5FUXA

Catalytic domain of thymidine kinase from trypanosoma brucei with dtmp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
182
structure length
168
Chain Sequence
AHGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTGDTLTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 55
structure length 168
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuxA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuxA01
3BB4A 2CVFA 4E09A 2C9OA 5HCNA 3BH0A 2ZUBA 1IN6A 3AF2A 3C15C 3QKSA 1XEXB 3K09A 5EXXA 2QGNA 3QPUA 1QHXA 2KI5A 1UJ2A 3NBFA 4PC7A 4E03A 2VP0A 4D0NA 3V4FA 1OSNA 2NQ2C 3SE0A 1TF5A 2ZU6A 3VKWA 4A8JA 5FTMA 1N5KA 1TQ4A 1N6PA 2J5XA 1B23P 2VHQA 1CULC 3ZVRA 2IS4A 3NBXX 2B21A 2GZDA 1T3HA 1NG9A 3Q8XB 4QBFA 4HUQB 4YONB 1Z6YA 3SJCA 2ZROA 5JJIA 4Q1FA 3IEUA 5DH9A 2OAQ1 1SVMA 4NCIA 1JECA 1AS2A 2P67A 1H8EA 5JFGA 4JYCA 4DJTA 3RSOA 5B2ZA 3GFOA 1VPLA 4KITB 4N0EA 3I73A 4UNNA 1CEEA 2YJTD 2EWWA 1X1SA 2BVNA 4PC3A 4QG7A 3WP0A 1I4TD 4RZ3A 4MGIR 2QORA 2GNOA 4O25A 1T5IA 3EC2A 2JEOA 3R7WA 2BC9A 1X8KA 1ZC3A 1M7BA 1XWIA 3BK7A 4IOMA 2GVDC 4G3XA 1Z3IX 3U44B 2ZU0C 4ZIRA 3WMEA 3OFNA 1Q3HA 2PH1A 5M04A 1H8ED 4FXPA 3CXLA 4WZAE 5D3MA 1JB1A 2QAJA 4JBXA 5AUNB 1GUAA 2ZRBA 1Z0DA 4CT5A 2GILA 2J7PA 4IDHA 4RVCA 5AUQA 1ZINA 3O8DA 4ZDKA 2ZPTX 1GILA 4D4MA 3LV8A 4NYMR 2JLYA 5FPKA 1TX4B 2VRWB 2ODBA 4M22A 1U2RA 3UKDA 1AJEA 4MYUA 2XZOA 4GP6A 5TMPA 1IXRC 1EWRA 3CB4A 1R8SA 3THWB 1DPFA 3T34A 4PFSA 5DNYB 3FHTA 3FVQA 1ODFA 1R0XA 2ZRKA 3L8YA 1SHZA 2ODNA 2GEDA 4Q7JB 5BN4A 1P2UA 2Q21A 4MH0R 3SBDA 3H0KA 1W0JA 4MDFA 3K1JA 1E9BA 3B13B 3L43A 3WHKA 2G6BA 1QF9A 3B1WA 1HV8A 4FW9A 3VU9B 1M34E 4NDZA 3U4QB 2OLKA 4TMZA 1EESA 1CJTC 1JXMA 1YRBA 8OHMA 4IOJA 3ETLA 1XEXA 5FTJA 5F98A 1XJCA 4HAWA 3CWQA 3DEFA 1U0JA 4PR0A 2ZM5A 1VYVA 3RAPR 3QBVA 1DAGA 1G3RA 2J7KA 3GEEA 1EGAA 3THOA 3TSOA 3DVLA 4NTZA 1IN5A 5DYIA 4MKFA 1R7RA 2OFXA 4M2LA 4HUQA 1E2NA 4NH0A 3W6NA 1P7CA 2CLSA 1W0JD 4M8NE 2IS2A 5IK2A 1J7KA 3RDPA 2V6JA 5H1YA 1XTKA 5F9FA 4PZZA 2P5SA 1RRFA 3A8TA 4IVQA 1X3SA 1S9DA 4HZUB 1ZNZA 4PAOA 2GESA 4LK2A 1UFQA 3VX3A 4DWJA 3L8ZA 3B8HA 2IF0A 4HZIA 3LQRA 5ANRB 4V0ME 2JATA 1W2GA 1GRQA 1ZRHA 1FQKA 3TUIC 4FIDA 3ZDQA 4KFRA 1CJUC 4C0BA 1VIYA 3WMGA 4Q9LA 3GJ8A 1YKSA 1A7JA 1DBSA 1GP2A 1ZU4A 2V6IA 2XTZA 3DL0A 4GMXA 4QHSA 5IK2D 4LI0A 5KDDA 4OKSA 3ADCA 2FEMA 5JSZB 2QSZA 5IDVA 3N5CA 2WOOA 3RVBA 3U5ZB 2VIIA 2Z6VA 5HZHA 3OEEA 2R6FA 3VR1A 1MOZA 3KUCA 4OHWA 4R2HA 421PA 4HATA 4BE7B 3TIFA 3UWOA 2VRWA 3QXXA 4AIIA 4C0KA 2J9RA 1WE2A 2YYZA 3LD9A 5IRCD 1MRNA 3A1TA 1YVDA 4N3NA 1XB2A 1G4AE 1LNZA 2ZREA 4I81A 2QMOA 3RC3A 2IWRA 4LJ4A 1PZNA 3ZQ6A 2AK3A 3THWA 3CPEA 2BJVA 4MYCA 3LXXA 2LCFA 2ASEA 2IC5A 4KO8A 3THXB 2ZRGA 1OHHA 5EZ6B 2IT1A 4DSUA 1OFIA 5HTKA 1IM2A 4JMPA 1ZYUA 1RFLA 4WIAA 2R2AA 2CE2X 4Q66C 5KSPA 3FMOB 4OQMA 3OEED 4F93B 2ZSFA 3QJYA 4OI0A 2QMEA 4CGZA 3VU9A 1RVDA 2O8DB 2OUKA 3U4QA 1IHUA 2WZQA 3CKLA 4BFTA 4HAVA 4BQSA 3KUDA 2BWJA 3GLHE 3NWJA 3WYGA 4NZYA 5KDOA 1KZ7B 1Q12A 4O2RA 4XOIA 2AKYA 3GJ7A 1GFIA 5FR2A 4UQOA 5JRZA 3SHWA 3CM0A 1ZAKA 3JVVA 1E1RA 3K53A 3I5XA 4MDEA 2QEQA 3OIYA 521PA 1BH2A 1OHHD 1VCIA 2C98A 4BFWA 4PAQA 4D0LB 4M1WA 4OQXA 4BZXA 3EA0A 1LV7A 3KZ1E 2Z83A 3IQWA 3AKEA 5K8TA 3KDSE 3CX6A 3T06B 4FKDA 3SQWA 3B7GA 4D26A 2RGXA 1PUJA 3B2EA 1KJZA 4II7A 1Q21A 3MD0A 2P6NA 5AWFC 2IS1A 3X2SA 3OAAA 1Z0KA 3EASA 4E5UA 3NHAA 5E7MA 1UDXA 1VHLA 4HZUA 1TL7C 4PC6A 4QKQA 2D7CA 4ZDWA 3HYRA 2QE7A 2JAQA 5UKDA 1E9SA 3I5YA 4LUCA 2H57A 3CR8A 5FH9A 3SHFA 4FCWA 3UANA 3U7EB 3IKJA 1BIFA 2BBWA 4J0QA 3B1ZA 3K9GA 4KHZA 4ACAA 1R6BX 3W3ZB 3KTAB 3ECCA 2BMFA 1GRRA 2ANBA 4TL6A 4AYXA 2BV3A 1N6HA 3AGQA 1NY6A 4NCJA 4LOAA 5JWOA 4H1VA 4BGDA 2IYTA 3P4XA 5B57C 2UKDA 4KJZA 4NCHA 4ZO4A 4LRWA 5JSZA 2WHXA 3OAAD 3UMRA 4LGMA 4Q18A 4GP7A 3QEOA 1OXVA 2F3TA 2EQBA 1KO1A 2QE7D 2VEDA 1WXQA 3LBNA 4PHGA 1FTSA 2OAP1 1OB2A 1N0UA 4US2R 5KNDA 2PZGA 1HT1E 1N0WA 4Q21A 4AKGA 1XTIA 2Q3HA 2O0HA 1GL6A 3EPLA 4B3XA 3DZ8A 4R7ZA 1G19A 4WW0A 2GZHA 3BB1A 3PCRB 5FBLB 1G3UA 2GTPA 5H8WA 5AJYA 1DOAA 2XEXA 3AVOA 1U94A 2OE2A 1D6JA 1JI0A 5CDFE 5JCZA 1G5PA 4V0KA 4F4JA 3V4RA 3THXA 2G3YA 2GAOA 3CW2A 4LPSA 1E0SA 1EFUA 5AJZA 2EFGA 5GJBA 4AYTA 4G5RA 2J0QA 4LHXA 4AY2A 1TQ2A 2PCJA 3IIKA 1N6LA 3MJRA 1M6NA 3EZ7A 5LPNA 2O8DA 3I3SR 4HAXA 4GMDA 5FTNA 4MRNA 5FUVA 1MH1A 4LYAA 1JXOA 3NEJA 3FDIA 5CJPA 1TF7A 3LVRE 1W46A 1AGPA 2FSFA 3QKTA 4CVNA 2GCPA 4NKRA 2HV8A 1HEIA 1EFRA 1OE0A 3I32A 5FL7A 1Z29A 5JZVA 1W4BA 1XRJA 4PX9A 3TE6A 3RRYA 4MKIA 3TUJC 2F1JA 1Q1EA 3RC8A 3T1VA 1E2IA 1Z6XA 4A36A 2JLSA 4B3BA 2QRZA 5EP4A 2IUUA 1G7RA 4JT2A 2WVJA 1AIPA 2C5LA 4G5QA 1Z0FA 5FBRB 3IHWA 4WZBE 2WJVA 2AXNA 1JNYA 1FPMA 2WWGA 4HB4A 5EE5B 4HEJA 2OBNA 2WIBA 3NDBB 4M4SA 1KI6B 2IEYA 5DIFA 5DN6D 4XIGS 3IHLA 4F4CA 4U7DA 2Z5FA 1EFRD 3KTAA 4QGGA 1MO6A 2ENNA 1DTSA 4FWIB 5FL7D 3TVTA 2G1KA 1AKEA 2WWIA 1G8YA 4MGKR 5CM8B 1OXTA 4DCVA 2A5JA 3C16C 1TAGA 1P75A 4RD3A 2YOFA 4CZ2A 3GLHB 3QEJA 3QQ5A 3ZIAA 1CJVC 2B8WA 3KKQA 4P4SB 3UFFA 4Q4LA 2CLCX 3A6PC 3QXHA 2VF8A 4JL8A 2PLFA 4G0NA 1P6XA 1XJQA 1QHIA 4RZUA 2GXAA 2ZANA 5E3HA 5FOXA 1MO4A 4M1YA 4L15A 1GM5A 1LB1B 2F9LA 2B8TA 3EW9A 2OFWA 1F3OA 4KVGA 4JS0A 4XH9B 4JJZA 1UBFA 1G8HA 4F92B 3G5UA 3U7GA 4IDQA 4JL5A 2D7DA 1XEWY 5JLJA 3BERA 3ZZ0A 1KOFA 2YWFA 1OFHA 4KBFA 4W5JA 3MJHA 3A4NA 4XTRA 4HLCA 5EXSA 3ZIAD 1KI1A 2ODWA 2RMKA 1N3BA 4YDSA 5FI1B 5JWHA 3ZH9B 1SVOA 1G291 3E5HA 2D4HA 2PZFA 2NO7A 5EE0A 1SKQA 1ZUIA 2DB3A 1II9A 1S0UA 2W2TA 3OZXA 4C9BA 4DLXA 2D2FA 2F1RA 3AVWA 1AZTA 1NN0A 3CRRA 2F9MA 3HPRA 4DDTA 5JS8A 4ACBA 5KU1A 1C9KA 1J8YF 1G64A 1P9RA 1PLLA 1RYFA 3CX8A 1F2TB 3PENA 4Q9HA 1OT3A 3EARA 2FG5A 1CR1A 4Z1MD 2IYXA 2IX3A 4A2WA 5B64A 3QG1A 4ESVA 3T12A 1L4YA 1XMSA 2HF9A 2RGNA 2ZJBA 1XPOA 4URYR 4G1UC 2WMOB 3F3YA 4PHFA 1J90A 3DDCA 4FI3C 2WJHA 4XWKA 1VKJA 1W0KA 1XTSA 4NL4H 3TAUA 5L8VA 1PJRA 2QPOA 4XTCS 1TQ6A 4RD2A 3REFA 3GLFE 2MSEB 1G9XA 1SVLA 2RHDA 4UNSA 2ZRHA 4C7OB 3I8XA 2WWXA 3FE2A 1ZIPA 3U3JA 2JJ1A 3P4YA 1TEVA 5DSZA 2CCKA 3KKPA 4YC7A 4FMCF 5C18A 4CDGA 2P5TB 1KI4A 1DO2A 4QNMA 3CR7A 4PQRA 4MGYR 3U7HB 2EVWX 1AGRA 3B78A 1TPZA 3Q3JB 4ON9A 4I1SA 4JLOA 4TWZA 1XCPA 1LTQA 5FOWA 2QL6A 2D06A 1S8FA 3TLXA 1D9XA 5HE9A 1E2JA 2QROA 2H1LA 3X1WA 3CIOA 2OEPA 1KI6A 1G18A 2AN9A 1GVNB 3VQTA 2GVZC 1E99A 1W0KD 1TNDA 2K5UA 2FF7A 2ZSBA 2YC2C 2OHFA 2ZEJA 3MCAA 1ESMA 1UM8A 2OCYC 2FE4A 3TSWA 2JJ1D 3TW8B 1NJGA 3GMTA 3GLHA 1NBME 3OESA 3VTKA 1GWNA 4QHTA 4Q19A 3LLUA 2WTUA 3EWSA 4P4SA 3CONA 3NIBA 1RFHA 2HLDA 2O52A 3IO3A 2JLXA 1JR3D 2EWVA 1KMHB 3AP2A 2D3WA 4RSGA 4MRPA 3RWOA 5SZHB 4KV9A 4U5XA 2ZITA 5DHFA 1JEDA 1TMKA 5FI0B 1GTVA 3PITA 2C9CA 1P9WA 1YQTA 4XSHA 1OH5A 4LJAA 2VP2A 3TQFA 5FUYA 2BOVA 3NEYA 1AS0A 1GDDA 3ZVMA 1HURA 1UEJA 1L2TA 2VP4A 4QGAA 1BYUA 3BE4A 2KBEA 1FQJA 2ZE6A 2RKOA 3F0TA 3I61A 2W58A 2XAUA 3P1JA 1UKYA 5J47A 2HLDD 1O87A 4TYYA 2E1RA 5JEEA 2W6IA 3I92A 3AUXA 2ZYTX 2GEVA 2CK3A 4HLUC 4GOXA 1LF0A 2XSZA 3DKVA 3UATA 2LKCA 3DM9B 3IBYA 3UEJA 1F2TA 3ZZUA 1E2KA 3E1SA 4TMWA 3UG7A 1N25A 1OFTA 1FAQA 1E69A 2C96A 1E2QA 3EIQA 2TMKA 4B6DA 2ONJA 2GBLC 4B76A 1E2PA 3KJHA 4EQ6B 2VO1A 5IF9A 3H4MA 3UIEA 1G7CA 4I1VA 2J59A 1CLUA 2Q9CA 2CXXA 4R2IA 3RYTC 2V55B 4US1R 4HLDA 3AQ4A 1I2MA 1S1MA 3IDQA 3IUYA 4DIEA 1BS1A 4LBZA 5KNCA 1G1MA 2W6ID 2VSOA 4NP6A 4NPHA 1QG4A 5KSOA 2CK3D 3U2QA 1DAKA 5HZKA 4XJXA 5EZ5A 4C7OA 4DRZA 1W4AA 2XSZD 3T5DA 2QZ4A 3LXRA 1FW6A 1HTWA 4KBGA 3VKGA 1S3SA 1HH4A 4UXHA 1MABB 1P9NA 2RAPA 4LBVA 4BFYA 4A15A 1CXZA 2MSDB 3QF7A 2B6HA 4QHYA 1SGWA 1XMJA 1CJKC 3C14C 2NO6A 5AR1A 4AK9A 2CMKA 2WSSA 3TH5A 5CB6A 1R8QA 3NXSA 1JJ7A 5G3YA 2ZRMA 1YZGA 2E9SA 2H5EA 1ZUNB 1BO6A 3RWMB 4Q47A 4UKDA 3IIJA 2IBMA 2LWIA 2W2XA 1N6OA 1A82A 3IPYA 3SS8A 1GKUB 3EIHA 4LHZA 4IOLA 2ZETA 4KLZA 4PHHA 1AZSC 1GKYA 1E3MA 3MWLA 4JSYA 5P21A 1W4CA 2FZ4A 2QP3A 2JGNA 3AH8A 2BEKA 2REOA 1VG9B 1II8B 1NRJB 2ZRNA 2BM0A 3Q7QA 2GXUA 4O2LA 1DG1G 4TTQA 1UBCA 4BFUA 3QNUA 1KMHA 2WSSD 1MRSA 2YNMA 4B73A 1E2DA 2QP9X 4LJ8A 3VX4A 4DSOA 3AKYA 2BIFA 4DLUA 5FBVB 5EUQB 3N70A 3SI7A 4TYPA 2QU8A 3M6AA 1W5SA 3MAAC 4OHXA 1OFUX 2XNSA 1LVGA 2JDIA 2L0XA 5GJWC 1HE1C 3EZ9A 2XXAB 4ASUA 3AM1A 4M9QA 1YR9A 3SJBA 1E0KA 3WHLA 4GNKA 3ZD6A 5JI2E 3W5JA 3ADKA 2AXPA 3TRFA 4JVLA 1U98A 3B82A 1OF1A 4DDUA 3K0AB 1ZVQA 2CL0X 1A5TA 1E9CA 4OI1A 2IYSA 1CBUA 1FX0B 2ZI9A 3FKSA 3OE7A 4JBWA 2IYQA 4PZYA 1Y3AA 4A92A 5C4GB 3SN6A 3K9LA 4HB2A 1XTRA 2WIAA 5J5CA 3NC0C 1TTTA 2KE5A 1YU9A 4EQ6A 2JDID 4BLOA 1D8TA 2DFKB 2Z4SA 3ZQJA 1KI3A 1WRBA 1NVUQ 2GK6A 2Q6TA 4ASUD 2OLJA 5J4HA 3LH5A 1IJEA 4LBWA 2HJVA 3VNUA 3G82C 3NHBA 1DAIA 3ONWA 1L4UA 2IYZA 1N2CE 2VHTA 4L5BA 3CF6R 1UKZA 4Z54A 4A82A 3T35A 2SHKA 3LFUA 1S2MA 4I1UA 1D2MA 3AV0B 4URZR 5BXQC 1ZM7A 1MABA 1W1WA 2R8RA 3EG5A 3FKSD 1ZNXA 3OE7D 4M9XA 2GJ8A 2Y8EA 1Z28A 2C8VA 3EX7C 4DSNA 2F43B 5E95A 2GBLA 2V9PA 4FD2A 3W6PA 5JWRA 4EPYA 1XBTA 4KSCA 1JEEA 1AQYA 4I1OA 5KPJA 1A2BA 4XWOA 1G3IA 2GF9A 4WZ6A 5GJCA 2ATVA 1VIAA 2ZIAA 1XDBA 1HA3A 2ZI6A 4MUAA 1NVXQ 1PUIA 4QFMA 4LBYA 1KDRA 1J70A 2IWHA 2QY9A 4LWZA 4P4UA 2OSBA 1P5ZB 1SXJE 2R62A 4URXR 2ZRCA 1II8A 3C4JA 1WF3A 4ITRC 1U8ZA 2VHJA 2AKAB 3AEZA 4B3GA 4Q03A 1IY0A 1W4RA 3FFAA 3OFND 3PJRA 1SVIA 3DPUA 5FBQB 4D25A 4XWAA 3KKOA 4M1SA 2ZJ2A 4U02A 2GXSA 1TEXA 5FBWB 2J7PD 2G1JA 4MA4A 4PSVA 2IYLD 2IXGA 4OK5A 2RHMA 1VECA 2JLUA 1ZM4A 4X8OA 3LBHA 1JPJA 1DAFA 3BIFA 4HSEA 4AD8A 2OCPA 3SNHA 1Q1BA 4BFSA 1OB5A 2XGJA 1NJFA 2XXAA 1IBRA 1JQLB 4PHTA 2IXFA 5B30A 1FMLA 5TY0A 2AD1A 2BEJA 3SBEA 1XXHB 1E2EA 4M21A 2ZS8A 1U8AA 3O8BA 3R9WA 3MG9A 2VYFA 3SEAA 1M7GA 2ENZA 2W00A 4JLJA 4QJ3A 5GADl 1WBDA 4PANA 2AK2A 3PIRA 3K0AA 1EG7A 4IEIA 3JVUA 2CHGA 5GJVC 4KSBA 4R98A 2CVHA 4TL8A 1G21E 1FX0A 2Z43A 2G0NA 4RY2A 3PUWA 1P2TA 1VCMA 4Q02A 4OYHA 4XVRA 4TZ6A 1P61B 1ZD9A 3QKRB 3CH4B 3PEVA 4TLCA 4PO8A 1A4RA 4PC1A 3B1XA 2F1IA 4TMVA 4LJ5A 1VHTA 4BLPA 1SKYE 3H86A 2W0SA 2CL7X 1P73A 2BBOA 4MRSA 2FFAA 2ZVQX 3HDTA 1AKYA 3Q5DA 1KIMA 2XTMA 4PPFA 1E2FA 3SU8A 3QENA 5K8LA 4QBHA 1OIVA 2A30A 2VQSA 3HP1A 1VCNA 4HAZA 2G88A 1RRPA 1P2VA 2J0VA 1QHHB 4LHYA 4NYJQ 2P3SA 4PO1A 2F43A 3CRW1 4YMWA 1KK2A 1KKMA 1QHYA 5AJXA 5E4FA 4LHVA 1KTVA 3UMSA 4UNPA 1G5TA 2O8EB 1NMYA 2GJAA 3RLFA 3GLIE 1RPZA 5JJLA 1GNPA 4EPXA 2QM7A 2IYYA 1OJLA 2VF7A 5DI3B 3CZQA 4RD1A 2WMNB 4FMCB 4RKFA 1US8B 3I4LA 3NTUA 4KYUA 5SZIA 1KY3A 3JZMA 3TUZC 3K0CC 1KO5A 3UEYA 1E96A 2R65A 1QVAA 4GDFA 5F3WB 2QTFA 3U3OA 1HE8B 1NN1A 2A78A 2C99A 2J87A 4A9AA 1DEKA 4M1OA 1N5IA 1N6NA 5ELXA 3AKDA 3FMIA 4JKIA 3T5GA 4L9SA 2ZJYA 2PMKA 2PJRA 3BORA 4QJ5A 5H70A 4JIMA 3B9QA 2IYUA 4EPWA 3UPUA 2FPKA 5C4MA 5AUOB 2EFEB 1KK1A 3NVAA 1GZSA 1T8UA 3THYB 3UG6A 3K70C 1UBEA 3AF3A 1G3QA 2F3RA 2WSMA 1XEFA 3P32A 4LC0A 3BGWA 3BJIC 2HT6A 1MV5A 4UJ3A 2YINC 3TBKA 3E2IA 3L0PA 3LBIA 3AF1A 1V5WA 1XXHA 4MYHA 2DCUA 1KYIA 2QT1A 2YC4C 1KY2A 3DO6A 4FMBB 4NCKA 3QXSA 2CCJA 3CO5A 1IY1A 5KDLA 3U7FB 1Q1ZA 2C95A 1E6CA 3M1IA 1FP6A 2H18A 3D8BA 2RGEA 2ZS9A 3F8TA 4DKXA 5D3QA 4AYWA 3C5HA 2FH5B 5FFMA 2PEYA 4LX0A 2JJ8A 2ZRIA 1NVVQ 2IUTA 3QKRA 4RFVA 4P33A 4ZI3A 2WAXA 1KBEA 1HYQA 3KQHA 1R2QA 1SVSA 2ZUDA 3X1ZA 2O8FB 1D2NA 1OIXA 3MWYW 4W9MC 1JBKA 1Z0IA 4JZKA 1E1RD 2XZLA 2I1QA 2IYVA 3CUEF 2V4ZA 1Z47A 2FPMA 3QSYA 3ICQB 5BN3A 3WYAA 2QMHA 1KHTA 4IXNA 4Q1CA 3RRNA 2AX4A 3SOPA 2ZVPX 3D7MA 2ERXA 1SVWA 2NPFA 4Q4JB 1QHHA 2DFLA 3CH5A 1KO4A 2XITA 4TLEA 5EXTA 4EFLA 4IW3B 4QGHA 1YHNA 2EU8A 2DHRA 1GL7A 1E98A 2AWOA 3TR5A 2O8EA 2Z4RA 2JASA 4MRVA 2GCNA 2VH5R 1MKYA 3FGNA 2HYIC 2FOLA 2QPAA 2J46A 4ZKEA 3KXIA 3QVUA 5DI3A 4DEYA 2Q3MA 4W7SA 1P2SA 2PT5A 5H68A 3CRVA 1US8A 5L3SB 3KX2A 2DFNA 1F5NA 4BLTA 3BFVA 1TU3A 4RKEA 1RC8A 1Z2AA 4TQAA 2C2HA 4Q1EA 3VNVA 2WBLC 5BW8A 2R6GA 2NG1A 1KNQA 2MMGA 3KXLA 2R44A 5FOTA 1UF9A 1OXXK 1LW7A 2DPXA 3FYHA 1R5OA 3IQXA 4BFXA 3CX7A 1VG1A 2QTVB 1SKYB 2ZRAA 4F4IA 2HXYA 3KFXA 1WQ1R 3THYA 1ANKA 2ORIA 2WKPA 3FMFA 3UMFA 4P0TA 4Z51A 3GLGE 4D82A 4FCVA 1IXSB 1GL9B 2RGAA 4DLYA 1QRAA 1E0JA 3V00A 2HEIA 3FB4A 4Q7MB 1NVVR 1O3YA 1CKEA 3Q7PA 1AS3A 4C4PA 3RS5A 1CTQA 4D2IA 1IAQA 2HJGA 2JLVA 1IJFA 2R6CA 1NY5A 2RH5A 4TMXA 1UAAA 1H8HA 1W5TA 2OCAA 2OG2A 1MO5A 2PZEA 4Q1DA 4ZCLA 1KI8A 2AD5A 4O3MA 4LV6A 1OW3B 1JAIA 3RSLA 3T1TA 1DARA 1KAGA 1P3JA 4KU4A 1CIPA 4JLAA 4R71A 3LNCA 4L4UA 1XTJA 3BJIA 3TKLA 2O8FA 2V8OA 2G77B 3GCGA 4IDNA 5JECA 3EPHA 1WB9A 1OYYA 1T6NA 1VMAA 4CYMA 4DC9A 4KFUA 1L7VC 1R5NA 2VA8A 3ADBA 1T9HA 3SC3A 2ZJ8A 3PUZA 2UZ3A 4C0AC 2QPTA 1GOTA 1M7HA 5EXPA 2HYDA 1T3LA 1FUKA 2GWHA 1GNQA 2QI9C 3AUYA 2P65A 4EIWA 3WP1B 2X8AA 4QOSA 1KKLA 4Q4JA 2GF0A 2WJJA 1NN3A 2FWRA 3IILA 1QHSA 4GZMA 3FTQA 2AFIE 3RRZA 4ARZB 4E07A 1NSTA 4B43A 5FPYA 2JCSA 3OIVA 1BYIA 2XJ9A 5GVRA 4CEIB 4DXAA 1AK2A 1IONA 1NSFA 1UEIA 2WWFA 2GCOB 4CEJB 2FX3A 3KFVA 5L3SA 3MGCA 4DDWA 5C46F 4C3ZA 2FA9A 2ZI5A 2A7QA 1HUQA 4TLBA 1XMVA 4EJSC 1PTQA 3G0HA 4OJKA 2V54A 3A1VA 3Q85A 4TLDA 4A1FA 4Q7LA 1AA9A 3IEVA 2O8BB 2B7BA 2PL3A 3HU3A 1ZMXA 4OI2A 4N0DA 4IJMA 2PX0A 1G8PA 2OM2A 2C78A 1CF4A 1IN4A 3EC1A 2FFQA 4Y0AA 4MKGA 2C03A 4AKHA 3LAWA 4E22A 4TQ9A 1ZU5A 3B85A 4HDQB 4V0MA 4C2UA 5E7JA 4DSTA 2CJWB 3KJIA 4IDPA 4JLPA 4IFEA 4B3DA 4B6FA 4OHYA 2GAAA 3A1UA 4KVAA 1E4VA 3CPHA 5EP3A 1Q1QA 3PEUA 5TDHA 5TV2A 1TBOA 2PCLA 2KBFA 3GJ4A 4QRHA 4BLRA 3AF4A 3RNLA 2P6RA 2ZS7A 4IVRA 2R9VA 2FGJA 2ERYA 1H65A 2N1BA 2NZ8A 3GP8A 2QQEA 1Q3TA 4AI6A 2C9YA 3VR5A 2W2VA 4S35A 3Q9LA 1QHGA 3AVXA 2YHSA 3GEIA 2DBYA 1XU4A 3K9HA 4Q4AB 4WA7A 1N5LA 1ZM3A 2IS6A 4Q5IA 1EX6A 3MWKA 5FL3A 821PA 4ESHA 1VDZA 4JLKA 3FOZA 4DB2A 5EQTA 4LSGA 3WRYC 4LZZA 3RS3A 3T61A 4GPTA 2RGDA 3LDAA 3E70C 3DHWC 4HI0E 1L8QA 4B71A 3DKPA 4TL7A 4PAMA 1EX7A 1WMSA 5CJ2A 5J4VA 1K5DA 2BCJQ 2XNDA 4QBGB 1GRNA 1LFDB 3PVSA 4NMMA 3FHCB 4EFNA 1XD8A 4EPVA 3AVTA 3VFDA 1AN0A 4JLBA 3QG5A 1LS6A 4F38A 1G7TA 4TTRA 4B3FX 1N0VC 4JSTA 2W83A 1R0WA 4XVUA 5LB4A 3RRMA 4ARZA 2IF2A 2NPIA 4BRUA 3BFXA 3VHLB 2NTYC 2IL1A 2OXCA 4Q1BA 2GEUA 4DT1B 2AR7A 2ZRDA 2NO9A 4CEIA 4KFTA 1R10A 2NOAA 5KNBA 2X2FA 2GCOA 1RKBA 3IPXA 4CEJA 2O0JA 4BFZA 1RIFA 4CF7A 3KQNA 1YZQA 1T3SA 2XNDD 2V3CC 1QZXA 1Z08A 2HCJB 3L0IB 2QGZA 1U0LA 1DG3A 1E9EA 2X19A 2RCNA 2W6JA 2JIZA 1KK3A 4JT4A 4LJYA 3AB3A 3KQKA 3SYLA 2N42A 4HLQB 2PEZA 4LJ7A 2BMDA 4CEHB 1ZM2A 5FOSA 2ZE7A 3TMKA 3SDZA 5EJEA 2O8BA 1U0HC 1Z6TA 2A5FA 3BB3A 1Z07A 1IOZA 4D81A 3QI2A 2EYQA 5G53C 1NMXA 1PLJA 2O5VA 1G7SA 2ROWA 3WBKA 2OBMA 4BUJA 3LRPA 1CR0A 3HR8A 2IUSA 3ZVNA 1OYWA 2GZAA 3T1OA 3AVVA 4C30A 1XA6A 721PA 2CJWA 2HCBA 2NMVA 2FSGA 1AM4D 2YZ2A 3GJ5A 3U3MA 4URVR 1UADA 4Q1AA 5A0FA 2FGKA 5SZJA 4UNQA 2OT3B 5B58C 2W6JD 3RS2A 2JIZD 3CF2A 1D9ZA 1J99A 2IW3A 4EKDA 3KQUA 1B0UA 1KNXA 3D6TB 5L3RA 4M0LA 3RHFA 4TQUS 3U3RA 3UGLA 3Q72A 2PBRA 2AWNA 4JBYA 3VAAA 2HUPA 1J8MF 5G41A 4ZCIA 1R0YA 1R4AA 2P6UA 4QXAA 4BECA 5KSYA 1W44A 3KL4A 3NKVA 1T91A 4Q4AA 2FMXA 3C8UA 5CM9C 1N5JA 5BWMA 4DDVA 1G41A 1TQDA 2OCBA 2ZTSA 4LC1A 4D6PA 2IHBA 5EE3A 3CNLA 4QC2A 2H8KA 5CDFA 1XNJA 1Z8FA 4KI0A 1KJWA 3EZ6A 3WMFA 3WY9A 3PUXA 5DISB 4B44A 1ZP6A 2OFOA 4Q4HB 3L0OA 3I72A 1WDTA 2ZR9A 2R6AA 4NU0A 1G20E 2JLRA 1Z5ZA 2YWGA 4OI4A 2ONKA 4HB3A 1TUEA 4A0FA 2J45A 4B75A 1QDEA 5DGXA 4B2PA 1M1YE 1F48A 1I4DD 2VTKA 4Q48A 1Y63A 1W36C 3SJZA 3X1YA 5L3QB 2ZSEA 1YJ5A 1YZKA 1W48A 1EWQA 2ZAOA 2FSHA 2ANCA 2A9KA 2KJQA 4DT1A 2BM1A 3CRQA 3ZS9A 1ELOA 1P60A 2QBYB 2ECKA 4MITA 1XTQA 3MWJA 1OV4A 2F6RA 1E79A 2LKDA 3UGDA 3OIUA 2H7VA 5KPDA 5LD2C 1VG0B 1VYUA 2A5GA 2JLZA 4PC2A 4LYJA 2WJYA 5J4LA 3ICEA 4KLNA 3FFBA 3GLFB 1E9RA 1DE0A 1Z6GA 4Y0VA 4CEHA 3LWNA 4N1AA 2Q3FA 2NO0A 3ASYA 1Z0AA 5HCIA 1KSJA 3ZVLA 3P27A 1W36B 4DB4A 1SQ5A 2HT1A 4Z8YA 3LQQA 1J2JA 3EIEA 3D3QA 3BBPA 3U6BA 2GK7A 2ORVA 4U00A 4WVFA 4NONA 2FN4A 4AG6A 2NGRA 1NVWQ 3EWAA 1TU4A 4LY6A 1IN8A 1W49A 1UKEA 1MT0A 2XTNA 3M0EA 4NYIQ 3K0EA 4A0HA 5LD2B 3B60A 2VSXA 4AKIA 2HDNB 1KI2A 1Y8FA 3NH6A 2XB2A 1G6HA 5J4YA 5CK5A 4PSAA 3SYNA 3CZPA 3W9YA 1VTKA 3O8RA 3K0SA 4QGFA 3VR4A 1PVOA 1CU1A 3QY0A 3DMDA 1G16A 1RZ3A 3MRSA 3C5CA 4BPBA 3L82B 1P4SA 2F7SA 4DBLC 2IXEA 1YZTA 1BOFA 2DB6A 1TADA 3CNNA 2JLQA 2FZLA 4D4KA 4HLUA 1FNMA 1C4OA 2VHUA 4TZ0A 4EDHA 2PX3A 4YMVA 3U61B 2OZEA 4FCTA 4LYHA 1E2MA 3EXAA 1KI9A 2GDJA 2WAYA 4JVMA 1OXUA 1DADA 3QPVA 4CW7A 2WWHA 4TMTA 5CK4A 1OXSC 4YMTA 5KOYA 1ZD1A 3QPWA 3PEYA 4HUTA 4TYWA 4C2TA 3HPQA 2VP6A 4Q4HA 2GHIA 3R9XA 3A37A 2GJ9A 1KGDA 3B1YA 2GXQA 3BH6A 3V9PA 3A36A 2YUUA 2N46A 1G4UR 3HU1A 4L16A 1NKSA 1UBGA 3TNFA 4ZCMA 3NG1A 4ILEA 3SFZA 4V03A 1Q22A 1EFHA 5L3QA 5TVKA 3TR0A 4OQLA 2FSIA 2G9NA 2BBSA 2CBZA 2PJZA 1DAHA 1EXMA 1KSHA 1XD9A 3OEHA 2QBYA 1Q0UA 4V0LA 4H9GA 1T5LA 3MMPA 3F5FA 5C1BA 5DLQC 4KXFB 2CHVA 1P72A 2GKSA 4P3YA 4QJ4A 2ZYUX 4KODA 1E4YA 3MSXA 4V0OA 1FTNA 1RE0A 3LW8A 1S4QA 4RD4A 3GLFA 4A6PA 2H92A 5FPHA 1PV4A 1RYHA 4NYIR 2VP9A 3N2IA 4V0NA 1GAJA 3DZDA 4YXWA 3VR3A 2F55A 2CHQA 3N2EA 3QXCA 1XFAA 3EAQA 3FWYA 4Z8XA 1T0JB 3M4YA 5DE3A 4EAQA 3AVUA 4BWYA 4IRUB 3OEHD 2YOGA 1FARA 3U6KA 2OV2A 4B2LA 5FOUA 2CDNA 4FN5A 3ZZTA 2X1VA 5HPYB 1XP8A 2A5YB 2BKEA 2QUZA 1E2GA 3FMPB 4WAUA 2WPDA 2I1VB 5A4JA 4YXWD 1NBMA 3ZYCA 1YR7A 4B47A 1CS4C 4HB0A 4QM7A 1W36D 2R6DA 5DYGA 1JR6A 1OPXA 2ZJZA 1OH7A 4DCSA 3H2YA 3QVVA 4DCTA 1KDOA 5FUWA 2ZRJA 4B48A 2ZJOA 3FPAA 2JLWA 4BFVA 2YVUA 6Q21A 2XX3A 3HYTA 3U3KA 3AVYA 3KJGA 4DLSA 2FNAA 3W8RA 1F2UB 5FPTA 3BAFA 1OKKA 4HDCA 2CNWA 2A2ZA 2DY1A 5CITA 3SZRA 2QENA 4IXMA 3AKCA 4RD6A 3U60B 1XZPA 2B92A 3K9NA 3W5IA 2ZSAA 3CLVA 3RANA 5CIQA 2VPPA 2WPDD 2KB0A 3AVQA 1NBMD 1I4LD 4C0HA 3ZS8A 4DLZA 5DO9A 4TT3A 4GRAA 4P32A 4JLVA 1A2KC 5SZKB 1I2DA 4B3CA 5IT5A 4KYIB 2KWIA 2UVQA 4TTPA 4FMDF 1UKVY 4YLGA 2OILA 1RW4A 4DVGA 4PPNA 3C41J 1OKKD 4DZZA 2CNWD 5KYKA 3AP1A 1G6OA 1DAMA 1NP6A 2BKUA 4Q9KA 5JHGB 2P2LA 5FPSA 2JJ2A 3AVPA 2VHCA 1KO7A 3B9PA 1DS6A 2REXB 3SJAA 3DMNA 3Q5EA 5BYKA 2YWEA 4TT3D 2IYWA 4JJKA 4QM6A 1KI7A 2KSQA 3WRXC 2E87A 2REBA 4M1MA 1EFCA 1UPTA 3P26A 2HF8A 4BZPA 2FU5C 2A5DA 3NBZC 4O0MA 5JRJA 1FOEB 5CIWA 1C1YA 1LS1A 3GPLA 1E1QA 1NLFA 4OL0A 1KZGB 5LDDC 2ZYVX 1SXJC 1JR3E 5FR1A 4GT1A 3W6OA 4F91B 3K8YA 4GL2A 3TK1A 4K8OA 1T8TA 4OBEA 3PUYA 4D4LA 4I4LA 1ZCAA 4LV8B 2FFBA 2JJ2D 4P31A 5DHAA 2GJKA 1FMJA 5AJWA 4GOJA 4GSYA 2IYRA 4TN1A 1XPRA 3A1SA 1T4GA 3IO5A 4C0LA 4C0QC 3KB1A 1QVRA 4JLDA 2YKGA 2E73A 4PO9A 1IQPA 3I62A 1XCGB 2C04A 3L2OB 3LX5A 4B35A 1U99A 4MKHA 1KDPA 3BS4A 1KBFA 1G5RA 2Q9AA 2QG6A 1R0ZA 3RS7A 2FNFX 3K70B 2WKRA 1E1QD 1K5GA 3CF0A 1ZD8A 2RB4A 3VHXA 2ODEA 1BMFA 2VSFA 2XJ4A 1SXJB 2CEAA 3DM5A 4NYJR 4BEBA 3KQLA 2JA1A 4ABYA 2ZE5A 4L9WA 1JPNA 4X8LA 1E2HA 5CYPA 1YZNA 2Q9BA 3PUVA 3OIWA 4QL3A 4AKEA 3O8CA 1OLOA 4B2IA 1Z63A 1FL9A 4DIDA 5FTLA 4Q00A 5JJKA 1CJMA 4JVSB 5CYOA 4DEXA 3SQXA 4K81B 5TXGA 4ERNA 3KKNA 4M1TA 5G3ZA 1F2UA 4US0R 1A1VA 5JS7A 2DWQA 3GJ0A 3TVDA 4PQYA 3GJXC 2ZSDA 2PMDA 4A6XA 3QE0A 2G83A 4YMUA 4B32A 1M8PA 4PTLA 4RD0A 5JBQA 5KO2A 2HXSA 3KB2A 5JI3E 1WP9A 3B6EA 4HAYA 5KTYA 3CRMA 4X8HA 1FFHA 1BMFD 3ZD7A 1CRQA 2IA5A 3AGPA 2D2EA 3EPKA 5L3VA 2OXRA 2ZI7A 1JJVA 3ND9A 1ZNYA 1LF5A 2J3EA 4ZPXA 3U44A 1S96A 3RS0A 1Z06A 1Q44A 1CP2A 2MMCA 2MSCB 5GVSA 1TF2A 1W47A 4H1UA 3VR2A 5EP1A 1W2HA 1NI3A 1II0A 3BC1A 1U81A 5F9HA 1K6MA 4JLMA 2RGCA 4NE2A 1U9IC 1E9DA 2AHOA 2RGGA 3EZFA 4NHOA 4DUGA 3B5JA 1RRGA 1EK0A 5AK0A 2ELIA 4WXRA 4K46A 5FTKA 1QG2A 4OHVA 2FV8A 3JZAA 4DHEA 4ZDJA 5JMTA 5J4KA 2IK8A 4UXJA 5CB8A 1KMQA 1QHNA 4GOKA 3TQCA 2BMEA 1ZUHA 4LJ6A 3NDPA 4HDOB 3O47A 4IDOA 1R79A 4PZLA 1KAOA 5AUPB 3K0CA 2RGNC 1WBBA 1E32A 2J41A 2BHRA 4DUGD 1YR6A 2BMJA 3WBJA 3PFIA 2P0EA 5LB2A 3WNBA 1MO3A 2G0TA 1F6BA 4G5GA 4LYFA 4RCZA 4EPTA 2PLRA 4LCBA 4JLNA 4CIDA 1W7AA 4UJ5A 3R20A 3ZJYA 3GLIB 1VG8A 1VYTA 1XPUA 3LW7A 5FOVA 2YWHA 3MLEA 1ZBDA 3DOEA 3ZGXA 2H16A 2XB4A 3TGPA 2QT0A 3W90A 2GRJA 3ND8A 3VR6A 1YZUA 2V1XA 2ZRFA 1BKDR 2X2EA 1SXJA 3BOSA 4DLRA 3P20A 3UWKA 4GBMA 1CRPA 4MYTA 3PXGA 1KSFX 1R5BA 1XJ0A 2XOKA 1SZPA 3VKHA 5DN6A 2CCGA 1HY3A 1TBNA 2NIPA 2DWOA 4NBSA 4PQFA 1NF3A 3PEWA 1XF9A 1H8HD 1Z22A 2V1UA 4UXIA 2AL7A 3SR0A 4RZ2A 3A4MA 1SULA 4DLTA 3GFTA 1GIAA 1PLKA 4WBSA 4CRWB 4TLAA 5KSZA 2IHYA 5KUTA 1DO0A 2QRNA 1AQUA 1T0HB 3IBGA 2EFDB 5K8UA 5BQ5A 5HKKA 1Q57A 3GEHA 2FEOA 3K70D 3LLMA 2ZJAA 4LPKA 1S1CA 2VBCA 4BASA 2DWPA 3WXMA 1SXJD 5LBIA 1COWA 1NIJA 3KY9A 3PV0A 4G5SA 2XOKD 4XD7A 3UGIA 1Z83A 2Q0HA 3LVQE 2ZE8A 1ZC4A 4KFSA 1CR2A 4F7WA 4TSFA 1IY2A 4OQFA 5IHPA 3MFYA 4B6EA 2QQ0A 3IGFA 1HT2E 1YZLA 5EE9A 2H17A 2GETA 1MR3F 5A5GA 1XZQA 2XZPA 4A2QA 1ONBA 1OH6A 3D31A 5EUMA 5HKKD 5EP2A 4CT4B 4A0RA 3TJZA 3NH9A 2V7QA 4X8MA 2ZI4A 4MGZR 2EW1A 2J1LA 1COWD 2NZJA 3CPJB 3X1XA 5AJVB 1DELA 2OBLA 3LA6A 1G3MA 3SYKA 4XD7D 1X1RA 3UXMA 2IEZA 4LHWA 4A4DA 3OF5A 4TSFD 1E9AA 3PQCA 4ZV4A 5BN5A 3BD9A 4Z1MA 4ZKDA 2CE7A 4RZXA 4HAUA 5K8IA 3HU2A 5C2JB 4LDJA 4W5HA 2ZAMA 2ZR0A 4PXAA 4EJSB 3H84A 1ZCBA 2VLIA 2ZYWX 4JVNA 4R9UC 1U9IA 4C0JA 3UK6A 4M1KA 3AP3A 1ZIOA 1ETUA 2EFCB 4TL9A 3EPJA 4HYYA 1Z6AA 2V7QD 1UDWA 5JCPA 2I3BA 3CBQA 5CLLA 4B74A 4Q9IA 2QN6A 1PTRA 1Z0JA 2QM8A 5BYJA 3W3AA 4PPQA 2QAGC 1ZJ6A 3GLIA 4IHQA 3HR7A 4FWTA 1LY1A 2GJSA 1K8RA 2RGBA 4EUNA 4OK6A 1X8JA 1IXZA 2DYKA 1JALA 3GQBA 3WYFA 2QMUA 3K0FB 2NO1A 2I4IA 2BCGY 3PR1A 3GJ6A 5HR5A 1KK0A 1S3GA 4UNRA 1P62B 1V43A 1GITA 1FUUA 3I8SA 4GFDA 3REGA 3LO5A 4P4TA 1SVKA 4MQBA 4IFBA 3L0SA 4M53A 621PA 121PA 1D5CA 1WA5A 1XD2B 1G8GA 5JHHB 4AC9A 5DI9A 4A2PA 1KDTA 2QAGB 4URUR 3HJNA 4XSGA 2ZI3A 4B33A 2ZJ5A 2F1HA 3BFKA 1RRCA 3J81k 4DCUA 3GLGB 3SFVA 4FINA 1OH8A 1JR3A 3R9IA 3KKMA 3A58B 3RS4A 3T1QA 4C0SA 3WNDA 1KJYA 4Q7KA 3CNOA 1NMZA 3H1TA 4GI7A 2BBTA 1E2LA 2FJUA 1GKIA 3FHOA 2J0UB 2ZRLA 4B34A 1JAHA 1YE8A 4NCNA 2QSYA 5J40A 3WNCA 2O8CB 1FNNA 3X1DA 4TYNA 1SHKA 1NIPA 2CL6X 4D0GA 2VL7A 4IEEA 1GG2A 2QNRA 1DAEA 3K09C 4DLVA 3EA5A 1G8FA 2C77A 2CLDX 3BH7A 5EE1A 4D4JA 2D74A 1DVRA 4A8JC 4AWXA 1S9HA 4I99A 1YRAA 1CR4A 4TMKA 4D80A 2D62A 1GNRA 3QF4B 4RFSB 3TAHA 3LX8A 1X8LA 2WWWA 4EPRA 5CLQA 1NL3A 2WJIA 1YR8A 2ZXUA 1XMIA 4FMDB 4XVQA 3C7KA 1ZM9A 1F60A 221PA 1FZQA 1JQJC 3S1AB 1RJ9B 1X86B 2YOHA 4QBIA 3BXZA 1N6RA 3A1WA 4OQNA 4V02A 1HQCA 3GD7A 2OESA 3R8CA 2WV9A 2ORWA 1M74A 4IOKA 3QKSB 2BDTA 4EJSA 1WCV1 3QOFA 1N6IA 4PPGA 1N6KA 3KJEA 4A8JB 4ZDIA 4ZI2A 4BRWA 1XEWX 3NC1C 2WKQA 1ESNA 4OJQA 1NG1A 2W0MA 3BWDD 4KAXA 4L8GA 4S2EA 3VMFA 1NN5A 2WWYA 2QTHA 4OHZA 4YDHB 4TYQA 3CWZA 5G40A 3DOFA 1NLZA 1KO8A 1IN7A 1NKTA 3MUFA 3RABA 3AF0A 2WM9B 4Q01A 3T15A 3QXJA 3IIMA 3K0FA 3I1FA 4BLSA 1ZW6A 3QKUA 3NBYC 4OK3A 4YMSA 4QNRA 3TSZA 4AURA 2PT7A 4LV5B 2ZRPA 4JYBA 4WXPA 2GVIA 2GA8A 1HQYE 3EZ2A 4RCYA 2FFHA 2UZIR 4MRRA 3QBTA 4G5OA 5FUXA 1XD2A 4KCGA 3ZLJA 1ZNWA 2BJWA 1E9FA 3W8NA 4IKEA 2QAGA 2A3RA 2ZQ5A 4URWR 3R7WB 4BLQA 3PG5A 4L9MA 4DLWA 3ADDA 2ZUCA 1VCOA 4Q9JA 4AG5A 4MUBA 2AFHE 4WOPA 4BZQA 5F2EA 2J0SA 3GLGA 5TB5A 1M2OB 1XXHE 2WJGA 2O0KA 4JL6A 2B7CA 3LY5A 2WOJA 4ZIRB 3B1VA 4RJLA 3R8FA 3ASZA 4DCNA 2QA5A 4EFMA 2FDCA 5D3MB 2QP4A 3FKQA 2DFTA 2Z0MA 3QUSA 3GFPA 1NNEA 1Z2CA 2EFHB 3HWSA 2WICA 5E7IA 3W34A 2J0UA 3KXKA 5HE8A 2O8CA 4JKYA 1U8YA 1GSIA 1QBKC 3A4LA 1E0AA 1U90A 5JEDA 1D2EA 1FP7A 4A0GA 4LJ9A 1XCMA 2VP5A 4GZLA 1OIWA 1XX6A 2OO7A 3BRWD 4YQFA 1Q20A 3GJ3A 2X77A 3OHMA 5TARA 4PSKA 3QF4A 4RFSA 2EYUA 4W5WA 4G01B 2ATXA 4M9SA 4NYMQ 4BEJA 2DR3A 4M9ZA 1E79D 1G17A 2ZR7A 1NLYA 2FPLA 3QIAA 4IVPA 1KSGA 4POAA 5KHOC 1TUIA 2YV5A 1EFTA 1E94E 1X6VA 3S1AA 3TW4A 1RJ9A
chains in the Genus database with same CATH superfamily
4H1TA 4IQFA 2CVFA 3DOOA 3NBMA 1TB4A 2C9OA 4M0EA 2IPMA 2ZUBA 3BH0A 4OAOA 4ZI7F 2JVKA 1JQ3A 3QKSA 5IM5A 3K09A 5EXXA 4YCSA 3DZCA 3SHQA 1QHXA 1NV8A 4F45A 3UC5A 4B87A 4D0NA 2AFIA 3BQ9A 2GAFA 1OY1A 1TF5A 2ABWA 4PX2A 3SE0A 3WNQA 4A8JA 5FTMA 5D3KA 1N5KA 3FNQA 4JAVC 1UJBA 3BTOA 3FSEA 2VHQA 4JASB 1YA8A 5BR8B 1KXZA 3O92A 3ETDA 1UC9A 1VLJA 2BSAA 3SZGA 2B21A 1T3HA 2O3JA 4HUQB 3Q40A 3TD9A 4IF6A 1Z6YA 2W2LA 4Z86A 3GRZA 3UAGA 1QCYA 2VG8A 3QPDA 1TZCA 3HN2A 2H4ZA 2HKIA 2FQ1A 2OAQ1 3B5IA 3IEUA 4NCIA 3WGUA 2J31A 1I3NA 3QPBA 4CPDA 2ACWA 3E53A 1MOPA 5EZSA 3HABA 1YTUA 2XIQA 1VLQA 4Y8VA 4JYCA 4DJTA 1TM3E 1V2HE 3F3SA 5B2ZA 3HKEB 3LUGA 5LLTA 1Z56C 4OHCA 2J3DA 2IKSA 1NZFA 4G5FA 2HSEA 2EWWA 4YP1A 3U3DA 3IV6A 3UAVA 2O59A 2IEBA 2BVNA 3FDZB 3WP0A 1I4TD 4RZ3A 1O4VA 2ZTMA 3F3MA 4O25A 2VSNA 3IVMA 2GAJA 5LQRA 4YRPA 1JN0A 1KR5A 4BV3A 1PT6A 2GHTA 2Q29A 2ZJFA 5GMOA 3GA5A 1B4DA 3TWOA 1YB7A 1M7BA 3TM5A 5ALPA 4TVSA 2FWJA 4IDCA 5KOHB 1BX0A 2L42A 3E35A 3R3VA 2GVDC 5E9QA 3WV4A 1M2OA 3C3MA 3B36A 1XQXA 3IHKA 3K5HA 3OQIA 1J5EB 4AXXA 2IELA 2CW5A 3WMEA 3T5MA 3JASA 3OOYA 1H8ED 3C3CA 3CXLA 4WZAE 2Y0CA 1TT5A 3D64A 2JH3A 4GI3A 5D3MA 1VKRA 4QYSA 1X70A 3JPWA 1GUAA 2ZRBA 3A10A 4YJHA 5H5JA 5HGXA 4ZYVA 2I22A 1JVBA 4ALMA 4Z0HO 4ZDKA 1K7FB 2ZPTX 1TTHA 4EG3A 2OHVA 3ISVA 1FVOA 4M0DA 3GEGA 2FI1A 2ODBA 2YZKA 3ED5A 1WHTB 4M22A 1Y1LA 2XRFA 4G56A 1U2RA 3ZDDA 4JMLA 3KZNA 1QH1A 3ADPA 5A7HA 1GZ4A 1HE4A 4WCFB 4ZHSA 4YRSA 4GP6A 1HEYA 3AM4A 1LZKA 1IXRC 3BUSA 1QANA 1EWRA 2WJ4A 4BP9A 3CB4A 4X7BA 3THWB 1DPFA 1AHIA 1PK7A 1MV8A 2H2FA 3EQ2A 4FYKA 4PFSA 3FVQA 3HM9A 3FHTA 3C48A 1C9EA 4R40A 1N1EA 2KS6A 3H6KA 3FUTA 3EMDA 4KAAA 2H07A 3DWIA 4RSRA 1QSGA 5ENDA 1ZD3A 5BN4A 1GXSA 2J6BA 5F73A 2PRJA 4MDFA 1BRMA 1DINA 5HBRA 2WJAA 1E6WA 1E9BA 3IS3A 3L43A 3BTSA 3Q3IA 4L1KA 3VKUA 4LQ4A 3B1WA 3LBAA 1HV8A 1U1FA 1U4SA 2E89A 1L5LA 3TIIA 1Z4KA 1HDIA 1AB6A 2HSWA 2INGX 2OLKA 1G20B 4LVUA 1GAWA 4RDIA 5EJ6A 5IANA 3RLIA 2HLNA 3FPFA 1C41A 4J0JA 4N4AA 4NABA 1D2RA 5DYTA 3WLNA 1O58A 2VXBA 3ND5A 3F73A 2CEKA 1BMDA 4O33A 3TX2A 4MTCA 1RPJA 3DEFA 1NMEA 2GYVA 5JZOA 4KLRA 3I9MA 3N2LA 4AZSA 3C74A 3DS8A 3EBOA 1GZUA 1UPBA 1GZ5A 3ZJ5A 4EARA 1L7OA 1DT3A 1YZHA 3DVLA 3TSOA 3JQRA 3K73O 4HO1X 4I1PA 1FU7A 4MKFA 3WGMA 1R7RA 1W88B 1Z6QA 2PTHA 1C3VA 2PVPA 5L7TA 3H11A 1OI7A 2CLSA 1IYZA 2YVQA 1QJ4A 2UDPA 1M0EA 2BZGA 2CZCA 1K9SA 2NU6A 3ZKWB 4XE5A 2IS2A 1NJ6A 2VPXA 5IBQA 1HEVA 3L3BA 4KUGA 1IFXA 5H1YA 5F9FA 3GGOA 2OQRA 1TA9A 2AI2A 5IT9A 4Q3NA 3JQBA 5J23A 1XZAA 3T38A 3UTDA 2G76A 4IVQA 1S9DA 3PEFA 3VO8A 4CMBA 3RJZA 3F74A 1ZNZA 1E8DA 1KJJA 1CY1A 5BSTA 3REQA 1LPBB 2XWJI 3HP7A 1UFQA 3ESYA 5G0WA 3JYOA 1KPGA 1GTSA 3B8HA 4RK6A 3TNLA 4HZIA 2Q3BA 2YYSA 1FLVA 1I13A 1S3IA 1RJFA 2VJYA 4CG2A 2JAUA 1W2GA 2FN3A 1DQYA 2LCQA 1KARA 1N0IA 4AUMA 1FQKA 1X0VA 3CIFA 3IALA 4FYJA 4E70A 3ZDQA 3R0VA 1FSSA 4DS3A 3I6YA 4C0BA 2XWBF 2ZULA 4FYPA 1V37A 1VIYA 3OOEA 4L5CA 5CVDA 3WMGA 4GMXA 3KKLA 1A7JA 1DBSA 1E3DA 2HGSA 3DOHA 1WXHA 2Q0SA 4OP3A 1PFQA 5DFAA 4CXMA 1VA4A 1M76A 1UMKA 1XLUA 3GLSA 2Q4EA 4JQSA 1ONOA 4OHOA 2FEMA 3F5DA 3LM8A 5THKA 5LQJA 2J9FA 3EVBA 3EK2A 3S29A 3DPIA 2QDXA 5HKBA 2HLPA 3BXFA 2JVJA 3WA7A 3KUKA 3KBOA 4B4WA 2BGTA 4DABA 4FZJA 5EIXA 4N48A 3W9UA 3KZMA 5KC9A 1K27A 3V3TA 3PD7A 3UH1A 1XDDA 5B6JA 5CNIA 4Q4CA 4DFDA 3E1KA 3E61A 1UM9A 1NZDA 1VI6A 2ZDQA 1SUAA 2JBWA 1WE2A 2FLWA 2C07A 3M6IA 1MRNA 1DRVA 4D44A 3PC3A 2BMVA 1YVDA 3U4QA 4N3NA 2WAMA 3DTTA 2QMOA 3O9MA 2WU1A 1PZNA 1NUSA 3OX1A 4OH1A 1YASA 5I9IA 3IVAA 1N0HA 1SG9A 3PB3A 5BN1A 3PK0A 2ZRGA 4KAJA 2GTHA 3MTIA 4CMCA 5EZ6B 1EDOA 4BAUA 4O6VA 5KZMB 1QIGA 1ILEA 1J2UA 5TMEA 2DLDA 3QVWA 3EH2A 1ISMA 3KYBA 3RIGA 3R44A 4PXSA 2XUOA 3L7DA 3QPCA 1WU8A 1RVDA 2X4LA 2J6HA 4KG7A 1WCYA 2CV2A 4ZV7A 1T26A 2QX9A 3AOEC 4MKZA 3ZQ4A 4AF7A 1XMPA 4H17A 4BQSA 2BWJA 3GLHE 1WEKA 1KYWA 2GKGA 1J23A 2ZW9A 1A96A 1EZZA 4D9FA 4IJUA 1M1YA 4XOIA 4CCWA 3OTOB 3ENNA 3A6JA 5FR2A 4UQOA 2QV0A 4YMGA 5FNVF 2TMDA 2B1RA 2WFMA 1E1RA 3K53A 4RMIA 3ZE0B 3I5XA 521PA 1VCIA 3IT3A 4BFWA 2DT8A 2Q1WA 4RKRA 2IOHA 4RGQA 4MWOA 4OJNA 1W19A 2W6NA 2Q3EA 4OQXA 1BDJA 3H2ZA 3N8NA 2E5WA 3EA0A 1LV7A 2V96A 3KZ1E 5DBEX 3ICPA 4ERXA 5K8TA 4RY9A 3KDSE 4X41A 4FKDA 3SQWA 3NHSA 1JE1A 5KTOA 5FULA 4BNDB 1YS9A 1CGII 1KJZA 2JPDA 1IXKA 2W6QA 3LF1A 4M0MA 3MD0A 1TW3A 2IS1A 4QFBA 1Z0KA 1D4OA 4B6RA 2YWBA 2YHBA 3U9LA 2E5LB 4J03A 4LOLA 4QKQA 4M46A 2WMDA 2R84A 4Z9YA 3L04A 5ICMA 1VIMA 3N8GA 5JH7F 5C5IA 1AHHA 1G1AA 1S2IA 1E9SA 4OH7A 3KOZA 4RNDB 4U6NA 5EPUA 4TS9A 1JU4A 3STYA 5K3EA 3HI6A 3IQHX 4PXYA 3E1GA 4J0QA 1WCXA 3K9GA 2OL4A 5J2UB 4TS1A 3OQNA 2BMFA 1GRRA 1PX0A 3LOUA 5KQGA 3AHFA 1KFBB 3ECAA 5JH7A 3DBRA 2RI6A 4HX9A 4LOAA 5EJ4A 4I3HA 4H1VA 1QFSA 4AL4A 1Z73A 2ICAA 1MB9A 1A8UA 3UWDA 1H5NA 4ZA2A 4NCHA 5B57C 2FPPB 2XA9A 2Z9DA 4UQPA 5JSZA 3L8MA 5ER9A 3L0ZA 4YT5A 4GP7A 3LDUA 1JFVA 3QEOA 2VJLA 1E89A 5ESDA 2EQBA 5E4JA 2QE7D 4BKQA 5BSGA 1WXQA 4JI5B 1S8OA 2OAP1 1MPXA 4HNAA 4EA6A 1KQFA 5CDSA 2C5SA 3DZHA 3RCBA 4AKGA 4ENPA 1C9NA 2WF5A 2I80A 2KMQA 4JVOA 2FPRA 3HADA 1TGYA 1WCIB 1TKBA 2YYAA 4J0GA 3TLGB 4R7ZA 3RO7A 5ICFA 4B3XA 3L1KA 4UEQA 4ER6A 2FETA 4HVCA 3AFIA 3FZGA 3BB1A 4M89A 5IEBA 1RKQA 5C53B 4OV6B 1AXEA 3NTXA 5AJYA 2ECFA 2FQWA 3GWZA 4K9LA 2OE2A 1L4FA 2BEWB 2DCMA 1F0KA 3JYNA 1P18A 4V0KA 5F35A 4F4JA 3THXA 2G3YA 1JGTA 2C4TA 4ZZIA 3AV3A 3CW2A 3ZHTA 1VLLA 1E0SA 1U8EA 1Y7HA 1PUXA 1EDZA 4G5RA 1DZ3A 1QDUA 5B6PA 3FX2A 5GONB 3MTGA 4J6EA 1TQ2A 3RASA 2V7VA 4IR7A 3L4SO 1N6LA 4KO2S 3ZEIA 4DLBA 2I0FA 3ZJ4A 1ORVA 3I3SR 2Z08A 3LUHA 4BWVA 4CFSA 5L3ZA 4V39A 5LJIA 4MRNA 1K7CA 1H6CA 3VDXA 2R47A 1YOVA 1GPLA 3A9VA 4WZZA 1V7PC 2K7FA 4GQBA 3SC6A 1JXOA 2NXCA 4XIJA 4D41A 2IH4A 5AW6A 4YJGB 4HXFB 3FNEA 4DRYA 3AEUA 4BNXA 4XEHA 5IUNC 2OCKA 4NQRA 3E9RA 4FBLA 3VAYA 4DV7B 1AV7A 2HADA 1LC0A 2ZQYA 5IKOA 1J39A 1OE0A 2I33A 3EEFA 5FL7A 4UTPA 5AVOA 3OQHA 1NUUA 4QFDA 4PX9A 1UKAA 1JDVA 3A4VA 1ITZA 2QZJA 5E1MA 2F1JA 3PDUA 2W42A 1WX1A 1E2IA 1SUBA 2O1SA 3MT8A 3SYMA 3FMVA 4FHEA 4HSGA 3VYUB 3WGQA 1XZBA 1ZRNA 1NOJA 1G7RA 1GRVA 5EP4A 5DK6A 3VR0A 4A36A 2WVJA 3O3OB 2O2IA 3NCHA 1U1IA 2Y6UA 3WZ2A 3BJMA 3HKCB 1ZSVA 3A3NA 3IHWA 4PIMA 5GGYA 2WJVA 4BIMA 3UA4A 3SM3A 3D8NA 1FPMA 1K86A 2YBEA 1F5SA 2VK8A 5F9MA 4J2HA 4QPZA 2JHGA 3PUHA 5G2OA 1KI6B 2IEYA 2BKLA 5K51A 5KNDH 1WW8A 2X8BA 3PFGA 4PW0A 2ZIEA 4WK2B 1EFRD 5HWSA 2OB1A 4MINA 2ENNA 4LTDA 4UASA 3VUFA 1EA7A 4MGKR 1BA3A 1G8YA 4PZDA 2GB4A 5CM8B 2OR3A 5AHRA 3ST7A 4TRNA 3BJEA 2ARPF 1N1DA 3I64A 4KZPA 3VU8A 2YOFA 4CZ2A 2C3YA 1QIIA 4FC6A 2QUIA 4KRYA 1CJVC 1H2BA 4PE5B 5ERYA 5I7VA 4FUQA 5AIAA 3NBQA 1T2NA 3H1PA 1ULSA 4JL8A 2PLFA 4W9NA 2JANA 4HBGA 2GXAA 1KBQA 2Z1NA 1NVBA 3WLPA 4B85A 1XVTA 1L9XA 1QE0A 1MO4A 1J21A 1PT8A 3PNVA 4PYOA 1V1JA 2HJWA 2KMOA 2BFDB 3AZQA 3DUWA 3EW9A 4B79A 4MR9A 4B7CA 4BQPA 4D0RA 1L7AA 1V41E 4JJZA 1JDTA 2TECE 3LUAA 3WGNA 3A7EA 4QG3A 4FQ8A 2FW7A 3L46A 1XLVA 2C7GA 2B1IA 3FFTA 3T52A 2QLJA 3MJHA 4RVFA 5M3BA 2O2JA 3D3WB 5EXSA 4TWBA 3ZIAD 4JI7B 4HK4A 5KWVA 2RMKA 3WK8A 4X44A 2BMAA 3T7KA 5CYFA 5FI1B 4ZEXA 5JWHA 5H59A 1G291 1DXQA 1PN3A 4R4JA 1KMAA 1IRXA 2ETVA 4DY6A 2DB3A 3ZTWA 1WDMA 1J8FA 1U3UA 1RM0A 2W2TA 2ZBFA 3N59A 3TD6A 4C9BA 3E4CA 3SDBA 2P0AA 3Q3EA 4P7GA 3TJRA 1GTJ1 2E48A 3N0VA 3AVWA 1UXHA 3A2KA 5KOJB 2ADOA 3PNLA 1QVWA 3H3FA 1P9RA 3PENA 3CX8A 2UUCB 4ZGWA 1FRQA 4FNAA 3SS7X 1P5HA 4LJSA 3QMMA 3IFSA 4A23A 1QMPA 3MPOA 5F21A 2AMFA 4RPJA 2IX3A 1O8CA 3L6OO 4NC9A 1BMTA 1Z7KB 7AT1A 1RABA 4QNNA 4JJAA 5IM4A 2ZJBA 1XPOA 4KGDA 5D51S 1FFBA 1YJQA 3ZWMA 5CR9A 2HN9A 2RI1A 1P4RA 3DBLB 3LBFA 4WK4B 4ESOA 1IBMB 1WB5A 4WN9B 1OXKB 4ZT2A 1DKNA 4ZXPA 4XWKA 1PG0A 3FWKA 5LMCA 3WVNA 1L5WA 3QJ5A 2RAVA 3JQ8A 1R1DA 5IARA 1HYEA 2J9ZB 4ZI7A 2JF0A 1DC8A 2ACEA 4O2AB 3K8ZA 3WX0A 1TEVA 3ETEA 1Q1GA 1DO2A 5JCOC 4UTZA 1HDEA 4WCDA 4YHHB 1O0BA 1F20A 1R12A 4E1PA 1TPZA 1EKXA 4I1SA 1IUNA 1XCPA 1P5RA 2HUNA 2QL6A 3TZEA 2D06A 5KYWB 4BB0A 1EBBA 1QFJA 2H1LA 4WT7A 1T6ZA 1YZ3A 5I9TA 2GSDA 2RG1A 5DF1A 1SVNA 4BMNA 3AWDA 2PR2A 4C87A 1S8AA 4RACA 1XL0A 3DWEX 1O96B 1NVFA 4S04A 1JMKC 1Y8RA 4AB1A 2HPVA 5AJUA 2ID9A 3IERA 4IHKA 3BT7A 5I8WA 1ZHHA 1BJKA 1XZIA 2E21A 2G40A 3TSWA 4BZWA 3NI2A 5BR1A 2E37A 3B6IA 3CJQA 2Y1DA 1TU0A 3TW8B 1NJGA 1JBEA 1O94D 2FPOA 2I62A 2F4NA 3IDZA 4UDOA 2C2BA 2HIGA 2HTEA 3DF7A 2RHGB 4WLOA 2WTUA 1EFVA 2HLDA 2LDBA 2VJOA 3NWBA 4TQGA 4WUVA 5FOQA 4CKBB 5IJAA 1I4OA 3GDHA 3IRUA 2D3WA 5JRDS 4YMLA 3QBDA 5LL6P 1YU6C 2G6TA 1LDNA 3RWOA 3JV7A 3MWEB 4LRSB 4KV9A 4NXMB 1D6MA 4S12A 2DBQA 5FI0B 3UMJA 4ADSG 3K6SB 1UK8A 3NHZA 3PITA 5KYVA 2V7GA 1MGPA 4JUFA 2FEWB 3GO4A 1PZGA 5E3RA 3GZTB 3L8GA 3OJ0A 4UAVA 5F1KA 1GDDA 1KH1A 3C6MA 4KLCA 3U3XA 3AILA 2HWWA 1HURA 3IMFA 5MHTA 1ZGHA 4JJ4A 2IP2A 4EZBA 4JXZA 1BYUA 3M81A 4KXLA 1XLTC 2BAGA 2ZE6A 2RKOA 5HIMA 1RWQA 2XAUA 2DUWA 2OWDA 1UKYA 1EIZA 5G0SA 4LXTA 4TYYA 2WM3A 1YDHA 4GBJA 1X7ZB 4OXRA 4LNAA 1NRIA 4DBLE 2GEVA 4J29A 4XDHA 4BO2A 1C0PA 3R5SA 3ORSA 1XQWA 4GOXA 2XSZA 2PS9A 3DKVA 4ENTA 5LP6B 2QRPA 4A7PA 4S05A 2GHQA 4L73A 1ZCJA 3S0JA 4AY5A 1F2TA 3ZZUA 4QYXA 4H4EA 2H5JA 3FN4A 1DRWA 1L1EA 5FO1A 2C96A 1BJTA 2RKWA 3EIQA 4TV9F 5H9WA 3CLSC 3NWEA 4B76A 2GBLC 5FWYB 3KJHA 2VO1A 3G3EA 2J3KA 2QDKA 2I65A 2I4NA 2W8ZA 3H4MA 2J59A 1CLUA 2CJPA 2ZT7A 4KW7A 4YCNA 2BFPA 1TZ2A 2HIHA 3I2HA 4HGZA 4E5YA 3EG9A 3RJ9A 1S1MA 4EYGA 5FX2A 2EL7A 4DIEA 1T0IA 4I19A 1G1MA 1NXVA 3IP5A 4G1BA 5TGZA 1QG4A 2P62A 4KE9A 5E0OA 3U2QA 2Q6IA 1DAKA 3H7AA 1P44A 4XJXA 1QF7A 4GZ6A 4DRZA 3T5DA 2VJPA 1DDIA 2ET6A 3OMXA 1FW6A 2F59A 2H3HA 3P2IA 3GRRA 4AO8A 4QJIA 5DWVA 4UXHA 1MABB 1MN6A 1CXZA 2B2CA 4NOKA 1UOQA 4QHYA 3SXPA 4L8VA 3EXHA 3KQTA 4TROA 3V34A 1OILA 1R8YA 1XMJA 1CJKC 1WSWA 5IKEA 3DVRX 3OCZA 1PWEA 2ZRMA 3V2HA 4N5IX 1YZGA 2H5EA 4Y9TA 4QTZA 1GA4A 2OOKA 3C1AA 1Z2DA 1VLZA 4RKYA 3AYZB 1Q50A 1RCTE 1Z7GA 4UOZA 3IPYA 4PYQA 1XQVA 2B6NA 3BF8A 3ET4A 4I4CA 4L51A 1YV9A 4LHZA 2ZETA 3JQQA 4GIBA 4ID9A 1SQ6A 3A9WA 4X63A 1T35A 1RXEA 3MWLA 3R0JA 1ESZA 2Z3VA 3ETHA 2CUTA 1RAIA 1W4CA 2QP3A 2VOEA 3B2QA 3EZNA 4GPIB 4NJMB 5P21A 2BEKA 4COOA 4HWKA 3HN6A 4YI5A 4MKRA 1XMOB 1ZNQO 5F64A 1X2BA 1UBCA 1W1UA 1Z26A 3FNRA 5EIWA 3QNUA 4QTXA 1RMTA 5IJXA 1B42A 2GPAA 3NIGB 1ZGCA 4TMYA 4L6AA 4LJ8A 2N3ZA 2N9UA 1P3Y1 4RANA 4RPKA 3AKYA 4LVOA 4I08A 1UINA 3OJXA 2JI7A 3GIWA 5CLJA 3H2GA 1EP2B 3JAKB 3UMMA 4HN2A 1T2FA 4NZMA 1J8QA 1IE3A 4FGSA 4XYLA 1FUEA 1Y8CA 4LQDA 3T41A 3ZDXB 4A5OA 1NW7A 1UAYA 3LG2A 1HE1C 1ULNA 5FFFA 2X13A 1PZXA 4ASUA 1WZUA 3ZE2B 4J94A 2ZWIA 4D02A 2EFJA 3V97A 2WVHA 1NULA 4GNKA 4D9EA 4KXVA 1TMYA 3ILVA 2R79A 3CKKA 2O48X 2AXPA 5LIRA 1T9DA 1UPAA 1GL3A 1U98A 4IZ6A 3DMHA 1IVNA 1PFUA 2YY6A 2D59A 1DWOA 5HEKA 3GX1A 3GRPA 4CTKA 4KK3A 2ZI9A 1RLUA 2ZIFA 4HNHA 4PZYA 1Z4JA 2LTAA 2H1IA 1TRHA 3I05A 5DNDA 1XTRA 3FCSB 1KYTA 2N71A 2V4UA 1PTJC 4PPYA 5DYNA 2BGJA 5J5CA 3T8YA 3I2JA 3VZDA 4EQ6A 2CMDA 5ALWA 3QHPA 5ILQA 1QTNA 4QQ8A 4JP3A 5CBPA 3I9NA 2OORC 5AW2A 2Q62A 1N5DA 3RUDA 2AS0A 4PZPA 2HJVA 2NUAA 3MGGA 4IZHA 3S2SA 4ZYZA 1R4MB 2VHTA 3CY6A 4J16C 3FPBA 4M98A 4JB3A 3WL8A 3NEAA 1UKZA 4OKNA 4TN5A 3FHJA 1MP0A 4HNVA 1L5YA 2XKJE 4HH3C 2SHKA 3MLAA 4KN6A 3T35A 1UR5A 1QF6A 4J3NA 2HTFA 2NU0I 1V8OA 4DIBA 1CT0I 1SKUA 3Q2KA 2Z56A 4KHPB 1I3MA 2A4MA 1S6YA 2XNKA 1R9NA 1V7CA 5FNVA 4MI1A 3FUWA 1QTQA 1GGKA 4YNBA 3SFTA 3NT5A 4MVJD 9LDTA 2V9PA 3GJYA 4FD2A 3W6PA 3AFGA 5TS3A 2PAFA 4PVDA 1AQYA 2A9PA 1QH0A 3QTBA 4DNQA 1ZUNA 2PUFA 1RS0A 4XWOA 1BWSA 4XZ3A 2WKSA 4CM6A 5H3CA 1VSBA 2DHDA 2ZI6A 3ZOKA 1V3VA 2R2GA 1ZH0A 4QFMA 1GUZA 2XODA 3BKWA 5ALTA 1Y5RA 4A03A 1KDRA 2PFGA 2IWHA 3QLTA 4LWZA 2VTBB 2JFBA 1UQUA 1RJDA 1AHNA 3FSXA 1S01A 4BNWA 2R1VB 4URXR 3OPYI 2GUGA 1U8ZA 4D96A 1TQ8A 3AIKA 3GFQA 4Y0NA 5D8DA 1W4RA 4ZQCB 1GGJA 1UUCA 4D25A 4XWAA 4M1SA 1X7DA 1O95C 3SF8A 2V6MA 2DPHA 1IXYA 2GXSA 1TEXA 5TLSA 2BFBB 1HZZC 1ZH6A 5FBWB 1CNFA 2I4RA 2RK3A 2EOAA 4G1MB 2PIAA 4KL8S 3UTCA 2BUCA 4IHAA 5K3SA 2JLUA 1WTAA 4R2XA 3BIFA 16PKA 1P4JA 1GNSA 5AK5A 5KYUA 1HDLA 4IMRA 4EA8A 4BFSA 3UBMA 1AVTA 1H4QA 2HO5A 4O1MA 3V4ZA 2XXAA 4L0DA 4UAGA 2AFHB 1DBWA 4PHTA 4TXNA 4B45A 1LPMA 3NBKA 3TDNA 1H0SA 2ROQA 4KR0A 3QVLA 1Q77A 2D0OB 2X5XA 4M21A 5EL0A 4ZQHA 2WJPA 1J49A 3GDGA 3G8DA 1VKHA 3MG9A 3PLNA 5IMBA 1CUBA 4QU9A 1W5BA 2G08A 2VXYA 3PIRA 4CQJA 2WB2A 4ZT6A 3UWSA 2GGSA 3JVUA 1VI5A 1G0NA 2YHUA 3ASVA 2CVHA 4IGIA 4R98A 4LY0A 1WULS 1NXWA 5PNTA 1ULKA 1T1RA 3WA6A 1QG6A 1TEHA 3KOWA 1TAUA 1UBUS 1ZHFA 4Z5XA 1IY5A 2PKRA 3ZCQA 3E03A 4P4LA 1DS3I 1T15A 4PO8A 1L0BA 2BM8A 3JYQA 3VVMA 3MUOA 2ONYA 2ZYGA 1KYYA 4L7VA 3WYCA 4TXMA 5CXUA 3EPLA 3IIEA 4BLPA 1OI3A 2WT9A 3WSTA 2ODAA 4JFAA 1CRZA 4ETWA 5J5VA 2W6OA 1SCUA 1QCCA 2BBOA 3T7AA 3DBOB 3E48A 4X84A 1PWYE 2OP0A 3HUTA 1YO6A 2HSGA 1E2FA 4PPFA 5K8CA 1FFYA 1C9YA 3QENA 3S2YA 2ZSUA 3N7TA 3IOCA 4WE3A 2IITA 5JAZA 2I91A 1FLAA 1OIVA 2VQSA 3BFPA 3HP1A 1C9MA 4X3CA 4LXIA 4LHYA 5JNSA 4NYJQ 4QLAA 4DMHA 2H11A 4YMWA 4NFYA 2UVDA 4N41A 2VQFB 1DNPA 4KPFC 4ZN6A 3JALA 4EABA 1KTVA 1TCVA 1U9YA 4Y9UA 2O8EB 3RHSA 4F6CA 2OKGA 2DEUA 3GLIE 4NMXB 3UMCA 4I2VA 4B09A 1N2EA 3A4IA 1GLGA 4POOA 3GMSA 3AY6A 4DPLA 4MB6A 4B4DA 5A4IS 5L40A 3CVOA 4D9IA 3PDNA 1ODIA 5K0LA 2B4AA 2BL4A 2IPNA 1FP4A 2RIPA 2XUZA 3LECA 1JQKA 4RKFA 2OVOA 3I4LA 3NTUA 4XB2A 5LMZA 4S1TA 3DVAA 2WB4A 3K0CC 4AMYA 3S5UA 3NJRA 5F3WB 3AERB 4IIGA 2QTFA 3E3OA 5EVCA 1OAKA 3O4FA 1NN1A 2A78A 2JIBA 3DYBA 3N2GA 1X74A 4YT2A 4M1OA 5ELXA 1WGTA 3U1TA 5LMUB 1DRJA 4GG1A 4L9SA 4M1EA 4YROA 4FKBA 2PJRA 4W1PA 3Q88A 2CNOA 3B9QA 4JCVE 2IYUA 4G26A 5EFOA 2NV2B 1P6UA 3JVDA 2AC2A 4BLVA 5C4MA 1U1DA 5AUOB 5JS2A 2PUDA 3MTQA 3R3JA 1U04A 1UBEA 1G3QA 2DKVA 2WSMA 3CNHA 3FOAA 1U63A 3NRJA 2K2WA 2V74B 2BGUA 3BJIC 3S2GA 2YINC 4OMFG 3UAOA 3HB0A 3RC1A 2H2IA 2L19A 3KSMA 3L0PA 2P3OA 3AF1A 3FI9A 4UFNA 3UQZA 5JAOA 2UVOA 2WIKA 2QN8A 3GH1A 4BRSA 4Z6KA 5JC1A 2XCLA 2RARA 3EJ6A 4WZAB 1LQ2A 3ML1A 2QJWA 4PRLA 3V8MA 4LWOA 3CO5A 1VRVA 3VPSA 3FYUA 1DBRA 4O4LF 4UM8B 5KDLA 3MXOA 3TZKA 2C95A 1ZI9A 3IKVA 4J8PA 1NKVA 2X0RA 1FP6A 1T9GS 2Q4BA 2FEAA 2Q8NA 2I4MA 2LXNA 5T67A 4DKXA 2OHXA 4LE0A 3VBEA 4DAEA 2X5KO 3GAZA 4L95C 4EHNA 1SUWA 4OAQA 4QXOA 4MMZB 1YRLA 2ZRIA 2HHCA 4ZI3A 3D4PA 2HA6A 3A05A 4RHXA 2MINB 3DULA 4EG8A 2O8FB 3ZHYA 4BCDA 2QAIA 4I9FA 5JO9A 1TURA 2AJBA 4W9MC 1JLLB 1OOEA 3IOBA 5EIHA 1E1RD 4D56A 3HFRA 1B73A 2QTMA 2P30A 2Z2XA 3R5KA 2HSDA 4F9TA 1NM5C 2V4ZA 1SD1A 4BN4A 2COKA 2VXCA 3GI1A 2CUNA 2FPMA 1NT2A 2H2HA 2RJOA 2Z5GA 3ID6C 4IP0A 4Q1CA 3UOAB 3WYAA 3LQYA 3WHIA 1PT9A 3W2IA 1NASA 3FIJA 3NASA 2R8OA 1BCRA 1QHHA 2DFLA 5I4BA 3CH5A 1KMCA 2XITA 3BSSA 1ISRA 1KBOA 1YHNA 2DHRA 2EU8A 2FQXA 4P81A 1E98A 5D1HA 3ZHCA 3DJYA 4YUVA 2HO4A 5IXSA 4S1WA 1DJOA 4BX0A 1B7GO 4WGGA 2HYIC 3ORQA 4OEHA 4WBNF 5A1JA 1TJPB 1XI2A 4NENB 1X9IA 4D1YA 3OLZA 5BMVB 4LDNA 1FVHA 3D6AA 2Q3MA 4F6RA 4JP1A 4AQ7A 2PT5A 5H68A 1W85B 2JFNA 3LQFA 4W4TA 3F6RA 4WSOA 3S81A 2PYZA 1EFAA 1Y3IA 2JARA 2QJTA 1ZMRA 4ZC8A 1QGED 3IAS6 2C2HA 4Q1EA 1SXGA 2ZYAA 2X1HA 3QE9Y 1FSPA 4G86A 1BH6A 2MOKA 1NHGA 1SWWA 4NU8X 1KNQA 3OJOA 4XWYA 2MMGA 5FOTA 4BNIA 3QTLD 1LW7A 2Y1FA 4HX2A 2DPXA 3FYHA 3IQXA 2H06A 3CLRD 4PNPA 5DGHA 5FUBA 3RUIA 3MWDB 4J0FA 1SUIA 3RBXA 3N2ZB 4AWAA 1DPGA 3WOHA 2C2KA 1SKYB 1UMBB 2C2OA 2ZRAA 3CX4A 3KFXA 3PPVA 4I3FA 4QASA 1KE1A 3H05A 3I9LA 2ORIA 3FMFA 2CXSA 1Z82A 4I7EA 4X91A 3GLVA 4D82A 4YCCA 5I3ZA 3MEQA 4IRXA 4DBVO 3ZHBA 3FB4A 1MVOA 1K8YB 5A4KA 5EEGA 4EB0A 3LWBA 4MRMA 4O63O 5I01A 1O3YA 4IGAA 3Q7PA 1PFVA 4LMBA 1YL7A 2RAFA 1CTQA 4D2IA 3TMYA 4UE6A 2DBRA 4F1KA 5CAEA 1IAQA 2W2MA 3F4BA 4R8SA 2PVCA 2WZDA 4FHDA 1WMBA 2ID7A 1ZCFA 4IXDA 3ILYA 4ND8B 1JG1A 1YD7A 3TO5A 3OPYA 1WCWA 4ZMSA 1MD9A 1JDPA 2D4AA 2IPOA 2OCAA 2OVFA 4NQZA 1XDZA 4O8ZA 3EQ8A 4RIHA 4Q1DA 2PZEA 4X20A 1KMNA 4F7DA 2CDCA 2P1ZA 2I2CA 4N5LA 5EAIA 2ZP1A 2C00A 4OUDA 1JAIA 5FFNA 4AMGA 4X92A 5DM1A 3T1TA 4JI2B 1HDGO 4PZCA 4A27A 1NA5A 1N2SA 5DU2A 1ZCZA 1FTGA 4LYYA 4E2FA 5A02A 4YS6A 4WKOA 3PP8A 4GZ5A 3TKLA 3GCGA 3UXYA 3NGXA 5KWSA 4KN9S 1U7HA 1KEEB 1VE5A 4L74A 3X2EA 5ITZA 3MTBA 4PN7A 4UHEA 1VMAA 1T6NA 4TGLA 1CUZA 4FGWA 4JROA 2I78A 1Y3HA 1FU4A 1R5NA 4RE6A 3WQRA 5AH0A 3MEKA 1EHYA 1BNCA 1B8UA 2WF7A 4M83A 4B4KA 3NATA 4R8RA 4V0SA 2UZ3A 3GZNB 1T2UA 5TC4A 4EVRA 2VDWA 1GOTA 2DKOA 4N7RA 1M7HA 1ZVVA 2XRMA 4GX1A 2HYDA 1F8FA 3DUFB 4DLPA 5CDGA 3N2KB 4RMHA 1FUKA 1HO3A 1YACA 3HA5A 4K6MA 2H54A 4TV9A 2RHOA 3WP1B 4RTPA 3NNSA 4Y6RA 4LSMA 4IJQA 3T7JA 2GF0A 1A72A 4G84A 2XT6A 1RAHA 5LMNB 4G1VA 5BNTA 4GZMA 2PQ0A 1UDCA 1PJLA 2AFIE 2WA2A 4NNJA 1EFPA 4B43A 1E20A 5FPYA 4CMIA 2F00A 1LRLA 4XGNA 1IM5A 4JODA 3PICA 1BYIA 3W5HA 2Q0QA 1QPBA 2PL9A 8ADHA 4LEIA 2FUEA 4KR7A 2XJ9A 1GQYA 2BLNA 4DMRA 2GNAA 4L0MA 3FNHA 3IESA 1IONA 4ZJPA 5EJ5A 4U0KA 1XZGA 2AX3A 2WWFA 5T57A 1W4LA 4CEJB 4M0UA 4YPOA 2DPGA 2XYRA 3GLUA 5HA5A 3DLHA 4JLWA 3KFVA 4A16A 4A8HA 4AJLA 5CFQA 5L3SA 1N2XA 1MBZA 5MGBA 4ENSA 1JFSA 4UHKA 2C1XA 2CNKA 1PTKA 3GVPA 1KRHA 3HCNA 4CJXA 2YN4A 1PWXA 1P17A 1VP9A 4MR7A 1H05A 1RI5A 4DMUB 5E2IA 1YS2X 1WXFA 1XLWA 3PKZA 3RTBA 4Q3CA 4E5NA 2VKTA 1UMCA 1KDYA 1M0SA 3KLPX 1G8PA 1KXJA 3RUHA 3ZLUA 1WXXA 2QNBA 4IIYA 4LX8A 2WQ6A 2ZM6B 4AKHA 2QTVA 1ORHA 4PGGA 2IRWA 4OA8A 2FEXA 3VZBA 4B8WA 1XDGA 5DLEA 2XCSB 2VNIA 1TBRR 1OXMA 1T5DX 3KJIA 4G25A 1RU3A 2CLFB 3HZHA 4B3DA 1B6RA 1A71A 1XAGA 3G2HA 1MC5A 1BMQA 2C5GA 3A1UA 3EBLA 4QAJA 2P40A 1JHMA 1T1EA 4K2HA 3ER8A 5TDHA 3FLBA 3LKBA 4FHGA 1TBOA 3EOAI 1XA4A 1U7ZA 3AF4A 3RNLA 2P6RA 1KHHA 3F1KA 2ZS7A 1UBKS 3FMGA 4IVRA 4GX2A 2R9VA 1ZMTA 2OK7A 2ERYA 3STHA 4Z9AA 1H65A 2NZ8A 1K3TA 4F8JA 5HOQA 1NXTA 2WZBA 1CHDA 2C9ZA 1AT1A 1JUDA 3ZPXA 1W1IA 3WC4A 2C2XA 1QHGA 3MJCA 2Q3JA 4C4SA 1QR2A 5FORA 2YHSA 3AVXA 2AFRA 1ZM3A 4ZVVA 3QHAA 4CV0A 1QUFA 1EWKA 2HQBA 2IIVA 5KJCA 4WK0B 1RACA 2IIPA 2Q3CA 821PA 2V5VA 3HKDA 3TLYA 1VDZA 2JIPA 3GN1A 4JLKA 4R68A 3TW6A 1O97D 2QNIA 1GEGA 2CJSC 1PS9A 1U8XX 2ODPA 2RGDA 5B58T 3SG0A 4BWFB