A 2O8EA 2WTMA 2I4IA 2QUHA 1U94A 4EJMA 2FZWA 1W0JA 2BLLA 5KMGA 1PFUA 1JYFA 1UBKS 4QEKA 5COBA 1ZONA 1A5BB 2QRVA 2XKAA 5K3BA 2FJUA 3WWCA 4EG0A 4EHHA 1CJKC 4L75A 4IAOA 3M4JA 2HGZA 3OCCA 4WBSA 2IV2X 2D2IA 3KJZA 4WVLA 1IZYA 3DE0X 1K2WA 3LMKA 5CVJA 3PEFA 4Z2YA 5EHNA 4EO4A 2R84A 5LJIA 1J1UA 4D1YA 4A8TA 3BULA 1NVXQ 3COPA 3EZXA 3RSGA 4Z1MD 4MVYA 4URFA 5DEIA 2QMZA 2WAMA 3LLVA 1PEKE 2GCNA 4TTQA 1VM6A 3A9SA 3VOTA 2Z6QA 2ODWA 3K8QA 3U48A 1F8UA 1DV2A 3DMHA 3P9NA 3TQCA 3RWBA 4ZU1X 4LWQA 5JXIA 5CU7A 4AJJA 5DLYA 3TEJA 1WO8A 1H0RA 3NNDA 3QSGA 1E0KA 1KAGA 2GEBA 4BNDA 4QXMA 3BICA 3EDYA 1H0HA 1JQ3A 1NHGA 2J9FA 2P40A 4JVLA 4MYTA 2I1QA 4CRWB 3LBFA 1NQXA 4MYUA 1Z0UA 3RKSA 5JMTA 4OCZA 2JGNA 1H1LB 5LL6P 4FX5A 1OYVA 2IIPA 4QTXA 4V2IA 3GAAA 1RWBA 2B69A 2QAGB 3IUYA 1OA1A 3QXXA 4LVOA 4I1UA 4DUPA 3K6SA 5AW5A 2I29A 4QPJC 1TZMA 3DDZX 5D5HA 2VUSA 4RD1A 2H2HA 5A4JA 1ZQ1A 2V65A 2ZIXB 3EMVA 1BVHA 2ZGVA 4Z9YA 1W5TA 3I8OA 4LZOA 2XNSA 4D3ZA 4DJEC 3NAMA 1FRNA 2XA9A 4QWMA 1B74A 2GJAA 4AS3A 1DIGA 4R01A 5A3RA 1M5UA 1GADO 2A0FA 1VJ0A 2Q3FA 2WAAA 3GX1A 1H6BA 3ENQA 5FNVB 4ECEA 4C1BA 3PP8A 4HXEB 3G2NA 2VBIA 1PT7A 5E6SA 3OEEA 1D2CA 2UZIR 2WT9A 2HADA 3MVEA 3RARA 1GG9A 2W90A 2EKPA 1Q7RA 4WK2B 5DSXA 3CURA 1T9KA 3IYLW 4PG7A 4YRKA 5CFMA 2PMCA 3DO5A 3VKHA 1MW9X 2HRQA 5G4KB 4H77A 3LRXA 1KAOA 3PX7A 1RYZA 5IKMA 4RKFA 2WSIA 3DAGA 4N5NA 2IYQA 4MKZA 3KKLA 2PXXA 2C29D 2FW9A 3E2MA 2SGEI 1XTKA 4RORA 4M38A 3TO5A 3OQ1A 1MO3A 4I36A 3R9XA 4YRIA 3R3SA 4D6XA 3C43A 4ER6A 3FYTA 1R6UA 3N0WA 4NATA 3TLCA 5FLKA 1RLOA 4EUNA 1G2PA 1YBMA 4QXOA 2CVZA 4YJ3A 1I0LA 3OIWA 4O2BF 5KCMA 3X1XA 4AJLA 1SXPA 4A36A 4RCVA 1Z2IA 1DJLA 4NOLA 2UZ1A 3O93A 1E2MA 2WIFA 2X5KO 4GPEA 4GZ3A 4FVTA 4YT4A 4R8RA 3KLMX 3PQFA 4L6CA 2PH5A 2VJPA 5JZ9A 2RBKA 3V9AA 1MT3A 4DIEA 4WJLA 2QRHA 5DNUA 4AAYA 3G0DA 4AQDA 5GJBA 1PPFI 3C3JA 3GCWA 2HJHA 3BXHA 3WYDA 4UDYX 1RXUA 3CB2A 1R10A 2HRZA 1L8LA 2NO9A 1ZUHA 2V3WA 3GFRA 2OQVA 3TLGA 5DAEA 2XUFA 5DBIA 2A5GA 4OHKA 2L17A 4NWIA 1PK9A 1PD0A 2PY6A 3CBQA 4PANA 5AJZA 1B6SA 4LF8B 3GY0A 5FWNA 3H9CA 2UZ3A 2R7MA 4FONA 2RC6A 3ZHUA 1XRSB 3ZOKA 4BLRA 3ZE0B 3L2OB 5K6AA 5CCBA 4LV8B 4CEJA 5EAIA 2EJCA 5FBHA 1RWPA 3GVXA 3VHLB 1SURA 1O97D 2QG9A 3M82A 4WGFA 2VO1A 1KU6A 4GLLA 5I8WA 2FSUA 1N78A 5CW1A 3VGPA 4ZAZA 2Q8PA 3W9SA 1F2UA 1GEGA 1RMQA 4NV3A 4WNAA 1T26A 2OVOA 1Y4UA 3EMDA 1DBWA 3JQFA 3V1NA 3CZAA 2J0UA 4L4XA 4YRNA 1NBAA 2XMPA 1FFEA 1HT0A 3Q5DA 3V7FA 3WR5A 5JO0A 4KPGA 1PWXA 2O1XA 4QHTA 3TGLA 2CEAA 3UHAA 5CFOA 2FZEA 4UNSA 1CVLA 1S2OA 1BKYA 1NASA 2B78A 1CBUA 2Y1GA 3GGPA 2OZPA 1XALA 3F9CA 3GV0A 4MPTA 3O90A 4JYBA 4LDZA 4PTZA 4ZI3A 5B6IA 1FP1D 3RH0A 2AI2A 2ZPAA 3N53A 1GY8A 3G1UA 1SVOA 3OJOA 3PUJA 2H9IA 3CRW1 2FUG6 2Y2UA 2PSSA 3O2NA 5J2TB 5TARA 2WJ6A 3HLTA 4IVRA 1QMGA 1KHHA 3A10A 5TSDA 4YAIA 3NEYA 4A26A 3A9UA 1N8TA 4S1WA 5MFPA 3PUZA 2JBWA 4L9SA 4GOLD 1HT3A 5LPNA 3I28A 2RBGA 4JUIA 4WQMA 2BEUA 3QXCA 3NOVA 4GECA 4TRRA 1N0IA 1DO0A 1KI4A 3O0DA 3P9SA 3FPSA 3F6RA 2DQYA 4O1MA 2O6LA 3T5CA 1OFVA 1T10A 1SIBE 2WJ3A 3PIIA 4YCJA 3TLEA 3C1OA 1XEWY 2HSWA 5IDQA 1CS0B 3JQ6A 3ZE9A 2ZJYA 5AI8A 2X0JA 1CZKA 3I6BA 3QMVA 5EKXA 3SEKC 1U3VA 1UXGA 3ET5A 2M9MA 4K3VA 5JJIA 1VKRA 1EFKA 5DOZA 3QEBZ 1VXOA 5K3FA 5C34B 2KQUA 2BKLA 2RKOA 1MJNA 4QUIA 5TQ2B 3SIPA 3WB1A 2P9BA 1BAPA 2C5SA 2HK9A 3MGKA 4HAOA 3TR5A 1EGAA 2NTEA 2V7UA 3CLTC 2HHLA 3OUZA 4HNTA 5KPJA 1JN0A 5GV7A 4XGRA 4GI3C 5A02A 3OKFA 4RJIA 3ZHBA 3HKDB 1J22A 3S1SA 5TPZD 2BI8A 2UYQA 2XEXA 1E6UA 2XVZA 3OTWA 3D0QA 1LBHA 2B5WA 1BD4A 1N2CB 1Q0UA 2AN1A 4QLAA 3KTFA 3ORSA 3FCYA 3FRIA 4MI1A 5J1SB 4Z9FA 2ZR8A 1FBNA 1TC1A 1K5DA 3TL2A 4DMRA 2XB2A 2YDYA 4KO3S 3P2OA 4JHLA 4O4JB 3T9AA 2EU8A 4HVCA 4HY3A 2XYQA 1BOFA 1MHPA 4RAQA 4HO1X 1HZZC 2GF9A 3H18A 4B81A 2O4UX 5ALLA 4ZIRA 2JIRA 4IDCA 3R6TA 1EZ4A 1V3TA 1OH8A 2ECQA 2DP4E 3EIXA 2WWWA 3LSYA 4LF4B 1A3CA 3W9BA 1JDVA 2YWFA 2WD9A 4LYDA 5JJLA 4B6PA 4TWBA 2X7XA 3DVRX 2H1CA 3QI2A 4IOKA 4J07A 3IXLA 2XWBF 3QJ5A 2J4DA 2OYCA 2AEEA 4DSTA 3QQ5A 1UM8A 5DXJA 4U5QA 4HR7A 4XWTA 2CWWA 1ZBQA 3HEBA 1ZO8A 2H1LA 4IDHA 3CUTA 3MJEA 2F43B 2G3YA 5F1PA 5JSZA 2Z3ZA 3E3NA 4R2JA 1RJFA 3JS5A 5KOHB 3SZGA 1IK6A 1T34A 4PIPA 3L7NA 2XRZA 5H3CA 3W6UA 4F06A 2QOEA 1N9ZA 4JB0A 4RLFA 2VPZA 3C6ZA 5HQ3B 3HJRA 3WIBA 4LF7B 2FQWA 3NU1A 4YDSA 4HNUA 1G20A 3ZXSA 3HB4X 3RT1A 3ZBQA 2K7FA 1XXHB 5FLYA 4DR4B 1KDTA 4EJFA 2VTEA 1M5RA 2ZREA 2QQDA 1QX3A 5F5NA 3ZQKA 2OFOA 1THTA 3MAJA 3VDNB 4QRDA 1NPYA 1K3TA 2HU7A 2JDID 1EUDB 5FHRA 1U7PA 2MSDB 4ZCRA 5HKAA 2CNKA 2BEUB 1EUZA 2XOEA 3X44A 2BLNA 3VNSA 3RLFA 2O2ZA 2G82A 4KN8A 4YP6A 1QVAA 1T0HB 4EITA 1D5WA 2GZ3A 3ZV6A 1J2RA 2WHPB 3HJUA 5AXBA 1QZ3A 3H04A 3RVOA 3A1VA 1D6MA 1KYYA 4BX8A 4CLOB 1RSZA 3QPDA 1MO4A 2W2MA 3ZTWA 5F3WB 3AGQA 3PS9A 2D8MA 3QX7A 3WGGA 1U2EA 2WE8A 5EZYF 5KYXB 3E9DA 4BMXA 1STOA 3PYMA 1YE5A 3HYNA 4FFOA 1UUFA 1SCJA 4Y2VA 4I5GA 1IJEA 4L0QA 3MZ0A 5FPYA 5G0WA 4LRXA 3DLCA 2JS7A 2ZCVA 3IALA 1QVRA 2XJ9A 1SC1A 2ZUWA 2I3BA 1RNLA 4JODA 1JLSA 1KQNA 1NLYA 1BFDA 3UH0A 3UFBA 3HR7A 4R51A 3ZU3A 2PUTA 4WNIA 3TOBA 4R2MA 2ATCA 2CLLB 3DL4A 4B45A 1RJEA 2OFWA 1P5FA 4PF1A 1H2XA 1XRPA 3Q12A 3DT8A 2XMZA 1CUGA 1ZP6A 3OU2A 2HHCA 3W5HA 4JI8B 3WGYA 2MU1A 1KAEA 4TKZA 3IXQA 1K7FB 3OWHA 3N2IA 4Y9UA 4YJDA 3P5SA 4H7KA 4P4NA 4X84A 4A6EA 1QCYA 1DBPA 1G8FA 2C54A 2HXGA 3CF0A 4X62B 4X0EA 1DKPA 1HZZA 1U1CA 2C9BA 2COKA 5J5AA 4FB5A 4RHUA 5G40A 5C1PA 1Q0RA 4MUIA 3R6LA 3EISA 1XG5A 4BYMA 3LLUA 1FSGA 4Y6QA 1PNVA 5L95A 2P2SA 4CDGA 1I4WA 3B7PA 3QA9A 1EWYA 1XL1A 3EDOA 3FG9A 1ACLA 2PA3A 2Q5FA 5DNCA 4HV4A 4OQMA 3REOA 3LTNC 1HTWA 3DP9A 3IUNA 3ZHZA 1ZNQO 1UC9A 2C20A 5JE8A 3E1SA 1NYLA 4F6LA 3WI7A 4ZI7F 221PA 1C7RA 1HI9A 5IJAA 1X39A 1F06A 2A88A 4KAJA 4K9LA 3C3EA 3M9LA 5REQA 1IG0A 2H2WA 2ROWA 3ONWA 2OO7A 2KW5A 1ONOA 4O4LF 1IMJA 1ZJ6A 3S6JA 3IAS6 4C03A 3X1DA 2Y8EA 3QLEA 1MMFB 5A1JA 4O4LB 2Y6VA 5JI3E 1NQAO 1QGED 4WLFA 1WKVA 1CJSA 4EEXA 3OX1A 4MQUA 4DLUA 5HX7A 3THXA 1D6NA 1USKA 3ONVA 3LZDA 4ARUA 2RIJA 1JA0A 1FLNA 5P8WA 5C8XA 4PX5A 2REOA 3G5LA 1PV2A 4FD2A 4IO0A 4C0WA 4CLEA 3VR6A 1G60A 4BNZA 2G5TA 2GM9A 2G80A 1UJBA 1NF3A 3VU0A 5AW6A 4PR0A 4CUZA 3HFSA 1I1NA 1QKIA 2C4UA 3NI2A 4KXMA 2XNHA 1MRNA 3QOWA 3SDSA 3RADC 1U28A 3V48A 1B1AA 2Q3MA 4BZXA 1U0FA 5JNLA 4HDSA 2BDTA 1ZA1A 4JLMA 5MN6A 2H5LA 4ITUA 1SXJB 3D54D 2XMDA 3KC2A 5A4KA 2O5CA 1NBMD 1IN1A 1C9YA 4TSKA 1YQ9A 2R6AA 2A1UA 4MJLA 3BIJA 3MJSA 821PA 3KT6A 4DC1A 5CMLA 2QY9A 3I62A 4D42A 1KQPA 3AU9A 2F9FA 3U13A 4DMGA 2GAFA 3EIHA 2QTRA 3ANNA 3BH0A 3HU3A 3JXEA 1YU9A 5DTEA 1GRQA 3KKMA 1KY2A 1PCEA 5WRFA 3A70A 5JQGA 2B1GA 2VN8A 3GDOA 1T4CB 2QTCA 3GRVA 1Q5PA 2ZULA 1ZCBA 3KQWA 4CM6A 4H1WA 5KWEA 4PPGA 3HRKA 3X1KA 1C3VA 2GFIA 3VYRB 4KIFA 4Y2QA 4XKJA 3KVRA 3T38A 4BB0A 3MOGA 2V7QD 1T0UA 3EAFA 5D51S 3C5VA 1TQ2A 1CX9B 4XVRA 3ZWVA 5CB4F 1CUAA 1G20E 1MZVA 2HF9A 2OL4A 1O6ZA 4JJGA 3A1DA 4BJ3A 4UZSA 3RU2A 1VA4A 2IGTA 4IHJA 4B3HA 2HCJB 4JJ4A 4FS3A 5ALJA 1EHCA 1MV8A 3PRHA 1EZZA 1RWMA 1Y7HA 4UDNA 3ZCTA 4DPKA 3EUEA 5HZKA 3ADPA 3BT7A 3H1TA 3TDKA 3I9OA 5L7YA 5LZ4A 2VHQA 3IC5A 3C6BA 4RS3A 2H7XA 1JQBA 1LX6A 2D7JA 2PLFA 2C5EA 3MOIA 3UT6A 2D7DA 1FX0A 1MIOA 4KN9S 4IIXA 3GEDA 4M1KA 3OZXA 1QZTA 4HGQA 1BXGB 4JVSB 3CNOA 3INRA 2FA9A 1U6KA 1K7SN 3P71T 2PFSA 4M0LA 3RK0A 5DGCA 1R5OA 2I7TA 1O9BA 3I1YA 1NXPA 3HGQA 3O95A 2XUGA 4JSYA 1FS6A 4A9AA 4EVQA 4IFTA 1NAIA 3PCTA 1W4RA 2Q6LA 4YROA 3N2LA 1XFAA 1VYHA 4BP9A 4EKDA 4CEIA 1Q1QA 2D5CA 5JAMA 1XAGA 2XDQA 3B3FA 1BCSB 4JITA 1QYXA 3MB5A 2JKYA 1X1RA 2YZ2A 2QSZA 3EW7A 4JGBA 5JJ5A 5TQ0B 3W4IA 4M54A 5LP6F 3WNBA 1OYVI 1LFDB 3AR3A 3A11A 2IPOA 2AZ4A 4NEHB 3U3KA 3A0UA 5E4FA 1J70A 4YAFA 4BKRA 2WZBA 1CUZA 1DEOA 3M5DA 4OB7A 1GKKA 2OGTA 5CFQA 4FWTA 5TLSA 3BREA 3KOYA 1FRZA 2VXYA 4DR5B 1YAHA 4BLPA 1W6RA 1NYRA 2JAPA 3ZNOA 3I2KA 4FZJA 4Y1RB 2QAIA 2WIJA 3PHCA 4Q37A 3E3MA 3IBGA 3V3KA 1P31A 2F1JA 3V8PA 1VJ5A 3VOSA 3LBHA 2HBYA 5EKUA 1ADFA 5BV1A 1P9LA 1YA8A 4W6ZA 1KEEB 1XN1A 3TIXB 2FEAA 4BV9A 2IYVA 4XWKA 4MPJA 1RKXA 4L2IA 1KTVA 4UUMA 4ARSA 5K0ZA 1JIXA 4BQFA 1Y48E 5JCZA 2MINA 2ZUSA 3MXTA 4C4RA 4D74A 1Z62A 1Y3FE 5AOAA 3GRAA 2AQKA 1GPNA 4B4DA 2NZYA 4Q16A 3VYSB 3G6WA 4AECA 4CQMB 1T3LA 2Q3DA 4YRMA 4NOKA 4IZOA 4CF7A 1MRZA 1CT2I 1U28C 5IK2D 1YS6A 1Y4ZA 3HU5A 5BMVF 1FA9A 3L06A 1XAHA 5LJLA 4ZQEA 4ILKA 2SGPI 4CV3A 4G1FA 2W7TA 4ZAGA 3B3AA 3ZDQA 1U8UA 2ZR0A 3A6LA 3E7XA 4CODB 4OFXA 1K9VF 3KJQA 1RLMA 3DXFA 4TL6A 3Q87B 3V34A 1C7FA 3O2JA 1U81A 3VU1A 5F2NA 1JUDA 3BAFA 4Z51A 3I2GA 3TKAA 3T1TA 1GPMA 2EL7A 2QA5A 2C3UA 1O77A 3PITA 4JL6A 4K6FA 4JJ7A 5CW2A 3AETB 5CDTA 2ERCA 3OBIA 4N1AA 3X2FA 5F7XA 2V7GA 2JJYA 3ICVA 5JBQA 1YKSA 3D4OA 4R41A 3PL5A 1U0BB 1ZN7A 1U7DA 4G2TA 5I8PA 1AN0A 1IY6A 1FYFA 3DMNA 2YIDA 3IMKA 3VR3D 3HY3A 2KI5A 1MIOB 1G2IA 5AI5A 2WIGA 5E8RA 1PQ4A 2GHRA 4C78A 3FCUB 3NDIA 1MB0A 1SU6A 1WXEA 3EYAA 1C0EA 1FTNA 3L7OA 1V47A 2FEWB 3TE6A 1YTPA 1M2KA 2W42A 4Q3AA 1XAIA 3O75A 4LSZA 4KQIA 5HJ2A 3WQSB 1I94B 4AN4A 2ZPTX 3H6GA 1P9ZA 1TCBA 3MQ2A 3QWAA 5FOTA 1UADA 5D7NA 4BO7A 3FZEA 3ED5A 1ULAA 2Y2VA 2ZIGA 4G8CA 5FNZA 1X2EA 4GZMA 2R8BA 3GJRA 4BVHA 4D92A 3L8CA 4DLRA 4IXNA 2ZG6A 1DMRA 2WM2A 3V4ZA 4DQ0A 1XTIA 4JCVE 3JAWA 4J43A 2CKMA 4FMDB 3BQ9A 4BBZA 2ZRLA 3RO7A 1SUDA 4QPDA 3TVDA 1BIFA 3M1LA 4CKCA 4HX2A 4N40A 5AVWA 1EK1A 4LFCB 1WMBA 4WN9B 1TQDA 4DSOA 3DT9A 3GA5A 5LBIA 3GXOA 5FA8A 4V1CA 1H93A 2WWHA 2GD6A 4RBNA 8OHMA 4YTEA 4AJHA 1M2NA 4I0WB 3RTBA 3LVRE 3E8MA 4CEJB 1QM5A 1WNTA 2BF7A 2DFKB 2X0IA 4K87A 4PBRA 1VLLA 1QOQB 1KDPA 4CKWA 2H0AA 2JGDB 4Y2SA 1ZWKA 2JKZA 3IELA 4O02B 1Q92A 3BFXA 4WSOA 3SF8A 4HAUA 3VBCA 2VFAA 4E94A 3IDSA 2B5VA 1MA0A 3I9FA 4BUZA 5M34A 4LTDA 3AKCA 5C1IA 3GZNB 5BUQA 4MVCA 3IP8A 1X8KA 1JG2A 1FYDA 5D86A 2IXEA 4ETIA 2AVDA 1VPEA 4BVBA 3ENVA 1U9ZA 4HH4A 1OXBB 2HL6A 3DMTA 4Y2UA 1MUUA 3VKGA 5JBIA 4HQKA 2V3CC 4TLBA 1GCUA 3NX4A 4HDNA 1E3JA 4C08A 1RJ9A 4MS3B 4MDHA 2F3TA 3WNCA 4MDFA 1LB1B 3I2JA 3AR4A 4EO9A 3JSAA 4H4CA 2GZ2A 1N0WA 1EVIA 5CP8A 2FLWA 2O50A 2TMDA 3BHMA 1QHHA 3QELB 1XK7A 4UATA 4WD3A 4EECA 1P4RA 5ENZA 3ABSB 2X2PA 3BCHA 1YRAA 1H5UA 1Y82A 3WMXA 4RSMA 1CRLA 1EXMA 5KVAA 4KWTA 3FH0A 4QL3A 3S1AB 5C7YA 4JDPA 5FUQA 4XASA 1N5IA 5H1YA 4PG8A 1VIMA 4CU2A 4PEVA 2WCYA 2NO7A 1B0AA 1RHUA 2PUWA 5H80A 5KHOC 1CRPA 4DG5A 4RESA 2GVDC 3T3EA 4KJXA 5DEOA 5KSZA 4L8FA 4S0XA 5E3IA 4AY5A 3PKJA 1U7XA 2NUBA 4Z1MA 4DR1B 1YWGO 3ASVA 1MAHA 4AJ4A 2O8BA 3B6JA 5K3FB 1DRUA 1T8RA 4Z99A 3PU6A 1QTQA 4EHDA 5A4AA 5MHTA 2CNDA 2C9OA 4YCLA 3GH1A 1ZESA 1HOTA 5C4MA 1F3OA 3QVKA 4KXFB 4I6JA 2XGJA 5AVTA 1XL0A 5GTDA 4R69A 2HJSA 4B4WA 5L7TA 2JFFA 3EGCA 3JWHA 1IH8A 1UK9A 3PICA 4DLLA 3SS7X 5JYCA 1W0JD 1XE3A 4ZN6A 2GD1O 3RODA 3DVQX 1OVMA 2YBEA