5FUXA

Catalytic domain of thymidine kinase from trypanosoma brucei with dtmp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
182
structure length
168
Chain Sequence
b'AHGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIKYTGDTLTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPDVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THYMDINE KINASE
publication title Cell Cycle Regulation and Novel Structural Features of Thymidine Kinase, an Essential Enzyme in Trypanosoma Brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 55
structure length 168
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2016-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00265 TK Thymidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 5fuxA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fuxA01
2Z4SA 1G8HA 3FHTA 4QBGB 4P31A 2Q21A 1A2BA 1XJCA 2XNSA 4OK3A 4AYTA 4PO9A 1BMFD 4ZCMA 3BB3A 1QVRA 5CYOA 2Q0HA 4MRRA 1OFIA 3SJAA 1XX6A 1U98A 1MR3F 4ZKDA 1OB5A 3KKNA 2XSZA 1Y3AA 1UJ2A 1TF7A 1X1RA 4HAUA 3X1ZA 2GNOA 2JJ1D 4DLWA 1ZP6A 3PUWA 4HLQB 2DCUA 1M7HA 4D25A 2CCJA 1W4BA 4IVPA 4V0MA 1S0UA 5EXSA 3DL0A 3W9YA 1US8B 2HT1A 1FTNA 1NLYA 4BGDA 4JKYA 1QHIA 4MKHA 4YMWA 4M1SA 2Z0MA 4ZDWA 1GUAA 2P3SA 1HY3A 4DCSA 4EIWA 2WJVA 5D3QA 5CB8A 1EX7A 3VNUA 4YLGA 5FBVB 1P73A 1G9XA 4EDHA 3C16C 2GVDC 1WRBA 3X2SA 4EUNA 3U3JA 3I5XA 2RGBA 1OH7A 4A36A 1SGWA 1YR6A 1UBFA 2K5UA 4BEBA 2BBWA 1W36D 2UZIR 4B2PA 3GLHB 4GMXA 4W5JA 1PUJA 2QPOA 2RGEA 2ZYVX 2J1LA 2QBYA 2KJQA 4Q00A 3R9WA 1Q1QA 4P4SB 4US2R 2IUSA 5FOUA 3B1VA 2VSOA 5C1BA 4PHFA 2DPXA 2QENA 4O2LA 1KSJA 2J0QA 3WP1B 2FZ4A 2EYQA 4FCVA 1E4YA 4UNPA 1DBSA 3ZIAD 3IO5A 4IOMA 4LPSA 2IYSA 2WSSD 3B85A 4JLJA 2ODBA 1S3SA 2QAJA 4LI0A 2PH1A 1R5OA 2QI9C 2XTMA 1E1RD 4QBHA 4UXHA 1KI7A 1S96A 2IS4A 4LV8B 2NQ2C 4AKEA 4O3MA 3RWMB 1EFTA 1MH1A 1UBEA 4PAQA 2ZRDA 3KFXA 3I73A 2FSHA 1EWRA 1Z6TA 1AIPA 4ZO4A 1E2IA 1UF9A 3W5JA 3SJZA 4LYJA 1XA6A 4R2IA 2O8EA 3TSZA 4JJKA 1G4AE 5JHHB 3QXJA 1Q44A 3LXRA 1ZNXA 4EJSA 3TRFA 2JJ2A 1OLOA 4DC9A 4PZYA 1NKTA 2DFLA 1TU3A 4LYFA 3BJIC 3NBZC 1R5BA 3HYTA 3P4YA 3KY9A 2BKUA 1XZQA 4F93B 1Q1BA 4R9UC 1ZCBA 3SFZA 1GRNA 4LJ5A 1SVOA 4Q4JB 3KQUA 4XWKA 1MV5A 5DE3A 2KBFA 1RRGA 1DE0A 4ON9A 1Z0DA 5IF9A 5L3VA 2AK2A 2RKOA 2V6JA 4URWR 1EFHA 3U60B 4S2EA 2WWHA 2FF7A 1Q0UA 3NEYA 2W2XA 5DHAA 2P5TB 5J4VA 1GZSA 3T5GA 2ENZA 2X1VA 1AZTA 2PZEA 2Z43A 2ONJA 5GADl 3BFXA 2QQEA 2OCAA 1NF3A 3ADDA 4TYPA 2OFOA 3H2YA 3OE7D 3B2EA 5B2ZA 3IBYA 5CDFA 3TIFA 3KX2A 5TXGA 2G9NA 4Q18A 1VECA 3MD0A 4RVCA 5FOTA 3IGFA 2J9RA 3PENA 3T1TA 5G53C 4F91B 1XJQA 1MT0A 2ECKA 5JSZB 2A5YB 1H8HA 2CL7X 1L2TA 2AL7A 4DSTA 4M8NE 3WRXC 1IXRC 3C5HA 2PZGA 4G01B 4WZAE 3U3MA 2W2VA 1WBDA 1U2RA 5SZHB 1C9KA 4FMCF 2WAXA 3RRZA 1R2QA 1KZGB 1UDWA 4EAQA 1AN0A 4YONB 1G41A 2OBLA 4M1KA 1XTRA 4LUCA 5KTYA 1E94E 4NPHA 4Q9LA 2O5VA 3E70C 4M2LA 1FFHA 2B8WA 5JS7A 2VYFA 1MKYA 2BJWA 3MMPA 2FGKA 3UATA 3FMPB 1UFQA 4AKHA 3KKPA 2YUUA 2ZEJA 5BN3A 1ZM4A 3EXAA 1FMLA 2F43A 4KODA 1NVVQ 1XTIA 3CF6R 4JVLA 4OK5A 1FPMA 4BQSA 1XEFA 1VHTA 3QXSA 1ZW6A 2FSFA 3CH5A 4V0ME 3ZLJA 3U4QB 4NYMQ 1PTQA 1SHKA 2VSFA 3AF1A 1G17A 1BH2A 3BK7A 4LC1A 4PAMA 2L0XA 1PLJA 4ABYA 2H17A 4ILEA 4KVGA 5FUVA 2BEKA 2OFXA 1OSNA 4PR0A 2ERYA 2O0HA 3I62A 3UMRA 4IKEA 4HB0A 2A5JA 3CBQA 1E9SA 3V00A 4LOAA 2IWRA 4AY2A 2VHTA 4LHVA 3ZIAA 2VHJA 3IBGA 5CM8B 4BEJA 3VKWA 3U2QA 2WSSA 1GL7A 1W2HA 1XEWX 2ZREA 1E9FA 1ZM3A 2ZU0C 2J3EA 2ZRKA 1S8FA 1P9RA 4LJ8A 4PTLA 1E1RA 1F2TB 1EGAA 2VP6A 1EWQA 2D4HA 5LD2B 4CRWB 3B60A 1R8QA 3TNFA 4E03A 3KXKA 1RC8A 2XJ9A 1J70A 4FMBB 1HUQA 2FSIA 3MJHA 2R65A 2CDNA 5FPTA 3QKTA 4S35A 4TQ9A 4RD3A 1QHXA 4BLOA 2QEQA 3FDIA 2ZE8A 4IJMA 3SZRA 4HZIA 4TMZA 4HZUB 1E99A 4TN1A 3SE0A 1Q1EA 2QGZA 4ERNA 2EVWX 2QMOA 3HP1A 4WW0A 1F2UB 3T34A 5KUTA 3L0PA 1LV7A 3FMOB 4YQFA 2IXFA 1NVXQ 1OFHA 5EXXA 4D0NA 1FNNA 2CJWA 4IVQA 1NJFA 3R7WB 3W34A 4DLXA 2GXSA 4DCTA 4MRSA 3VQTA 3EARA 3K0FB 4JL6A 4UNNA 3TUZC 3AM1A 2PCJA 2GCNA 4DIEA 5IT5A 4NMMA 3FKQA 4D26A 1FMJA 1TUIA 3NH9A 1JPJA 4I81A 4UJ3A 4Q4HA 2QRZA 3ZZ0A 3FHOA 2W83A 3AKDA 4KI0A 4L9SA 2OBNA 4LJ7A 4M9QA 2AD1A 2F7SA 2ZE6A 3EZ7A 5JWOA 621PA 3MWKA 3GEHA 1N6HA 2F1JA 4JLKA 2ZJAA 5KSOA 2FNFX 1KKLA 2ZI9A 3VX3A 5UKDA 3BAFA 4M1WA 4F92B 3L0OA 1S1CA 3BFVA 4PSVA 3BS4A 5LD2C 3A58B 1NN0A 3EA0A 1ODFA 3B5JA 4OI2A 4TT3D 1KI9A 1JJVA 1YJ5A 1T3LA 2G88A 2GCOA 3AQ4A 3I4LA 3IILA 1M2OB 1NY5A 2GZDA 5BQ5A 1IM2A 2ASEA 4OK6A 4CT5A 4TWZA 3CR8A 4PHTA 2HCBA 2DFKB 5J5CA 3WNDA 2ZJZA 4NBSA 4CEHB 1E3MA 5CDFE 5F9FA 3I61A 1AJEA 3HR8A 4FWTA 2ZJ2A 2V7QD 3BOSA 4RSGA 3A1TA 1KI6A 5FUWA 2GJAA 3DO6A 5GJWC 1IN6A 2C96A 3TUJC 3NHBA 4D4KA 3PV0A 5EP1A 4C0LA 2D06A 1J7KA 2EWVA 1CJTC 3KJHA 3UG6A 3CONA 1KI8A 5C2JB 3RWOA 4FXPA 4JLOA 1KMQA 4GL2A 1W4RA 4Z1MA 2ZXUA 2F1RA 3QXXA 4PSAA 5JI3E 3T15A 2NOAA 1ZNZA 1VIYA 2XGJA 1CP2A 2FX3A 4TL7A 4EPRA 1H8ED 1NIPA 5K8IA 1DOAA 3RS0A 2HXYA 3FHCB 2ZS7A 1KK0A 1ZNYA 1CR2A 5AJYA 2JLWA 5KYKA 5FI0B 4FINA 4A15A 1F60A 1JXOA 2CVHA 4NYJQ 4Y0AA 3AB3A 2O52A 4CEIB 5EE9A 1NLFA 3AGPA 4LHZA 1QHYA 4LJ4A 4LWZA 1WMSA 3LVQE 3QG1A 3CZQA 3MWYW 2OT3B 4LJ9A 4HLUC 4TQUS 4B35A 4OJKA 4F4CA 4Q01A 4P3YA 1X1SA 2OHFA 2WOOA 1G3RA 5FPKA 4EFMA 2H18A 1ONBA 1TBOA 4IOLA 1E6CA 2WBLC 2ZE7A 3C8UA 4PPFA 1N6RA 1CIPA 1P6XA 1VPLA 2J7PA 1NL3A 1U8YA 2J41A 3W8NA 3UPUA 1VTKA 1S3GA 2FWRA 2QTHA 4GPTA 3BBPA 4PZZA 1IXZA 2KSQA 4B74A 5M04A 3K70B 1Q3HA 3FMFA 5SZJA 1Z5ZA 3LBNA 1J99A 2ANBA 1AM4D 2WJIA 4J0QA 1Z22A 3LWNA 4BFYA 2J59A 3CWQA 5EE1A 1BO6A 3GJ8A 5C4MA 3LFUA 5CIQA 2QE7A 1YR7A 3B9QA 4LBYA 1KDOA 3QKRA 3OAAD 2ANCA 4M53A 2OZEA 1J2JA 4QHSA 4DKXA 3JVUA 5FL7D 3SEAA 4BRUA 2GHIA 2XNDD 4D6PA 4JLDA 4JMPA 5FOWA 1QHSA 1EXMA 3SJCA 2ZI3A 1TADA 4TYWA 2NGRA 3U7HB 4U00A 2G1JA 1CRPA 1XEXA 1ZM2A 3L0IB 1W0JD 2IX3A 2FE4A 2WWGA 5TV2A 2G6BA 5FPYA 1Q1ZA 2IK8A 1W4CA 2XZOA 3OIYA 3KJIA 2VA8A 2A2ZA 4PPQA 4Q9IA 2QBYB 1BS1A 4QRHA 4KJZA 4B3CA 4HUQA 2J0SA 2VLIA 2FH5B 1GFIA 3QY0A 4TSFD 4A1FA 4HUTA 2JATA 2Z83A 2REXB 3N70A 1FOEB 3I5YA 2ZRNA 1X86B 1HYQA 3SU8A 2AFIE 1T9HA 4TT3A 3LLUA 1X3SA 1JEDA 2OM2A 2PLFA 3H84A 1F6BA 4P0TA 3R9XA 4TL8A 1YQTA 4AD8A 4CT4B 4RY2A 2IUUA 4PHGA 1UAAA 1FX0A 1FARA 1A82A 3EX7C 4C4PA 1YZGA 2ZYUX 5CM9C 4LSGA 3L8YA 4WBSA 2R6DA 4HAXA 2JLSA 1J90A 5FBRB 4XD7A 1G7RA 3WBKA 2V7QA 1W44A 3KUDA 4LBWA 4A0HA 3F8TA 2O8EB 4X8HA 3OEHA 2YYZA 1I4TD 1IN5A 4D0LB 4EJSB 5K8LA 4GP6A 1SULA 1Z6GA 2CL0X 2BV3A 4G5RA 3GP8A 1CF4A 4AK9A 1Z83A 3E2IA 3BGWA 4MKGA 3TUIC 3GLIA 1E9EA 2CCKA 1G21E 3LX8A 4A2QA 2RMKA 3MWJA 1T3SA 1P7CA 3LO5A 4Z51A 5J4LA 2A78A 3UFFA 1KK1A 2XOKD 3GJ5A 1ZCAA 1H8EA 2ZAOA 1JAIA 3TAHA 5CITA 1JR3A 1KAOA 1VCIA 4OQXA 1T5LA 4TLCA 1CJUC 5AUPB 1MO5A 3QUSA 3WNCA 1JQLB 3CNLA 1UKEA 1XB2A 2HCJB 4TZ6A 1QHHA 4G5QA 1ZD1A 2ZTSA 4PO8A 4V0OA 4JT2A 3Q9LA 1MO3A 1Z6XA 2R62A 2EU8A 4IXNA 2HT6A 3W6PA 4H9GA 4L16A 1TF2A 2HEIA 3W90A 4URUR 4B2LA 2LKCA 4DLVA 4CVNA 4C3ZA 5EZ5A 2YHSA 3TW8B 4L8GA 2CLDX 2HV8A 4GP7A 1JEEA 2IL1A 4Q4AA 2C04A 2HJVA 4B3XA 5KNCA 5EP4A 2BM1A 2XSZD 4QGHA 4PC6A 4WIAA 3ZQJA 4JVMA 2WVJA 1GTVA 1I4DD 4HAYA 4R71A 5D3MA 4QHTA 1L7VC 2B21A 1OFTA 2GCPA 1NLZA 1VYUA 3GLFA 1GVNB 1MRSA 1OXUA 5LDDC 2ZI7A 2FPKA 1N25A 4IOKA 4V02A 3RNLA 4Q7JB 3QJYA 1E9AA 2QSZA 1OKKA 1O3YA 4BFXA 3KJGA 1DAKA 3HPRA 4FKDA 1LS6A 5JS8A 5JLJA 1G7TA 2PX0A 3OEED 3WMEA 3OAAA 4EQ6A 2RHMA 1ZC4A 1CBUA 1P72A 2P65A 4XVQA 1OH5A 4OI0A 1GL6A 2F43B 4QJ5A 2QPTA 4OI4A 2XNDA 1UKYA 1YZKA 3BERA 5TVKA 4A2WA 3BB1A 4OHXA 2QP4A 4QBFA 1ZJ6A 3LAWA 1NMYA 3CUEF 2NO7A 3CX6A 4PC3A 3SDZA 2YWEA 2ZRLA 1E1QA 2GF9A 2IC5A 2Z5FA 4Q7LA 1AQYA 2WWYA 2Q9BA 3SR0A 4CGZA 4PQRA 4LY6A 2BOVA 1CXZA 4M0LA 2C77A 1RFLA 4ITRC 1DAFA 3IPXA 4JL5A 1TNDA 1U9IA 2IYXA 1E79A 2ZROA 4TSFA 1SVIA 4MDFA 4NYIQ 2IEZA 3Q85A 2IYTA 1X6VA 2NPFA 4DBLC 1E2KA 3KFVA 3EIEA 1AKYA 3PEWA 4B3FX 4KBFA 3QKUA 4I4LA 3K09A 3BXZA 5C18A 3IUYA 4QXAA 2J45A 3O8RA 1Q3TA 3RSOA 3D8BA 2IYRA 4TL9A 4YMVA 3ZGXA 1YU9A 1U90A 1COWD 1K6MA 1BOFA 2NTYC 4ZPXA 3LW8A 5JCPA 3P26A 2ZRAA 5TMPA 1KAGA 2AXPA 1FZQA 2QMHA 5DI3A 4B73A 4LC0A 4X8OA 1CU1A 1ESNA 1IHUA 2W2TA 4Q1FA 5CJ2A 4DB4A 3U61B 1EG7A 2F3RA 3BIFA 1WP9A 3U7GA 2OLKA 4JLAA 3SBDA 2ZS9A 1ZD9A 1II8B 3LX5A 3U3KA 2DY1A 2QT0A 5CK5A 3L82B 2QY9A 1G19A 1H65A 3H4MA 1OIVA 2CJWB 3L0SA 3DM5A 4MRPA 4FMDB 4BLQA 1EESA 3CF0A 3K9GA 1NBMA 3IIMA 3WMFA 5AK0A 2OUKA 3PR1A 4Q4HB 4C7OA 5C46F 2GXQA 1RYHA 2GBLC 2IT1A 2IYLD 1L4YA 2N1BA 3IQXA 5CB6A 4WXPA 3VR2A 4BZPA 1DPFA 1P61B 4W7SA 5P21A 1FNMA 4DWJA 1SQ5A 3TMKA 2R6AA 5KSZA 3PG5A 3A1SA 4ZKEA 4B3BA 2CHGA 5AUQA 3BB4A 1JR3E 2HXSA 2A5FA 5H68A 4Q48A 3W3ZB 1H8HD 2P0EA 4N3NA 2ZR7A 2GCOB 5LBIA 1XNJA 4GNKA 2ZRIA 1HA3A 1UEJA 3ZS8A 1IN7A 5B30A 2XTNA 1ZC3A 2RH5A 2NO1A 1Z28A 4IHQA 3SNHA 5H70A 2ZR0A 3TH5A 1IN8A 1K5DA 3CRMA 4OQNA 4F38A 1YZNA 4B76A 4JZKA 1RYFA 4FD2A 4MGZR 1KI6B 4TYQA 2ZETA 2X2FA 3DZDA 4W5WA 2W6IA 4PSKA 2O8DA 3PUVA 2HYIC 2NO6A 3OEEA 1Z63A 3ICQB 3K9LA 5E7JA 1YZQA 1L8QA 1OIXA 4M21A 4FN5A 3VX4A 2ZYTX 3OESA 3THXA 1G18A 3W5IA 4DDUA 2ZRCA 4HDOB 1KO8A 1KK3A 2WMOB 3GLFE 3DHWC 1U0LA 3GJ3A 3KJEA 2ZRBA 4GI7A 2VHCA 2C99A 1P2SA 3FTQA 5CIWA 5BN5A 5DISB 2VIIA 1DAMA 4A8JC 4M1TA 5F9HA 1WCV1 3CRQA 2PT5A 3LXXA 1U0JA 3W6OA 3B6EA 1SVSA 5JBQA 3C41J 2AK3A 3DMDA 4IDNA 1EFRA 2C2HA 5HZKA 1SKYE 4KBGA 4ZI3A 4QBIA 2OILA 2CCGA 3EC1A 1DADA 2ZSBA 3CRRA 3GD7A 1W1WA 1XTQA 2YJTD 4NONA 4KSBA 3RDPA 2JCSA 2EW1A 4TMKA 1COWA 4L9MA 2FFBA 2AKAB 3QF7A 4MYUA 3UG7A 1KBFA 1EX6A 4QOSA 3BORA 1WE2A 2GEVA 2HF8A 1K8RA 3QPUA 3HDTA 3ZVMA 1DAGA 4PPNA 4XH9B 3EWAA 3K53A 4POAA 1D9ZA 3SOPA 3VMFA 2ZI6A 2N42A 2IYZA 5J4YA 2WIBA 3R9IA 2JLVA 2VO1A 5E7IA 5E7MA 1KHTA 1S9HA 4ZCIA 1N6KA 1YZLA 2J0UB 1G64A 1P75A 5E95A 1T5IA 3GPLA 3B13B 4GDFA 1P60A 5B58C 3FE2A 3M0EA 3UANA 3RC8A 2GZAA 2WIAA 1M6NA 1ZAKA 2BMFA 2KE5A 3QKRB 4GZLA 4NE2A 5H1YA 3NDBB 2J87A 1FUUA 1D5CA 2ZUDA 4IVRA 2A3RA 1KO1A 1X8LA 5FTJA 4LJ6A 3AKEA 4L4UA 3KQLA 5A5GA 5K8TA 1G3MA 2GEDA 2DYKA 5FUYA 4DEXA 2DB6A 1XMVA 3DVLA 4DUGD 3ZJYA 5TY0A 1XEXB 4YDSA 2TMKA 1KI1A 4TMXA 1P2TA 1AS3A 3MSXA 3NHAA 3WRYC 2CNWA 3RRNA 2P6RA 1LS1A 4C0BA 1RFHA 1KDPA 4NP6A 5IHPA 2GAAA 5JZVA 1ANKA 2R9VA 1CR1A 1Y63A 4HUQB 2FA9A 3W6NA 1XJ0A 4DJTA 4IEEA 3MRSA 1ZM9A 4FCWA 3GJXC 4WVFA 2OSBA 5A0FA 1G16A 4AURA 3QENA 3B1XA 1OE0A 2ZS8A 1NBME 2YV5A 2JIZA 5J4HA 3EPHA 3QQ5A 3GEEA 2DFTA 4TLAA 1N0VC 3PUXA 4JBXA 2XXAA 1ZMXA 4BE7B 3A1WA 3EA5A 3VR5A 1KKMA 1J8YF 1Z0JA 1FX0B 2AXNA 3EIHA 3W8RA 2C9CA 4D2IA 1LNZA 3E5HA 5BXQC 2WKQA 3CX8A 3LY5A 2W0MA 4TQAA 4B71A 3SN6A 3CXLA 4Q7KA 4ACAA 4AI6A 4GRAA 2IYYA 4U7DA 1E2LA 1E9BA 2BCGY 3REFA 2YOHA 2OCYC 2GF0A 4LDJA 3ECCA 3S1AA 5AJZA 4LRWA 4TMTA 2F6RA 1CJMA 2PEZA 5E3HA 3VR1A 4Z1MD 1SZPA 3RRYA 4UQOA 2FNAA 1XTSA 2AHOA 1HH4A 1RPZA 2IS2A 5BYKA 5H8WA 2FMXA 5CK4A 4Y0VA 4FI3C 3H86A 4Z8YA 2FFAA 4L15A 5ANRB 3LBHA 3HU3A 3T61A 2V1XA 5HE9A 1UBCA 4F4IA 4KSCA 2D7CA 1VKJA 1Z29A 4G5SA 3L43A 3OZXA 2FGJA 2DB3A 1U81A 1O87A 1QHHB 1NSTA 3FKSA 3KB1A 4TLBA 2HJGA 1NSFA 2AWOA 1E96A 2GBLA 5AR1A 4DVGA 1CJKC 2KB0A 5C4GB 4EKDA 3FOZA 4ZIRA 3R8FA 2Q9AA 1UKZA 3QEOA 3VAAA 1W46A 5BYJA 1OF1A 1IBRA 2XITA 3PEUA 3QBVA 4FW9A 4A4DA 3NVAA 3P20A 5L3SA 2YWFA 3ND8A 4Q4AB 1KMHB 2BKEA 2J7PD 1KI2A 5JRZA 1GRQA 2DWOA 1ZBDA 3SHFA 1YZTA 2XZLA 2GWHA 3DPUA 1N6PA 2CMKA 3ND9A 5JEEA 4US1R 2CLSA 3UXMA 4ESHA 5TB5A 3GLFB 1IY0A 2QM8A 4RJLA 3P1JA 4IFBA 4XTRA 3AUYA 1G7CA 5CYPA 4KCGA 4HYYA 5AJXA 1P62B 2VRWA 4NZYA 3JZAA 2H16A 3U6BA 3SQWA 1OXVA 1ZU4A 2QE7D 1M8PA 4FMCB 4NKRA 1G7SA 2QMUA 5TARA 1OH8A 4RZXA 1EFCA 3ADCA 1UDXA 4EQ6B 1R79A 3H1TA 1XZPA 4Z8XA 2FFHA 1OJLA 4HAVA 2YZ2A 4E09A 1SKYB 1JAHA 1N0WA 1N2CE 3K0AA 3ADBA 4KU4A 4CIDA 4DUGA 1D2MA 1Y8FA 2I1QA 4TTRA 3SFVA 2CLCX 3ZDQA 4RCZA 1W4AA 2ODWA 5FUXA 2FEOA 1GKIA 3AF2A 2EFGA 3LDAA 2JLZA 2E1RA 4M1OA 4CDGA 1N6OA 5IK2A 1CR4A 2Z4RA 1YHNA 3NKVA 4HAWA 4ZDKA 1XD8A 4ZDJA 4M9XA 4A8JA 5JEDA 1YR8A 3GJ4A 4KITB 1PLLA 4KO8A 5HCNA 2D3WA 1OH6A 1XBTA 2ELIA 4LHYA 2O8BA 3QXCA 4ZI2A 1PLKA 2OV2A 2VHUA 5JCZA 4W9MC 1HV8A 3CPJB 4XWAA 3THWA 1LB1B 4TMVA 1W0KD 4JVNA 4QM6A 2GJKA 1E2HA 4OHYA 2Y8EA 3RAPR 3EC2A 4RKEA 1IY2A 4RFSA 4MITA 3THOA 2ZRPA 4DLUA 3RC3A 3IHWA 4H1VA 5JHGB 4YMSA 4KHZA 4AKIA 1NG9A 4XD7D 1PVOA 3C5CA 1G3UA 1D2NA 3U6KA 1TMKA 4A0RA 5DI3B 3OEHD 4OQMA 3UGIA 2QNRA 3LD9A 2H92A 3MJRA 4XSGA 2ORWA 4QNMA 4JBYA 2YKGA 1OXTA 5JRJA 4KXFB 1MO6A 3A1UA 5L3QA 4AKGA 4C2UA 421PA 4A82A 2FOLA 4M1MA 2D2FA 4TTQA 1GILA 2PLRA 4PC1A 1JECA 1LVGA 1A7JA 1YE8A 2IA5A 1GNRA 1QZXA 4LK2A 4US0R 5KU1A 4BFWA 3NBYC 1VCOA 1JR3D 4PC7A 2IF2A 4AYXA 3MG9A 2WPDA 3LW7A 4HLCA 3JVVA 1U9IC 1KO4A 1Q20A 2V3CC 5F98A 4XWOA 4A6PA 1TX4B 3AVYA 3J81k 1HURA 3D7MA 1Z0KA 3WY9A 4ZDIA 1CS4C 3K09C 2MMGA 4OKSA 4OYHA 3X1YA 3PJRA 1P9NA 2WJJA 1SXJC 3AP1A 3U7EB 4G5GA 1KJYA 3ZZUA 3X1DA 3K0SA 1Q21A 3GLHA 4KLNA 4I1VA 3DKPA 2WSMA 2XB2A 3I1FA 2QL6A 2IF0A 2XZPA 4TTPA 1MRNA 3D3QA 3ZD6A 2CK3A 2QAGC 3DM9B 2ZAMA 1ZRHA 2ORIA 1WA5A 4UNQA 1NN5A 2LWIA 5GVSA 1S1MA 3AVPA 4DCVA 1IQPA 1ZUNB 2WJYA 2HDNB 3B9PA 4Q9JA 4GMDA 1GM5A 3QE0A 1PV4A 1OYYA 4N0EA 1LW7A 721PA 1GP2A 2X19A 3LQRA 4PQYA 4DT1A 1OKKD 2V54A 5FOSA 2H1LA 2O8DB 5KPJA 3HU2A 4OJQA 1WBBA 3GFPA 4U5XA 4PQFA 2GXUA 2V1UA 1KZ7B 4XVRA 2JGNA 1YKSA 2ZRFA 2YINC 1KSFX 3THXB 2O8FA 3EW9A 2WKRA 2DR3A 3P4XA 3BRWD 4MRNA 4B48A 1E1QD 2ZRGA 1WXQA 3QVVA 2F1HA 2ZSAA 4DLSA 1E0SA 4BFTA 4JLNA 1KSHA 3Q8XB 3A8TA 3ICEA 1JNYA 4MUAA 2JAQA 121PA 2GJSA 1G5TA 1DARA 2BIFA 1NVUQ 1R0YA 3EASA 1NMXA 2A5GA 3T35A 2GXAA 4TLEA 1NRJB 3AKYA 1B0UA 3UKDA 1E79D 4TMWA 4C2TA 5L8VA 1KNXA 3B78A 3FFAA 4B47A 2C9OA 4DSOA 3CPHA 4B3DA 2OCPA 1G1MA 3IHLA 2IHBA 5DGXA 4JBWA 1W0KA 4AWXA 1KO7A 1SXJD 1FW6A 2ZVPX 4RZ3A 1KBEA 4NCIA 2IWHA 5JMTA 4P4UA 5DYGA 2V8OA 1AS2A 4BPBA 1OHHA 4HATA 3QPVA 4II7A 3FPAA 1NMZA 1P3JA 1TU4A 3KTAA 4NDZA 2D74A 2EFCB 4DCNA 1R7RA 1GKYA 1ZUHA 1CJVC 3WHKA 2BMEA 5HZHA 1XD2A 1LFDB 1TQ6A 3GJ6A 4I1OA 3AEZA 4MGKR 5FBLB 1PUIA 4DDTA 3DOEA 1N0UA 1G8PA 1Z08A 4B33A 1T4GA 4EPTA 4IOJA 1RE0A 1FUKA 4XOIA 3E1SA 5J47A 4CZ2A 221PA 3Q3JB 1BYUA 5CLLA 2ZU6A 4KVAA 4KFUA 3O8CA 1E2PA 2LCFA 2RGXA 2ODNA 4LX0A 5JJLA 5AUNB 1OV4A 1L4UA 4QGAA 2D2EA 3NEJA 5G3ZA 2WZQA 4JS0A 4LGMA 3VKGA 2YC4C 1NBMD 4URZR 4GBMA 3THYA 1B23P 2IEYA 2B7CA 5HCIA 2ZVQX 1S2MA 3ADKA 3RS4A 1JALA 4X8LA 2BBSA 3SS8A 4DDVA 1BKDR 1PTRA 3CRVA 4JIMA 1VCNA 2BWJA 3KQNA 3TSWA 4NH0A 4G0NA 3R8CA 4HAZA 5DO9A 3BH0A 2UZ3A 4D82A 1GAJA 3EZ2A 4B75A 3GLGA 4DLYA 2VQSA 4XJXA 5EE0A 2GTPA 2FZLA 3ASYA 1E2NA 4F7WA 5JI2E 2RAPA 4IEIA 1UBGA 2E9SA 3RRMA 4A2PA 2CL6X 1XRJA 2OAQ1 1FP7A 2GJ9A 3AH8A 2JLQA 2OESA 3B1YA 5G40A 4PANA 1Z2AA 2MSDB 3IEUA 4TYNA 5SZKB 3CPEA 1G3QA 1ZM7A 1F3OA 4WAUA 5GJVC 4B3GA 1XEWY 5JECA 1DAHA 3AGQA 5KOYA 1EFUA 1XD9A 1E0AA 1TBNA 1UKVY 1E0KA 2R6GA 2YC2C 4QC2A 4B34A 1ZVQA 1R4AA 2JA1A 1IONA 3FGNA 1JB1A 2W6ID 4Q47A 3UK6A 1F2TA 4BFZA 4BUJA 3OIVA 1NY6A 3ETLA 2CEAA 3TGPA 2N46A 2FFQA 4NU0A 1ZIPA 3G5UA 5KPDA 3S1AB 3FMIA 5DHFA 3LH5A 3T1VA 2CHQA 1T0HB 2V6IA 3MWLA 2HUPA 2WHXA 4NTZA 3LLMA 1R6BX 2ORVA 2H7VA 2VSXA 1P2UA 4LJAA 1AA9A 2QROA 4G5OA 1W47A 3GCGA 3QEJA 1XCPA 2ZSDA 3QPWA 4MUBA 3ZQ6A 4M4SA 1C4OA 4V0KA 4IW3B 4Q1AA 1P5ZB 1AGPA 1EK0A 5FH9A 5GJBA 3CX7A 3UIEA 1IOZA 1XXHA 4Q1CA 2QUZA 3GJ0A 3NH6A 2YOFA 4Q66C 2NG1A 1EFRD 4C0KA 1QHGA 1I2DA 1LY1A 2ZANA 2QGNA 4ZIRB 3FB4A 1KY3A 1R0WA 4AC9A 4EPWA 1JBKA 3LQQA 4BASA 2P6UA 2JASA 4FWIB 1RKBA 1SXJA 3QKSA 1TQ2A 4DLRA 3CZPA 2YNMA 1Q22A 5L3SB 2I1VB 5DIFA 2OEPA 5CJPA 3MAAC 4CEJA 3DZ8A 1V43A 4V03A 1R5NA 4JJZA 1UADA 3EPJA 2QAGA 1QDEA 2JDID 1DAEA 2VTKA 4RKFA 4LHWA 2GILA 3MLEA 3OF5A 1N5IA 2BEJA 4WA7A 2X2EA 1ZD8A 2A9KA 5AWFC 3UWKA 2VRWB 3OIWA 1XCMA 3B82A 3IO3A 3K0CA 4Q9KA 2NO9A 4C0AC 3U44A 1FQKA 1SVLA 2FSGA 3ASZA 2F9LA 2WWWA 3HPQA 1RRFA 3U5ZB 1MABA 2G3YA 3EAQA 3M4YA 5TDHA 3GMTA 4X8MA 4IRUB 2YOGA 3B1WA 2ZUBA 4H1UA 3K0AB 4OL0A 3OHMA 2DWPA 3CIOA 5CLQA 3OFNA 1KOFA 1ZINA 2V55B 1KYIA 3CB4A 2OXRA 3VR4A 4DCUA 5HR5A 1P4SA 2CNWD 4RD0A 2ZPTX 1N5KA 1E9DA 1XTJA 3GLIE 1QF9A 3T1QA 1Q12A 1TQ4A 2B6HA 2A7QA 1W36C 4PHHA 1R0XA 4A8JB 4YMTA 3QF4A 4K81B 1T0JB 2GAOA 4KYIB 2PJRA 3K0EA 3EG5A 3PUZA 3CR7A 1ZU5A 4MYCA 3TSOA 3PCRB 4KFTA 2H57A 4BECA 2WOJA 1FQJA 1HQCA 4I1UA 3THWB 3NWJA 2JIZD 4LZZA 2PCLA 2PJZA 1NKSA 4BLTA 1GSIA 2ROWA 1VCMA 2QTVB 4LV6A 2ZQ5A 2VHQA 4RFSB 2QRNA 2BBOA 1A4RA 1SHZA 1W5SA 2NZ8A 1DAIA 2ZRJA 4G1UC 2B92A 4GOKA 4A0GA 4B32A 2RGDA 3KXIA 1IJFA 3Q5DA 3GLGE 1Z07A 4YC7A 3PVSA 4IDQA 3QI2A 5GJCA 2UVQA 1RJ9A 3EIQA 4JLPA 2LKDA 2IYVA 3RS2A 2O0JA 2YWGA 3NIBA 2FPLA 2H5EA 1TTTA 3CRW1 4ACBA 3A1VA 3O47A 4HSEA 4P33A 5KNDA 5L3QB 5FPSA 2WICA 5K8UA 3O8DA 2ZJ5A 5AJVB 2DWQA 1N6LA 1KDTA 3IKJA 4E5UA 2QM7A 1TAGA 2G1KA 3BFKA 5EQTA 3U7FB 2IYWA 2G0NA 1T8UA 2VP9A 3ZH9B 1IAQA 4Q1DA 3SYLA 2GVZC 3KZ1E 4GT1A 3X1XA 4JLVA 3SHWA 2RCNA 1DG1G 1ZYUA 2NPIA 3AVUA 4GOJA 1V5WA 2OLJA 5FTNA 5EXTA 1G291 3B7GA 2JLRA 4IDHA 3VU9A 5KDLA 4KLZA 1OPXA 1P9WA 2ZR9A 4Q1EA 1VG8A 3TVDA 3FKSD 4HEJA 3UGLA 1E4VA 3Q72A 2ZI4A 5JJIA 5KSYA 1KIMA 2AD5A 4QHYA 1CTQA 1G8GA 1SKQA 2Q6TA 2J5XA 4A6XA 4TZ0A 1KO5A 3WNBA 3L8ZA 1E2DA 1KK2A 1E2JA 2EWWA 4LYAA 3AVVA 2W58A 1Z06A 1GKUB 1Z0FA 1NG1A 2V9PA 1VIAA 4GFDA 5ELXA 3CKLA 3TQFA 1XMJA 3KQHA 3VNVA 2DFNA 3K1JA 2GA8A 4DHEA 1QRAA 2AKYA 4RD6A 1XXHE 2CHVA 1E98A 2ATXA 2CBZA 2GESA 2JDIA 2BHRA 3SYNA 4OQLA 1OXXK 3KXLA 1XF9A 2OXCA 3ONWA 1Q57A 3DDCA 3O8BA 4KYUA 4PO1A 1LF0A 3ZVLA 4DT1B 1SXJE 1DS6A 1HQYE 4MH0R 4O0MA 1G6HA 3AF0A 3MUFA 4D4JA 1K5GA 2PT7A 1D8TA 1PJRA 2SHKA 4HB2A 3I72A 4ESVA 1U0HC 2I4IA 5SZIA 3G0HA 1E0JA 1MO4A 4B43A 1KI4A 2PX3A 2O8FB 1Z0IA 4MKFA 2Q3HA 5DH9A 3HYRA 3SBEA 1KSGA 2E73A 4NCHA 3RYTC 2DHRA 5DN6A 3U3RA 3WXMA 1G5PA 4L5BA 4EPYA 5DYIA 4XTCS 5FOXA 3VR6A 2G0TA 1YVDA 3V9PA 5IK2D 4C30A 5G3YA 3WYFA 2X8AA 4M1YA 4PZLA 3CH4B 2BJVA 5F2EA 4Z54A 2AR7A 3F5FA 2CE7A 2MMCA 3QXHA 1W49A 3T5DA 3TKLA 1KDRA 1KI3A 4HDCA 1GG2A 2A5DA 4ASUA 3WYAA 4W5HA 4C0QC 2VF8A 1W5TA 2O8CA 3ZVRA 2R6CA 3UEYA 1R8SA 2FG5A 1G3IA 2REBA 3IIJA 3ZZTA 3QNUA 2JLUA 3PUYA 4RZUA 2JJ8A 4UNSA 1QBKC 1NVVR 2ATVA 2CXXA 5J40A 1XCGB 4RD2A 4UJ5A 1IN4A 2VF7A 3KTAB 1Z3IX 3EPLA 1BMFA 4R2HA 4LPKA 1RZ3A 3QVUA 1BYIA 3REGA 1DEKA 4KFRA 3ZVNA 1XD2B 2ZJ8A 3OIUA 2WTUA 3VKHA 4NYMR 2GK7A 1N6NA 2OG2A 4JKIA 3TW4A 1XTKA 1UM8A 5E4FA 1C1YA 5JWHA 2JJ1A 3FVQA 4BLPA 5LPNA 3GLIB 2QZ4A 4GSYA 3TLXA 1TF5A 4B2IA 5JJKA 2ZJOA 3C4JA 3TQCA 4Q03A 3SQXA 3UMSA 2AWNA 4KFSA 2QP9X 5L3RA 3RS3A 2W6JD 2NMVA 1M7BA 1E9RA 4BFSA 4QG7A 3CW2A 3ZD7A 3EZ9A 2IYUA 3KDSE 2WPDD 3L2OB 2RGAA 4HDQB 3QBTA 1KJZA 3BH6A 2OO7A 4P4TA 1GWNA 2D62A 1G8FA 4BZQA 3THYB 2DBYA 2NO0A 1JQJC 1RVDA 1AGRA 5KSPA 3CNNA 4NCNA 2GKSA 3QIAA 1XMSA 5FTKA 2XTZA 5FPHA 4F4JA 2BMJA 3UMFA 1N5LA 2C78A 5KNBA 3RLFA 3GLGB 3MFYA 2A30A 5BWMA 4DB2A 4ARZA 1CEEA 1KY2A 1NN3A 3K9HA 1CLUA 4URYR 3TK1A 4JL8A 5BW8A 1KTVA 1VG9B 1F5NA 2CK3D 1N5JA 5FI1B 1W2GA 4C0JA 3GQBA 3EWSA 1U8ZA 2KWIA 4N1AA 1P2VA 4UKDA 5D3MB 3RHFA 5FL3A 2WWIA 3GEIA 1DELA 3VR3A 1JR6A 4GZMA 3NDPA 3LA6A 5JFGA 1HT1E 2R2AA 1GOTA 4IDPA 1DVRA 3IQWA 2FPMA 2C5LA 4C0SA 3M1IA 3WMGA 4CYMA 4RCYA 1CULC 4BLSA 2P5SA 2GZHA 2PMKA 2J7KA 3IPYA 1YRAA 1E32A 2XX3A 2EFHB 3T12A 4OBEA 2RGGA 4A9AA 1XPRA 1WDTA 5A4JA 4XVUA 4DZZA 5B64A 4Q5IA 3MCAA 1WF3A 4R98A 4YXWD 5FR2A 2RGCA 1Z8FA 3AKCA 4MKIA 1D2EA 3C14C 4KV9A 2D7DA 2BC9A 1T8TA 1TUEA 1X8KA 2EQBA 1HE1C 3KL4A 3C15C 1II8A 2RGNC 3QG5A 4JYCA 1SVKA 4V0LA 2JLYA 3T1OA 4B6EA 2QQ0A 1XU4A 1WB9A 5HPYB 1VHLA 2ZJYA 3N2EA 2BDTA 4O2RA 3TR0A 4AIIA 3K9NA 1GRRA 1XXHB 4MGIR 4IDOA 2W00A 2FDCA 1II9A 5EXPA 4Q7MB 1ETUA 4CF7A 2KBEA 3PXGA 3Q7PA 3NBFA 2OE2A 3LBIA 4PPGA 1NJGA 3NBXX 3TVTA 3FYHA 2F3TA 1NNEA 4WZ6A 2JEOA 1G8YA 3DEFA 4GOXA 1SXJB 3QKSB 4JSTA 1Z2CA 4PX9A 1DTSA 2GJ8A 3NXSA 2FN4A 3OE7A 3RS5A 3F0TA 2P67A 3P27A 4LBVA 5EUQB 2VPPA 2IUTA 4CEJB 4LJYA 1OHHD 3AUXA 1VDZA 4QFMA 4QL3A 1HTWA 3CWZA 2QAGB 2QORA 3V4FA 4C0HA 4RZ2A 4UNRA 4WZBE 3BE4A 3TJZA 1R0ZA 821PA 5LB4A 1T3HA 2OBMA 3I92A 4TLDA 3CNOA 4D80A 1KNQA 1XWIA 4NCJA 4M9ZA 2Q3FA 3P32A 4PFSA 2CVFA 3IIKA 4QGFA 3UGDA 2GVIA 3H0KA 3RVBA 3EZ6A 4NYJR 2UKDA 3AVOA 3U44B 1HT2E 1M1YE 4DLZA 5FBQB 1MABB 2AX4A 2IW3A 2W6JA 1G20E 3R20A 4IFEA 1US8A 1TPZA 2HLDD 2AN9A 2XAUA 1SVWA 2R6FA 2PBRA 3PIRA 3WHLA 5HKKD 4HB3A 4NHOA 5DI9A 4C7OB 1UEIA 2ZSEA 3I8SA 1AQUA 1KJWA 1X8JA 1FAQA 1R10A 2IXGA 2J46A 3FWYA 3BJIA 4JSYA 5J4KA 2NZJA 3KKQA 1RRPA 2B8TA 3Q5EA 3LV8A 1VG0B 4PXAA 2C8VA 5KDDA 1DO2A 1VMAA 1A5TA 2IXEA 1PZNA 1QHNA 3FFBA 1Z0AA 4JT4A 3QF4B 3IEVA 2ZE5A 4URVR 1ESMA 5G41A 4D0GA 1NP6A 1NN1A 3A6PC 4OI1A 3IDQA 3SJBA 4P4SA 2GEUA 2QA5A 2FJUA 2WKPA 2NIPA 3K8YA 1M7GA 1AK2A 1YRBA 1S4QA 2W0SA 1QVAA 1NIJA 1GITA 3K0CC 4UXJA 3RSLA 4YMUA 2VEDA 2QU8A 6Q21A 2VBCA 1NVWQ 1UPTA 3NC1C 1RJ9B 1T91A 5AJWA 2ZITA 3BH7A 3N2IA 4BFVA 1IY1A 1JXMA 1OIWA 3G82C 3UEJA 4Q19A 5IDVA 3AVTA 4DLTA 2ZUCA 3TAUA 3B8HA 3PEVA 4QJ4A 4YXWA 1OFUX 4D4MA 1Z6YA 1JI0A 1E2EA 1ZIOA 1Z47A 4EFNA 4MGYR 2XEXA 2MSCB 4C9BA 2J0UA 2VP5A 3RABA 2IS1A 2G77B 5EP2A 2WAYA 1E2QA 1LTQA 1JJ7A 2F1IA 2ODEA 4NCKA 4Q4JA 1D6JA 2FEMA 3AP3A 2EFEB 2AFHE 3VU9B 4HI0E 3RS7A 3PITA 1J8MF 4R7ZA 3A4LA 2QMEA 2GK6A 2QPAA 3HWSA 2R8RA 3KB2A 1QG4A 5JWRA 4LCBA 4QNRA 3NTUA 5KDOA 3Q7QA 3UWOA 3U3OA 3VHLB 3PFIA 3AVQA 2GRJA 5FOVA 2R44A 3ZYCA 5AUOB 3GFOA 2E87A 4Q21A 1A1VA 3WP0A 1AS0A 1U99A 4DXAA 2GDJA 1BIFA 2BCJQ 4O25A 3TBKA 4D81A 4EFLA 3MGCA 3A37A 3LNCA 4EPXA 4BZXA 1II0A 2V4ZA 3VTKA 3GJ7A 1XMIA 4XSHA 4DSUA 2ZJBA 3AF4A 2Q9CA 5FR1A 3W3AA 3I3SR 3SI7A 1S9DA 1IJEA 1N3BA 2QSYA 1HE8B 2IS6A 4K8OA 1D9XA 2ZI5A 5JSZA 3K70C 4OQFA 4JLBA 3CF2A 1DO0A 3F3YA 1YR9A 3QSYA 2PL3A 3GFTA 2WV9A 5B57C 2MSEB 5EJEA 3PEYA 1RW4A 3AP2A 2PEYA 1E2FA 3KUCA 4RD4A 3V4RA 2FV8A 3X1WA 1HEIA 2FU5C 5DLQC 3KQKA 4Q1BA 1FTSA 4UXIA 3BWDD 3DMNA 1CKEA 2HLDA 1I4LD 2ZRMA 2WMNB 4URXR 2I3BA 3OFND 3EZFA 4G3XA 1U8AA 5HKKA 2YWHA 1W48A 1AKEA 5KO2A 3NG1A 3VHXA 2ZYWX 2IBMA 4D4LA 2B7BA 4YDHB 2OAP1 1MOZA 2RGNA 4I99A 3KKMA 2GETA 3T06B 1Z6AA 1G5RA 2C03A 3U4QA 4B6DA 2OCBA 4MDEA 5HTKA 2WWFA 4HLDA 1QG2A 1YZUA 2QN6A 5EP3A 3BD9A 2RB4A 5EE5B 1GIAA 2ZRHA 3KKOA 4CW7A 5KHOC 5BN4A 2QTFA 4I1SA 2O8CB 4LHXA 1M74A 4A0FA 2XXAB 1SVMA 1WQ1R 4KAXA 2JLXA 3M6AA 4M9SA 3HU1A 5EE3A 4AYWA 1ZUIA 2ERXA 4DRZA 1T6NA 4HB4A 3A4MA 5DSZA 2C95A 2WWXA 2C9YA 1F48A 3GLHE 2P2LA 1KMHA 2F55A 1GNQA 3LVRE 1OYWA 3AVWA 1G6OA 4DIDA 1G4UR 1GNPA 2QG6A 1KGDA 3NC0C 4Q4LA 3K70D 3HR7A 4EJSC 4DSNA 1TEVA 4OHWA 5FBWB 3RANA 4XIGS 4TYYA 3CO5A 2KI5A 2VP4A 2EFDB 4MA4A 4NYIR 4B44A 4EPVA 4HZUA 8OHMA 4MYTA 1CR0A 2XJ4A 1XPOA 1RRCA 4LBZA 1F2UA 4FMDF 2HYDA 3LRPA 2WM9B 2H8KA 1OXSC 1OB2A 3BC1A 4OHZA 3A4NA 2WJHA 2G83A 3R7WA 3TR5A 5DNYB 2PMDA 4Q02A 4PC2A 5FL7A 3SYKA 1FL9A 3D6TB 1N6IA 3AV0B 4LYHA 3K0FA 1TQDA 1VYTA 1E2GA 4E07A 4MYHA 4WOPA 1XPUA 4RD1A 4WXRA 4JYBA 4P32A 4BRWA 1W0JA 2ONKA 1XFAA 1W36B 4QM7A 3B1ZA 4ARZB 4AG6A 4ZV4A 2BBTA 2BMDA 2Z6VA 3AVXA 4QKQA 2J0VA 2IHYA 2P6NA 4A92A 1OT3A 2VL7A 4MQBA 4M22A 1CRQA 2REOA 3PQCA 3QOFA 1E2MA 3HJNA 2VP0A 2PZFA 3DOFA 3CM0A 4Q9HA 5F3WB 4BWYA 3AF3A 1AZSC 4HLUA 4ZCLA 4E22A 2VH5R 2C98A 1ZNWA 5EZ6B 4JLMA 4AG5A 4CEHA 4K46A 4LV5B 1TL7C 2QT1A 521PA 5EUMA 4N0DA 4JVSB 1JPNA 4V0NA 1ELOA 1E69A 4BFUA 2IYQA 4FIDA 4L9WA 4PAOA 3C7KA 1GL9B 2OFWA 1OW3B 2JJ2D 3I8XA 1W7AA 2WJGA 1LF5A 3CLVA 1XDBA 4DDWA 1XP8A 4QJ3A 5DN6D 1I2MA 2BVNA 1FP6A 2HF9A 2XB4A 1VYVA 4NL4H 3SC3A 2Q3MA 1IXSB 1GDDA 3I32A 4U02A 5GVRA 1M34E 3N5CA 2YVUA 2BM0A 5FFMA 4BLRA 1TEXA 5FTMA 1NI3A 2XOKA 3EPKA 4RFVA 3VFDA 4TL6A 2ZIAA 2ENNA 5IRCD 4QGGA 5LB2A 3ZS9A 4B6FA 3A36A 1U94A 5FTLA 2F9MA 4FCTA 3TE6A 2O8BB 2EYUA 3DKVA 1E9CA 1RIFA 3JZMA 4ASUD 2O0KA 1DG3A 1VG1A 1A2KC 2X77A 2QP3A 4IXMA 4CEIA 2VP2A 4MRVA 5HE8A 3WBJA 4OHVA 4DEYA 2RHDA 3WYGA 2ZSFA 3D31A 2CE2X 2ZM5A
chains in the Genus database with same CATH superfamily
3WBFA 1KEVA 2Z4SA 3FHTA 4P31A 2Q21A 1A2BA 5MGNA 4OK3A 1MDBA 1NTOA 5BOSA 4FLEA 2VYVA 3HCRA 3O90A 1XXLA 4RQAA 4AXXA 1CUGA 2PKQP 3V8BA 3WICA 1A9QA 2Q0HA 3DE2X 1WP4A 3F5SA 1C3OA 2P8JA 1U98A 4P81A 4W7IA 3MS4A 2BKLA 4L4RA 4ZKDA 3HCAA 3N8IA 5LA6B 4BXOA 1XKLA 5D6OA 4HGUA 1DWQA 2VNIA 3KOUA 1THTA 3OXLA 1X1RA 3G1TA 4TV8F 4B4VA 1WO8A 2QT9A 4HAUA 3WLMA 3X1ZA 3KUXA 1FVFA 2JJ1D 2EZ4A 3OZTA 3PUWA 4HLQB 2P35A 3ESCA 3QE2A 3WLEA 4CR6A 3TR6A 3WKAA 3AI1A 3U7RA 3HUTA 3E81A 5DNUA 3SX4A 1JEYA 1RYDA 1I7PA 3L4BC 3PUHA 4F4UA 5ECYA 2Q28A 3W9YA 1QK5A 1RQXA 3M70A 2MSWA 3QV1A 5AJHA 1QZZA 1A5ZA 3AMVA 2ZT6A 1FTNA 3NOQA 4GE3A 5EMJA 4LNUA 4JKYA 5DMHA 4BGDA 1EB8A 3DT6A 1Y3CE 3MT9A 2XQJA 4HDMA 5LQMA 9ABPA 1TUSA 2Z0MA 4L4XA 4ZDWA 4BNIA 4X1OA 4O63O 4UFOA 4FDVA 1ZZEA 3T7JA 1HY3A 2VQEB 4DCSA 4DUPA 4EIWA 5FFFA 2P0AA 1NBIA 3R8XA 1MU0A 3OSZA 3JQ8B 4GS5A 4PX2A 5TNXA 3K4PA 3CJTA 1P73A 3P2OA 3IUNA 4LOJA 4LTDA 3JX9A 4RKWA 5DYWA 2GVDC 1DBIA 4L5CA 1N78A 1XTUA 2MDTA 3IRUA 3U3JA 3I5XA 2C4WA 5NULA 4A36A 1JH9A 1NWCA 3FVVA 3GLHB 4GMXA 1WUKS 1I0ZA 3DMRA 4CKWB 2RGEA 2YQZA 1RQNA 2R11A 3L3BA 3AUTA 3HO1A 1PFWA 3P9RA 2XCTB 3INYA 2RHGB 3JWGA 1TM5E 3OM0A 2IUSA 4WNAA 2VK1A 2PX5A 4YP0A 3AEKA 3U81A 2QENA 1EP1B 4ARUA 2ERWA 1ZEJA 3B36A 3RVLA 1ZK1A 1IJBA 2B6NA 2VEOA 2RSLA 1F9EA 2HPHA 1E4YA 2RK3A 3AWDA 3IAS6 3MQ4A 4MS4B 5KKCA 3ESDA 1M1XB 3LOQA 4JQOA 4LPSA 5ECDA 2WDZA 3TIXB 2BE9A 5IS2A 2IYSA 4TWAA 3ZNPA 1Q0HA 3BWMA 4ES6A 1KWKA 4JLJA 3RS9A 2HY7A 4BY9E 4G63A 2XUGA 2CNBA 2QAJA 5L7TA 2FN8A 3KAKA 4ZVQA 1D1SA 1E1RD 2I2AA 3CUYA 5LIPA 4LV8B 3O4FA 3THOA 2A5LA 4PAQA 3WA7A 3KFXA 4F3NA 3ZZMA 4LYJA 5CA0F 2WUDA 3ACBA 1XA6A 4R2IA 4IS2A 3FTDA 3M1YA 1EXDA 1ZGJA 3P2YA 1OLOA 1KP3A 4AZVA 4BMNA 1EK5A 1FLDA 3S99A 2BFFB 3D5EA 3EF1A 3ITKA 3NBZC 3P4YA 5DBIA 2W2NA 2IUYA 3AUKA 4HAOA 1WVIA 1QP4A 1E1CB 1Y1PA 4IDBA 1ZCBA 2HK9A 2ZAIA 1SVOA 1L8LA 3G3EA 4XWKA 4MWBA 1MV5A 5JSKA 2BR4A 2W93A 4ON9A 4POOA 4BZZA 3AIIA 2AN4A 1EFHA 2JFBA 4JB2A 1CCWA 2C4MA 2FF7A 3GGPA 4NNOA 3SS9X 4WUVA 4BO7A 1R50A 5KX5B 4MX8A 5DHAA 1U28A 1ID8A 3HFJA 1YMQA 2V4UA 3EK2A 3GOQA 3VH2A 3AM4A 5HBRA 5TMBA 1OZHA 4N0QA 3D6UA 4WDQA 3T5GA 2ENZA 4BE9A 2X1VA 2PZEA 1C1DA 2ONJA 3LFTA 5GADl 4ARSA 1F4VA 3H2YA 3OE7D 3B2EA 2XGSA 3AHJA 3ND7A 4UASA 3LT1A 5CDFA 2P41A 3ZTYA 1H9CA 2BEWB 4WE3A 1QRDA 4AY5A 2DAPA 2IYNA 3CZ9A 1VECA 3OF3A 4GKBA 2HIGA 2Q3JA 3MD0A 3SYRA 2O0MA 2HL6A 4ND8B 2CB0A 3WLHA 3IGFA 2CLOB 2J9RA 2DMRA 3UXEA 1H2WA 3EIUA 2WCYA 1XJQA 5G53C 4BZWA 4BNXA 1IPEA 2C2KA 3TOCA 4DSTA 1F4LA 3L0ZA 4OF4A 2GAFA 3JALB 3L5KA 5CM2Z 1YQQA 5M34A 1MJFA 3RS8A 1WCXA 1SC9A 2FW9A 3VZPA 4D97A 4XSVA 4FMCF 1HZZC 1VIDA 1R4ZA 4C87A 4DCMA 2WD7B 1PJTA 2H5LA 1G41A 2OBLA 3EQ8A 1U2DC 2W6QA 3MPUA 4MYRA 4L4ZA 4NPHA 4Q9LA 3R5HA 5T8KA 3KQMA 4YRPA 2CHUA 4MVWA 2VKTA 1T5DX 1MKYA 2GEFA 4BYMA 4WP4A 3AWIA 3LUKA 4CCYA 5JOQA 3UATA 1K0UA 1NOJA 1CIVA 2RCYA 1QG6A 2ZEJA 3PF8A 1ZM4A 4G4SO 4CV1A 3ZJVA 2BUSA 2VQFB 3IPAA 3ICVA 3IVXA 4OBXA 4RF2A 4JVLA 2WFMA 1U2PA 4BQSA 1ZN9A 3U7QB 3OWOA 3TECE 4K9RA 5THKA 1PNQA 5A4DA 1DBQA 1ZW6A 2FZ5A 1DPGA 1HLPA 1OAKA 1Z26A 3U4QB 1IEWA 4CKXA 2VDNB 4NYMQ 2QQGA 1G17A 3BK7A 1S8NA 2GK4A 4JBGA 4WH0A 4LC1A 4S24A 4IMIB 3TTTA 2FPGB 1PGPA 4PYKA 5INTA 1AKUA 4KVGA 5BN4B 1BQ3A 1XLWA 3PCXA 5DBOA 2X5NA 3FSGD 1F4PA 3U37A 3V46A 3F97A 3OUTA 4RGYA 2AC2A 3SKVA 2OCKA 1KGSA 1BX0A 1E9SA 2XVAA 3V00A 4C5BA 4NMLA 1ZJWA 1TK3A 2DPGA 2VHJA 3IBGA 2XMSA 3D8RA 4UDNA 3U2QA 4NWIA 1B6SA 4MI1A 1E9FA 2AJBA 1KFEB 4P4LA 4QDUA 1QVVA 2GN2A 1S8FA 5AVSA 3GGDA 1FTWA 2XQKA 2V98A 1Z36A 4FOOA 1E1RA 1QIDA 3GROA 4QA9A 2UZ4A 4H3VA 4XB6B 3LMKA 1DBWA 1GGVA 5C1OA 1NF8A 1BKYA 4EL0A 1KWGA 3TNFA 1U2TA 1ECLA 4I1YA 4QWWA 1HUQA 4L8FA 4M8IA 4UW9A 2R65A 2FR8C 3H5IA 4S35A 2HBYA 5DOZA 5LMNB 5EJ4A 3FYDA 3TCNA 3ZY2A 3IXMA 4I19A 4UVDA 2QK4A 2PYIA 1XMXA 3HP1A 1F2UB 4B0OA 1DFIA 4X85A 3VO9A 4GZ5A 3OO0A 2AMJA 1LV7A 1YR2A 4P4NA 1OVGA 3R3HA 1OFHA 3FOAA 3RAJA 1SB9A 4MMXB 4BX3A 5FAKA 3P9ZA 2WP8J 4IVQA 1B26A 1SHJA 2GXSA 2JAOA 3JRXA 3W34A 3NTVA 2ZATA 4EY7A 4XYGA 1K7SN 2NX2A 4M1EA 1OBOA 2CXPA 3PLNA 3MN1A 1DKQA 4IO1A 1PAUA 3IIIA 5FHRA 5KKAA 3L46A 3L7LA 1HYHA 3FKQA 4NMMA 3WL5A 1LSUA 1FMJA 3D6HA 1JPJA 2EEPA 3ZZ0A 1XZ8A 1FFWA 3AKDA 1GPWB 1XKQA 4DREA 1U8TA 5IJZA 3EZ7A 3UV7A 8GPBA 5EZYB 5JWOA 621PA 4IXWA 3GEHA 2F1JA 5K99A 4MPTA 2JFZA 3STVA 3DF7A 1A9YA 1TLFA 4GLLA 5UKDA 3UOWA 4BMPB 2Z2JA 2NVBA 2A7XA 4J7CA 4PSVA 1L6IA 1Q84A 2VK2A 1P5HA 2D8MA 1L5SA 2IOHA 2YXNA 1OVOA 3BS4A 3B5JA 4OI2A 2EZ9A 4Z5XA 1KI9A 2DEUA 1K4MA 1T3LA 3ZX4A 2G88A 3IILA 5TEWA 1MGPA 5A7GA 2P9FA 2RG1A 2A88A 3EGVA 3ZHYA 4I1IA 4L27A 1E5TA 4JLUA 2Q1SA 1KVQA 1W2WB 1ZLYA 2ISCA 1OI2A 2HCBA 2DFKB 2GCGA 2J3JA 3CR8A 2ZJZA 1GCUA 4PHTA 5J5CA 1E3MA 1X94A 1EJ0A 3ITEA 1E5LA 2L17A 4YASA 4JI7B 4NI5A 3WQRA 4FNAA 4MHSA 2BGLA 4BDSA 3FFXA 1OAAA 2LW7A 3PTLA 2P2YA 4EKIA 1N32B 4Y1RB 3A1TA 3DO6A 1XHFA 3C1OA 5JS6A 1K6IA 5F9MA 4C4RA 4FYVA 3R3UA 2PZBA 5CPBA 4C03A 4D4KA 4BJ1A 4ND4A 1OCEA 2Z2IA 1KI8A 3KLMX 3OXGA 4PBRA 1QGDA 3RWOA 2XNJA 2GKVA 1KMQA 5K0GA 1Y8RA 3ZX5A 3EXHA 4ZANA 1W6RA 3I2FA 4UOZA 4PSAA 4Z4CA 2ZXUA 3KXDA 4ITVA 3A3OA 1RYMA 2XGJA 4G5XA 3N0XA 1NDQA 4HWPA 2CFTA 5K8IA 1NIPA 4KQEA 5H4HA 3LGAA 4DRXB 2HXYA 1MPTA 3DBHB 3C6BA 4U1RA 1S2NA 2JAXA 2X6RA 5FUBA 3GPCA 1L7MA 3F6EX 1F60A 1PSWA 1A27A 2PMBA 4IJVA 5IX8A 1W35A 2YMMA 3SXUB 3JAMA 4B7XA 1CGJI 1A3CA 3BEDA 4KRYA 4B6OA 3WGLA 5CLHA 3TPCA 4B8WA 4MEJA 1EUCA 3VZCA 4KH1A 2KHZA 1CT0I 5KYUB 1IHYA 3LVQE 4FHCA 1U1CA 4I4TF 3CZQA 4YBRA 4YX9A 4BAZA 1MX3A 3DKIA 4HLUC 4LDZA 3V2IA 4B35A 4C20A 3HY4A 2OHFA 4PYMA 1G3RA 1LDNA 2YXDA 4IJQA 1NPYA 1U5BB 1X7YB 3HCWA 4IOLA 4TLLB 5K5EA 2ZE7A 3VO1A 4RGQA 1N6RA 1CIPA 4P92A 4BGIA 4FE4A 4NFLA 2J41A 3TMAA 4LHSA 3CZ5A 4N5HX 4EMTA 4R1QA 5JMPA 5HK9A 4R0VA 2QTHA 1V9LA 3SM3A 4FS8A 3WC4A 5B55A 5JROA 3BTUA 3K16A 3K70B 3FMFA 1Y7PA 3L4KA 3P9NA 4Z7JA 1HE4A 1WXFA 1N5MA 1AM4D 2WJIA 3SIPA 4J0QA 1Z22A 3LWNA 4F86A 4J43A 3GUVA 1XF1A 4TV8A 3RVJA 1NRWA 3KZCA 3KJQA 4UTZA 5C4MA 3MRTA 4RPKA 4TYMA 2GKRI 2QE7A 1YR7A 3JQAD 2PA0A 4XUGB 5EOVA 5T6BA 5DBHX 3VJMA 3B1FA 3RUIA 1PU2A 1MUUA 4C43A 2OD7A 3SEAA 2XNDD 1JFLA 2W2KB 1K3UB 3PC7A 4JLDA 4E11A 3ZGOA 4YMIA 1C7QA 2IPNA 3BHNA 1FSGA 3H04A 3LHFA 1O4WA 1KQGA 2ZIGA 2N71A 4KQJA 4EUSA 4L0CA 5KJCA 1F7VA 1MQSA 1I1NA 3GYBA 2XLBA 1AT1A 1ZM2A 1IB0A 3P9XA 1W0JD 4NRDA 2C59A 2FE4A 1YBFA 2H2IA 1VHWA 2V3VA 1Q1ZA 3ELBA 4AO7A 3O83A 5F4ZA 1JE0A 1FFSA 1P6QA 3EULA 1NE2A 3KJIA 3OIYA 4PPQA 4Q9IA 3K35A 4XX0A 4QRHA 5AVVA 2QBYB 3G5MA 4HUQA 4RADA 1GLNA 4P84A 3HYCA 1GFIA 2FEWB 4HUTA 2ZJ0A 5BORA 4ARCA 5I45A 2JATA 3NHLA 2Z83A 3NAMA 1KP2A 2OV8A 4HNVA 4HNGA 4B6SA 1HYQA 4Y8VA 2AFIE 4REQA 2P6AC 1R9JA 3NHYA 4F21A 5F5XA 1RM3A 2BM9A 1QV9A 3RREA 3CTMA 1QK4A 2GT1A 1U3VA 4HGQA 5D00A 3W06A 1DIGA 3OKFA 1UAAA 1FARA 1USVA 2J8ZA 3PEFA 3EFEA 2NXCA 1F17A 3OOWA 1ZAYA 4KPFC 4GICA 3KD2A 4BNDA 4G1VA 3ZQ4A 3OZCA 4WBSA 2JLSA 1EVIA 4XD7A 2PZ8A 1W52X 5EA2A 2O8EB 3TJMA 2VQ3A 3G9XA 2EQ5A 4ZVNA 2XWBF 1V6AA 4D0LB 4EJSB 1XDUA 2JD1A 2D3TA 4LE1A 2B4RO 1BE1A 1PFUA 2AA3A 2CL0X 5D2CA 3GP8A 2R8ZA 1QRSA 4H7IA 3WLTA 1BUSA 1OA0A 2B99A 1U0FA 5L45A 4MKGA 3TUIC 5CA0A 3WGOA 4RTLA 1E9EA 1OXKB 3G2PA 4JP2A 2O3SA 3GUZA 4NIMA 3LX8A 4A2QA 4NOLA 2RMKA 3MWJA 1T3SA 5FWYA 3UFFA 1W4LA 1TE2A 1NW8A 2NSJA 3GJ5A 1CDZA 1ZCAA 4WXMA 3F8WA 5LWQA 4UM9B 3KYDA 3HE3A 3LPAA 1A96A 5CFLA 3AOGA 3LBAA 1BC5A 3AJRA 3WDLA 4OQXA 5JMOA 4HNHA 4TLCA 1NUUA 3D6AA 3O84A 1ZD5A 3PNVA 1ZD1A 3K9CA 4ZGGA 2YHIB 2IBSA 1XQVA 3E03A 1MO3A 3I9JA 1HDRA 4IXNA 5KNDH 4UDOA 4X1YB 3RQSA 3EDYA 1UWLA 4XZ3A 4L95C 2R7NA 3H5TA 1CPYA 1A8IA 2QJOA 3E2MA 4GXNA 4URUR 4A73A 4B2LA 1KA9H 3R5DA 3TW8B 1Z7BA 4L8GA 2CLDX 1NULA 2JFOA 1V9SA 3OJOA 4R8RA 3DW1X 2YQPA 1FBNA 5CXXA 3U3DA 4CQMD 5IEBA 4EUKA 2A84A 3H1AA 4MV5A 5ES3A 1ADCA 1PTJA 2BE7A 2X8BA 4PC6A 4WIAA 5ICCA 3ZJUA 1TJPB 4GYYA 3UOAB 4DJDC 3Q9SA 1XK6A 2DBQA 3CPSA 2CBXA 4M54A 3EFOA 4QDXA 5D3MA 4BB6A 3AF6A 1QMGA 2GCPA 4F12A 5J59A 3GLFA 1GVNB 1G9TA 1PL7A 1OXUA 4NULA 4KB5A 1MMFB 4N3GA 4TQGA 4R81A 4YCMA 3DVAA 3PHBE 4WEQA 4B0PA 1M75A 1TZKA 2J5KA 1DQZA 1JDVA 3QJYA 1E9AA 4RZQA 3DXZA 3HCNA 3VO8A 4CM5A 4BFXA 3KJGA 2WF8A 3HPRA 3WO1A 1H1LB 1TRHA 2Q5JA 2PX0A 3OEED 3IDOA 4EVSA 3EZLA 4N0MA 4N8DA 4EQ6A 1NFQA 1P72A 1RLTA 2NZVG 4QYIB 2X5OA 4XVQA 3W2GA 4OI0A 4QJ5A 3G2OA 2XNDA 4OL9A 1YZKA 2PNJA 1E3WA 1MD9A 3EBOA 2ZW9A 1KBZA 2EAUA 3JQBA 3QELA 4K9PA 4OHXA 2QP4A 5HIIA 1ONNA 2QR3A 3STUA 3CUEF 1A8QA 1TCCA 1UBLS 2WD9A 3ANTA 3DMYA 5BSTA 4XFJA 4E1VA 1ZN7A 4KLRA 4L7VA 1J2YA 5JSQA 4AU1A 1XMOB 3OMLA 4PQRA 4EA8A 1Q2XA 2YFHA 3AR2A 4LY6A 2XB8A 3KQVA 1TLTA 4QYMA 2C77A 4JI0B 1E58A 1SUCA 2HWUA 3LFHA 2MIIA 4DWWA 2IYXA 1CEQA 1OGJA 4MDFA 3BF8A 1KMCA 2IEZA 1DCMA 2IYTA 4JOCA 4LSWA 3ROMA 3WLIA 4DBLC 1Y33E 3IDAA 4F46A 3E3AA 4F4HA 1IZ8A 3EIEA 3MBKA 3D6FA 2NPOA 4KBFA 1QK3A 4L9RA 1LC0A 5CNJA 4DCJA 2VXYA 4B17A 3CEAA 3ONFA 5DEIA 3ZXXA 4YMVA 2V74B 4Z6KA 1YU9A 4OXYA 3U16A 5EINA 2A3NA 2F48A 4DCCA 1CSEE 3RYHA 1EQ2A 4V0RA 1TJ5A 2VYNA 1LLQA 3D02A 3DB1A 4EFKA 1KAGA 2AXPA 3CXUA 5CVJA 1SURA 1TIHA 2WHYA 5DI3A 2PPLA 3P9SA 1XRLA 1V1JA 4B73A 3MMXA 4KMMA 3L7DA 1ESNA 1IHUA 4Q1FA 1T9ZA 5CJ2A 2W70A 1IY6A 3VZQA 4BMOB 4DB4A 3U61B 4TZTA 4JBHA 4IDEA 1WP9A 2PZMA 4MKRA 2V7EA 2VVTA 3U7GA 1BA2A 1GNTA 2OFFA 1HLGA 2OQ2A 3NVDA 2E89A 3IQDB 2WW8A 3HA3A 4OYRA 1K5HA 3HDHA 4MO9A 5A6SB 4R6WA 2WSLA 5ILGA 2QT0A 2Q4RA 1E9VA 4LWQA 1W25A 2FK7A 1UDAA 2E4AA 3LUFA 4G65A 1G19A 1WKCA 4EELA 3TQIA 2CJWB 4YI5A 4HVAA 2D13A 2NQTA 3EOBI 4LS3A 4XA8A 2C7PA 1NNUA 3L0SA 4QPNA 4AF6A 1QS0A 3EXEA 3MJTA 4AJ4A 5JBNA 1W29A 4NH4A 2WFAA 5JAMA 2GRUA 3OFJA 2ID7A 2AFIB 2XBMA 2QLLA 4AP5A 1NBMA 3HZRA 4YEDA 4XYLA 1AX9A 1ZJJA 4OPMA 2DQKA 3S28A 3WMFA 1T9GR 4Q4HB 4C7OA 5C46F 1RYHA 4WX2B 1L4YA 1OLXA 4JEMA 1UDRA 2P4SA 2ZK7A 4PX5A 3Q7EA 4I3HA 5KOIA 3C6KA 1B0ZA 3GH1A 5ALIA 1YB7A 3S8YA 1U3FA 1P61B 2EW2A 4WKGA 1RADA 2ZUVA 4DWJA 5KYYB 4MVJF 4B85A 3SBXA 2CEKA 3IQFA 2R6AA 3PG5A 3ZCQA 5C32A 2A0WA 1YAHA 3JAWA 3C3PA 4G2TA 4N76A 3FRJA 1XDWA 4ZAZA 1I5EA 2HXSA 4GMGA 3OJXA 4LVUA 4Q48A 1PYGA 5B7GA 3ILXA 1F20A 2VZLA 3NM6B 1KPGA 4IIDA 4FPXA 3A9RA 1PVOA 3AIMA 4QOFA 4S0ZA 5G0TA 3SVLA 2XTNA 1B00A 1CS0A 2XVXA 2NO1A 3F90A 5CEEA 4DLNA 5HIJA 1AK1A 2RAUA 3NOXA 4DG5A 4CDMA 3E53A 3GVIA 2BGIA 2YV1A 3OFSA 4L85A 3H5WA 3IC5A 3UGJA 2XCIA 3FTEA 1KEZA 1K5DA 2ZFUA 4R9VA 3G23A 4W9NA 1SOWA 4B76A 2E7ZA 4M55A 4TYQA 1KI6B 5H9VA 2ZETA 3IJRA 4W5WA 3DZDA 3DVQX 4JB3A 4GAEA 2E48A 4J3NA 1W73A 4AY3A 4BP3A 4D5GA 3RUDA 3PUVA 1IZYA 1FDIA 2NO6A 2ZSKA 2O2JA 2VXCA 3D0QA 3D7NA 3OEEA 3K9LA 3P0EA 1M6VA 1YZQA 3OCWA 4BCDA 1L8QA 1U7WA 1UMBB 1OIXA 1D0VA 1UH5A 2P1DA 3EXG1 3OLVA 3AESB 3W5IA 2JF0A 4H7PA 5E4JA 4BB9A 1CT2I 2G5GX 1KR2A 3LZDA 4D8VA 5BMOA 2WUGA 4QXPA 1HSZA 2HQSA 2WMOB 2FJPA 1U0LA 1BCSB 1XC7A 3GJ3A 2EKDA 2GARA 1MJ5A 1Y5IA 2Y67A 1X80A 4HO1X 3S4YA 5CVTA 2JPDA 2F3SA 2B5OA 2BHLA 5EKUA 1OLSA 4I5GA 4O02B 4XQGA 5G1NA 5AUNB 1LC3A 5BN5A 4CETA 1MT3A 3F1LA 1H2BA 1LPAB 1SKUA 4M1TA 1WCV1 3T38A 4A0SA 2PT5A 3LXXA 2XYGA 5CBPA 3ROFA 2GSWA 5JBQA 1EE1A 4JOBA 4BKOA 2JGDA 5FBHA 1QQ7A 2YIMA 3ZV4A 3DMDA 3KOOA 2G1PA 4IDNA 5HZKA 4REMA 2R00C 2J3LA 4RW0A 4RO0A 1P9OA 2ETXA 4GPZA 3OP1A 2Y6VA 4DEVA 1DUVG 2HGSA 4IKPA 3GD7A 1TMGE 3W8FA 3OZUA 1KBOA 5E6SA 1GO2A 2JCSA 1QFYA 2IY7A 1YQDA 2JEZA 2FY8A 2FOXA 2G9VA 2FFBA 3BVPA 1QR2A 3GUYA 4X93A 2DY0A 2VI5A 3UG7A 1EX6A 4I4TA 3SE7A 1SKBA 2GEVA 3KR9A 3OFVA 4GRIA 3EUFA 4IQ0A 4V0QA 1Q2UA 2HF8A 3IMKA 5E8JA 1BDIA 3OMWA 3QPUA 4HBZA 3TEJA 1CUJA 5K05A 3P9YA 2ZI6A 5J4YA 2IYZA 1K6JA 4JASB 1UBKS 3UOGA 1YQGA 3WHIA 3DLIA 5E7MA 4DMKA 1HDXA 1A8PA 3VDPA 1YZLA 3ROPA 2CT8A 4N4AA 2BTEA 1T5IA 4MLDA 3S3TA 2ZR8A 1S3FA 3PU6A 4LE2A 1QR6A 2GZAA 2WIAA 3NDBB 2BMFA 5H1YA 1DJNA 1RLOA 1L9KA 3R6TA 5BV2P 2A3RA 2VC2B 2G63A 4LSZA 4G09A 2OYRA 3AKEA 4L4UA 3EVBA 2J9ZB 5A5GA 2XBLA 1G3MA 3CF4A 2GEDA 2DYKA 5FUYA 2UVPB 1PGQA 5AW9A 4QLAA 2PL5A 3DVLA 4DUGD 4MUJA 1FC0A 2H06A 3ZJYA 4HDRA 1V8FA 2H2AA 3HVUA 3L8EA 1KI1A 3FN4A 3MSXA 3ICWA 4TMXA 1XVLA 2M98A 2CNWA 2JFNA 2O2HA 4FHGA 4FR5A 3FNGA 3RRNA 4C0XA 1RFHA 1KDPA 2C29D 2E18A 2F3PA 5IHPA 3Q0TA 2GAAA 4FHEA 2GN9A 2X0KA 4J1TC 4DNPA 3ECAA 1MV8A 4NR0A 1IOLA 1NW5A 1W4ZA 3L05A 4N7JA 4EEZA 2PZKA 1J07A 2XQGA 4DJTA 4L8LA 3VVCA 3MRSA 1ZM9A 1JFRA 2TRSB 4K1XA 2W98A 5HDQA 1UWKA 3QWBA 2VTBB 1TZJA 3E59A 4K8RB 2WABA 2VJPA 1O9HA 1PT9A 3B1XA 3MF4A 4Y6SA 2X76A 1R6DA 2ZS8A 1CQZA 4N54A 2VJMB 2YV5A 3CLUD 3I9NA 5CVEA 3DVRX 2JFWA 4W8OA 3P9PA 3QQ5A 4YRQA 3RJMA 4AZ0B 2XXAA 2W2LA 2Y1GA 2OC4A 3KZKA 3LY9A 3IT1A 4MV3A 3EA5A 2FW6A 4IGEA 1KKMA 4BE7B 1Z0JA 2G5PA 3HI4A 2JFPA 4IH9A 5CG1A 1EGVB 4M0UA 1FDSA 2C9CA 1UKBA 3E5HA 3NU1A 1UBTS 3B8EA 3LY5A 2XT9A 3BJRA 3FCCA 4FEAA 4Q7KA 4YAGA 4WCDA 3HJBA 2VKQA 4ER0A 4KQ2A 1SN7A 2P4UA 3ZY5A 5AW8A 4YWHA 1ODJA 2EQAA 2B34A 2YOHA 3PJEA 5K0SA 3I83A 3NWPA 2Y71A 2QXYA 3ROKA 2DLNA 3MVEA 2I3AA 1M1NB 3ABRB 3BDAA 3EHEA 2HHCA 3MBOA 3S1AA 3PC6A 3ZJ4A 4O6VA 5HJ5A 5I6DA 1A7KA 2AG8A 1P33A 2JGFA 2XRYA 3EQ6A 3VBCA 3L0YA 4UBJA 1KHHA 3E9QA 4MUMA 1BHJA 3U5TA 3IAAA 4MAAA 4X44A 4OGGA 5BYKA 4ZTZB 4FDTA 5CK4A 4Y0VA 2BMVA 4IX9A 3AHCA 3IAHA 3D3JA 3DNFA 2HB6A 2NU9A 1IWOA 3LBHA 5ERXA 4BATA 5JD4A 4XDZA 5HE9A 4KSCA 1VKJA 2XKKA 4P58A 1Z29A 1NXWA 3L43A 1Q7EA 3OZXA 5ENZA 3IUQA 2VDWA 3FYUA 1C7RA 1P5FA 2NYUA 3JQGA 3OQBA 2DB3A 5M7EA 1O87A 3BICA 1KE1A 4HEQA 1NSTA 3KB1A 5DMXA 1KQOA 1WXDA 1E96A 1N0HA 3R24A 3NHFA 4P2GA 4PNPA 5C4GB 3A27A 5K6AA 5KMGB 3WJ7A 3HCEA 2OLEA 1UKZA 3BX1A 3O21A 2JI7A 2E4UA 2Q7DA 4I2NA 4EP1A 2HLPA 4QX6A 1EHIA 1IBRA 1DV1A 1I3OA 2IXTA 1ODSA 2YN2A 3HKEA 3PEUA 4BVBA 3NVAA 1GGKA 3BQMB 1OWOA 2YWFA 1MW8X 1LDBA 3PDWA 1Q0SA 4Q4AB 1XCJA 1WHTB 1T9AA 3F6BX 3CNBA 2Q5OA 3HP4A 4MVJD 5C3UA 2DWOA 2XMCA 3CSDA 4J9VA 2JGAA 4UQLA 3A9VA 1K9VF 1P1KA 3AILA 3NM4A 4Z0HO 2NUAA 2Z57A 1A5SB 5F23A 1POXA 1QH9A 1BVHA 5K3OA 1KRWA 3TQSA 5B4TA 3WJ1A 1BXKA 2O8NA 2SCUB 3DAGA 4Z0PA 3S2EA 3HVRA 5TB5A 2NU2I 1IY0A 2QM8A 3BGSA 3HNOA 1WF6A 3F2VA 2XOXA 4G56A 1TK2A 4HH0A 4IQ4A 4KCGA 3MGBA 1QFJA 2F64A 2PS0A 2ECPA 3AHEA 3ADPA 2B1QA 1LPSA 4NKRA 4DV6B 1OH8A 5C7IO 5FRDA 3PDIA 2V1CA 3ETDA 3L77A 2QLNA 1TJYA 4RZXA 3V8MA 2WU0A 3NNSA 1T0IA 1HKUA 1ZXLA 5EJ9A 2WM8A 3BT7A 2VHEA 4E09A 2YZ2A 5A2GA 1I4EB 1N0WA 3KSMA 5AMXA 2KM1A 1EFVA 4AN4A 2FRDC 3JW8A 3WRVA 4CIDA 2BISA 4DUGA 1Y8FA 1U9ZA 1I7NA 4RJKA 4HTAA 4RCZA 3WWPA 1V16B 2P11A 1MT1A 4QYWA 5FUXA 4HCJA 4LRTB 4Y2RA 3QU4A 1TRKA 4I55B 3UZUA 4AT1A 2EFGA 4ZYLA 2JLZA 1OOEA 4K7JA 5IK2A 1CR4A 3FTNA 3PC3A 3DH0A 3WGMA 1KP9A 4Y2TA 4EA7A 3C8HA 3T3HA 9GPBA 3HJUA 4JD5A 5JDIC 3UNXA 4D9KA 2FWBA 4RQBA 1X7GA 1WW2A 4KITB 1P8JA 4N7RA 4KO8A 5HCNA 3ZY6A 1QTNA 1RI5A 2Q5QA 3PXEA 3IUMA 2QUKA 4LE0A 4NQZA 1TPYA 1YDHA 4ZI2A 4N5MA 4E21A 4OUKX 1T2CA 5KYNA 3THWA 4TMVA 1W0KD 3FXAA 3GLQA 5EZYA 4B8ZA 2XWPA 3NHRA 4GOMD 2QX8A 1UBHS 4OHYA 2ROQA 1OMTA 2XUJA 1IY2A 1RMYA 4RFSA 2B2XA 3I2IA 4OOEA 4Y0NA 3V4OA 3A6EA 3EDCA 1MOPA 2EATA 3MGKA 2OZKA 1T9BA 2D1SA 3QLVC 4AKIA 4WJLA 1NG9A 1MOQA 3IAS1 1N7GA 5G2OA 3C5CA 1LPBB 4TV9B 4BX9A 1TMKA 4F3RA 5BO5A 4A6DA 4YV2A 2FLVA 1V4BA 3OEHD 4PFQA 3UK7A 1ZVVA 3UGIA 3LD9A 2W8BB 1CZNA 2ORWA 2GH1A 4KOEC 2Q1UA 4DBLE 3BA6A 1L7EA 3UKJA 3BSWA 3FD8A 1OXTA 1NR5A 1MO6A 4KXFB 4CF5A 5J1SB 2WE8A 4AKGA 1FJ2A 3USCS 2X23A 2FOLA 4KYVA 4N8EA 3R5CA 1TO1E 2D2FA 3FNRA 3DWIA 1GILA 3KYIB 4M1MA 4TTQA 5T4EA 3DR3A 3RBZA 4DJJA 2I6XA 3N75A 4BMYA 1A7JA 5AQ1A 1MFPA 3VGJA 4B7AA 1QZXA 4US0R 2O50A 3MCTA 4V2IA 4BFWA 4BFLA 2L2QA 3ZTTA 4DZRA 1QX3A 2VDRB 1JR3D 4PC7A 3THRA 3VA7A 4O5AA 4HLCA 3LW7A 2VDOB 1GA6A 3HM2A 2OFPA 4CCWA 2HU2A 2ZTHA 1U9IC 1JA9A 1ENYA 5IH3A 4F5WA 1LDGA 1P44A 1LUAA 4XWOA 1PEAA 1L5KA 4A6PA 1T2EA 1V3QE 2Y9MB 5C0OE 1HURA 3DAPA 3PHGA 3RYCB 4MMZB 2X58A 1X70A 5BR8B 1C8VB 1IUOA 2IPLA 3GFFA 3G1WA 4J9UE 5JQGB 3G49A 4OKSA 4RE5A 4TKVB 1F6WA 2EBHX 4FFRA 1P9NA 2RG7A 1XAJA 3PNKA 4HRAA 1SXJC 4P5PA 3U7EB 5AHXA 5C7OO 4G5GA 5BV1A 2CC2A 4D46A 4OAPA 5JATA 5BSFA 2VBIA 3PQDA 4E5YA 3ZCTA 1KEUA 2VJDA 1CB0A 1WB5A 1PX0A 2WSMA 3DKPA 3I1FA 3GEBA 5JSUA 5ESDA 2QL6A 3JZFA 2XZPA 4DADA 1MRNA 3RARA 1KTIA 2F9FA 3ZD6A 2W6CX 3DM9B 2ZAMA 4HJXA 2Q41A 4YFYA 5E9AA 3TXYA 5FWAA 1VPTA 1AKMA 1PEYA 4UULA 2C9ZA 1GNLA 4ND2A 2I80A 2WUEA 3DTVD 1IDN1 1QB7A 3GRFA 4JEHA 4MQEA 1PS9A 2HDNB 4Q9JA 5KCMA 5DT2A 4AJNA 1Z0ZA 3L1KA 4ZOBA 2CXOA 1HNNA 4WXHA 5HCUA 5T41A 4EO9A 4YRMA 4DHWA 4BN0A 2YJZA 4JUAA 3ZI7A 2QL7A 3CT4A 3ONVA 2I78A 4M1QA 1LU9A 2C2GA 4G8DA 3PJGA 4E1BA 3ODPA 1JGTA 4Z9BA 1GP2A 1X7HA 4KIWA 3MT8A 2V54A 5FOSA 2WNSA 4KR0A 1Q15A 1O95C 4PE5B 5KIAA 3K15A 2PGXA 2X42A 3OVMA 3OPMA 1IHOA 1C5KA 1QCZA 2OCDA 1VZ2A 1KZ7B 1XZCA 3B4VC 3BJEA 2Q3LA 3Q3VA 4WLNA 4L75A 2ZRFA 1DC8A 5ELMA 3THXB 1T3GA 2WKRA 4GG1A 3BRWD 3U9LA 4B48A 2P2CA 2FXIA 3ILVA 1E1QD 3Q8LA 1DINA 3CC8A 4KN6A 4DLSA 4HFMA 1LX7A 3IERA 1HWYA 2FKAA 1E59A 3W5UA 2B8NA 3IOYA 2R751 5KC9A 4PQGA 3WB2A 1AO0A 4IHKA 2DQZA 1NVUQ 5IT0A 4RVNA 2NSHA 1UJMA 1NYTA 2A5GA 4JUIA 4UBKA 1N3LA 3W78A 2GXAA 3Q8WA 3SXJA 4EO7A 1V8ZA 5H9WA 5F2KA 1XAHA 1PDVA 1WCIA 1KEPA 2NAFA 2C9OA 3OT1A 4B47A 4UBLA 5KOHA 1JFSA 3L18A 3C3AA 3EVEA 1U6KA 3BBLA 2A57A 2X3UA 2B0UC 1G1MA 5MN4A 3RUPA 2ZB3A 3M5DA 3DDWA 2Q3EA 2H54A 4Y9TA 3KYCB 3O8OB 3CH7A 1W0KA 2ZIVB 4Q7EA 3HEAA 4PFKA 2ZVPX 3TRJA 4RZ3A 1SUWA 3I5UA 5DYGA 4EHJA 4YCJA 5AI8A 1U3TA 3TDKA 1AS2A 2XCSB 1G9SA 1LDYA 5EJAA 1WGCA 4PLFA 2UYQA 1DUIA 3SR3A 5ENDA 3AI2A 3DMFA 5DSXA 4IQFA 5HX7A 1VXRA 1TU4A 2REQB 3KTAA 4HMOA 2UUCB 5CT6A 1F8YA 3K8QA 2P1ZA 4G84A 3FPEA 4ISBA 4AZSA 1IHDA 5IEJA 5LZ4A 3WHKA 3BMNB 5FA8A 1EGHA 3WGYA 4I1OA 1R6VA 3UCFA 1GUFA 3O9ZA 4DQVA 4IH1A 4XR9A 1RKXA 2NU7B 1I3NA 1N0UA 2YMQA 4M0MA 1T2UA 3ANXA 4B33A 1TT5A 3UFXB 1TTQB 2O2SA 2PUVA 1ATIA 4U3JA 4YMHA 4XOIA 3E1SA 2FVYA 4J6EA 221PA 2IJGX 2VF4X 2QD3A 4EG8A 5HUJA 5CLLA 4R1LA 1XYVA 1U4NA 2A14A 5AVRA 4CKYA 5HGJA 3P97A 5JJLA 3FVRA